F426427

General Info

Members Datasets Scaffolds Average Seq Length
373 183 373 249

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0833523|Ga0436362_0833523_1291_2127
Length 278
Sequence VAISATKARARSITCGQWGGRGEEEEDKTMLATIYIMWLREVKKFLRSPSRIIGALGQPIFYLIALGYGLGAVFQAAGRGNYIEFLAPGIIGMSIIFSSIFNGMAVIWDRQFGFLKETMVAPVPRFAIMFGRTLGGATVATFQGCIVLGLTFIFGFHPYSWTLIIPAICIMLLVAMLFSSMGLMVGSLLSDMQGFQLIMNFLVMPMFFLSGSLFPLQGIPTLLSAVAHIDPLSYGVDAMRTLLIHVSAFGLPLDISVLSVITLIFLGLGSYFFSRIQI

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 1.34
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10015795 3300005327 Bacteria 6035
2 Ga0070683_100018261 3300005329 Bacteria 6209
3 Ga0070670_100016668 3300005331 Bacteria 6306
4 Ga0068869_100005462 3300005334 Bacteria 7997
5 Ga0070666_10170713 3300005335 Bacteria 1523
6 Ga0070680_100044726 3300005336 Bacteria 3598
7 Ga0070680_100257690 3300005336 Bacteria 1475
8 Ga0070682_100153836 3300005337 Unclassified 1581
9 Ga0070682_100154062 3300005337 Bacteria 1580
10 Ga0070682_100160318 3300005337 Bacteria 1553
11 Ga0068868_100000334 3300005338 Bacteria 31757
12 Ga0070660_100068022 3300005339 Bacteria 2776
13 Ga0070689_100417438 3300005340 Unclassified 1137
14 Ga0070689_100564874 3300005340 Bacteria 982
15 Ga0070691_10109105 3300005341 Bacteria 1382
16 Ga0070661_100111961 3300005344 Bacteria 2039
17 Ga0070671_100003655 3300005355 Bacteria 12044
18 Ga0070674_100001651 3300005356 Bacteria 12029
19 Ga0070673_100094151 3300005364 Bacteria 2455
20 Ga0070673_100672577 3300005364 Archaea 949
21 Ga0070688_100124039 3300005365 Archaea 1734
22 Ga0070659_100009195 3300005366 Bacteria 7252
23 Ga0070659_100445929 3300005366 Bacteria 1097
24 Ga0070667_100005910 3300005367 Bacteria 10188
25 Ga0070714_100027330 3300005435 Bacteria 4724
26 Ga0070714_100265949 3300005435 Bacteria 1589
27 Ga0070713_100054898 3300005436 Unclassified 3308
28 Ga0070713_100118075 3300005436 Bacteria 2322
29 Ga0070694_100049893 3300005444 Unclassified 2819
30 Ga0070708_100029276 3300005445 Bacteria 4748
31 Ga0070681_10004147 3300005458 Bacteria 13706
32 Ga0070681_10016961 3300005458 Bacteria 7276
33 Ga0070681_10042182 3300005458 Bacteria 4573
34 Ga0070681_10055693 3300005458 Bacteria 3936
35 Ga0068867_100424006 3300005459 Unclassified 1128
36 Ga0070706_100000434 3300005467 Bacteria 50174
37 Ga0070706_100453244 3300005467 Bacteria 1194
38 Ga0070707_100163073 3300005468 Unclassified 2172
39 Ga0070699_100044371 3300005518 Bacteria 3850
40 Ga0070679_100039829 3300005530 Bacteria 4672
41 Ga0070679_100082291 3300005530 Bacteria 3209
42 Ga0070679_100107918 3300005530 Bacteria 2770
43 Ga0070679_100394532 3300005530 Bacteria 1330
44 Ga0070679_100535324 3300005530 Bacteria 1115
45 Ga0070679_100647149 3300005530 Unclassified 1000
46 Ga0070684_100001161 3300005535 Bacteria 18892
47 Ga0070684_100256751 3300005535 Bacteria 1598
48 Ga0070697_100001114 3300005536 Bacteria 20315
49 Ga0070697_100396942 3300005536 Bacteria 1196
50 Ga0068853_100000800 3300005539 Bacteria 21859
51 Ga0068853_100891281 3300005539 Bacteria 854
52 Ga0070686_100051592 3300005544 Bacteria 2619
53 Ga0070696_100036122 3300005546 Bacteria 3405
54 Ga0070665_100040854 3300005548 Bacteria 4662
55 Ga0070665_100114987 3300005548 Bacteria 2693
56 Ga0068855_100000808 3300005563 Bacteria 38711
57 Ga0068855_100002418 3300005563 Bacteria 23041
58 Ga0068855_100004110 3300005563 Bacteria 17753
59 Ga0068855_100016532 3300005563 Bacteria 8875
60 Ga0068855_100070429 3300005563 Bacteria 4068
61 Ga0070664_100017236 3300005564 Bacteria 5931
62 Ga0070664_100418568 3300005564 Bacteria 1227
63 Ga0068857_100000395 3300005577 Bacteria 30659
64 Ga0068857_100241996 3300005577 Bacteria 1652
65 Ga0068857_100624079 3300005577 Unclassified 1020
66 Ga0068857_100772467 3300005577 Bacteria 916
67 Ga0068854_100011707 3300005578 Bacteria 5721
68 Ga0068856_100006431 3300005614 Bacteria 11528
69 Ga0068856_100016868 3300005614 Bacteria 7078
70 Ga0068856_100017024 3300005614 Bacteria 7045
71 Ga0068856_100245611 3300005614 Unclassified 1805
72 Ga0068856_100262551 3300005614 Bacteria 1742
73 Ga0068856_100840523 3300005614 Bacteria 937
74 Ga0068852_100000009 3300005616 Bacteria 149600
75 Ga0068852_100002047 3300005616 Bacteria 13739
76 Ga0068852_100046843 3300005616 Bacteria 3685
77 Ga0068852_100278659 3300005616 Unclassified 1611
78 Ga0068852_100436425 3300005616 Unclassified 1294
79 Ga0068852_100763486 3300005616 Bacteria 979
80 Ga0068859_100018631 3300005617 Bacteria 6978
81 Ga0068859_100028554 3300005617 Bacteria 5593
82 Ga0068864_100000703 3300005618 Bacteria 28109
83 Ga0068861_100424642 3300005719 Bacteria 1185
84 Ga0068851_10016410 3300005834 Bacteria 3543
85 Ga0068851_10089122 3300005834 Unclassified 1622
86 Ga0068851_10104064 3300005834 Bacteria 1509
87 Ga0068863_100002707 3300005841 Bacteria 17508
88 Ga0068863_100332937 3300005841 Bacteria 1476
89 Ga0068858_100004230 3300005842 Bacteria 14131
90 Ga0068860_100001296 3300005843 Bacteria 27187
91 Ga0068862_100047848 3300005844 Unclassified 3650
92 Ga0070717_10300854 3300006028 Bacteria 1426
93 Ga0070717_10330297 3300006028 Bacteria 1360
94 Ga0070716_100030532 3300006173 Bacteria 2924
95 Ga0097621_100000518 3300006237 Bacteria 27043
96 Ga0097621_100274893 3300006237 Bacteria 1481
97 Ga0068871_100000818 3300006358 Bacteria 20836
98 Ga0068871_100092702 3300006358 Bacteria 2519
99 Ga0068871_100445461 3300006358 Bacteria 1160
100 Ga0075428_100001739 3300006844 Bacteria 23246
101 Ga0075428_100555146 3300006844 Bacteria 1228
102 Ga0075430_100028787 3300006846 Bacteria 4718
103 Ga0075430_100150349 3300006846 Bacteria 1939
104 Ga0075431_100048210 3300006847 Bacteria 4393
105 Ga0075431_100292177 3300006847 Unclassified 1648
106 Ga0075433_10141952 3300006852 Bacteria 2134
107 Ga0075434_100022111 3300006871 Bacteria 6193
108 Ga0075434_100121735 3300006871 Bacteria 2625
109 Ga0075429_100137222 3300006880 Archaea 2141
110 Ga0075429_100439790 3300006880 Bacteria 1143
111 Ga0075436_100129713 3300006914 Bacteria 1767
112 Ga0097620_100018631 3300006931 Bacteria 6978
113 Ga0097620_100028554 3300006931 Bacteria 5593
114 Ga0105240_10000148 3300009093 Bacteria 142265
115 Ga0105240_10000184 3300009093 Bacteria 126650
116 Ga0105240_10003298 3300009093 Bacteria 25231
117 Ga0105240_10004349 3300009093 Bacteria 21628
118 Ga0105240_10010183 3300009093 Bacteria 13233
119 Ga0105240_10011941 3300009093 Bacteria 12042
120 Ga0105240_10020051 3300009093 Bacteria 8926
121 Ga0105240_10021102 3300009093 Bacteria 8671
122 Ga0105240_10026495 3300009093 Bacteria 7606
123 Ga0105240_10028713 3300009093 Bacteria 7257
124 Ga0105240_10079463 3300009093 Bacteria 4036
125 Ga0105240_10145691 3300009093 Bacteria 2826
126 Ga0105240_10329923 3300009093 Bacteria 1737
127 Ga0105240_11015850 3300009093 Unclassified 886
128 Ga0111539_10117300 3300009094 Bacteria 3121
129 Ga0105245_10001000 3300009098 Bacteria 25662
130 Ga0105245_10016213 3300009098 Bacteria 6493
131 Ga0105245_11248982 3300009098 Unclassified 791
132 Ga0105247_10003975 3300009101 Bacteria 9513
133 Ga0114129_10003691 3300009147 Bacteria 21558
134 Ga0105243_10544406 3300009148 Unclassified 1108
135 Ga0105241_10000869 3300009174 Bacteria 22911
136 Ga0105241_10002836 3300009174 Bacteria 12950
137 Ga0105241_10037355 3300009174 Bacteria 3658
138 Ga0105242_10060496 3300009176 Bacteria 3112
139 Ga0105242_10404949 3300009176 Bacteria 1274
140 Ga0105248_10002961 3300009177 Bacteria 18814
141 Ga0105248_10004803 3300009177 Bacteria 14957
142 Ga0105237_10001697 3300009545 Bacteria 28502
143 Ga0105237_10008032 3300009545 Bacteria 11478
144 Ga0105237_10195686 3300009545 Bacteria 2021
145 Ga0105237_10332382 3300009545 Unclassified 1524
146 Ga0105237_10341042 3300009545 Unclassified 1503
147 Ga0105237_10346418 3300009545 Bacteria 1490
148 Ga0105237_10628162 3300009545 Bacteria 1081
149 Ga0105238_10001126 3300009551 Bacteria 26949
150 Ga0105238_10002350 3300009551 Bacteria 19022
151 Ga0105238_10014130 3300009551 Bacteria 8074
152 Ga0105238_10015039 3300009551 Bacteria 7836
153 Ga0105238_10040172 3300009551 Bacteria 4741
154 Ga0105238_10064370 3300009551 Bacteria 3666
155 Ga0105238_10076722 3300009551 Bacteria 3334
156 Ga0105238_10231848 3300009551 Bacteria 1823
157 Ga0105249_10014871 3300009553 Bacteria 6883
158 Ga0105239_10003426 3300010375 Bacteria 19426
159 Ga0105239_10048017 3300010375 Bacteria 4679
160 Ga0105239_10056049 3300010375 Bacteria 4323
161 Ga0105239_10057259 3300010375 Bacteria 4275
162 Ga0105239_10083927 3300010375 Bacteria 3508
163 Ga0105246_10001916 3300011119 Bacteria 12536
164 Ga0157370_10000059 3300013104 Bacteria 116740
165 Ga0157370_10013611 3300013104 Bacteria 8371
166 Ga0157370_10168288 3300013104 Bacteria 2038
167 Ga0157370_10507946 3300013104 Bacteria 1107
168 Ga0157370_10564456 3300013104 Bacteria 1043
169 Ga0157369_10000035 3300013105 Bacteria 191300
170 Ga0157369_10026388 3300013105 Bacteria 6444
171 Ga0157369_10032558 3300013105 Bacteria 5732
172 Ga0157369_10086935 3300013105 Bacteria 3338
173 Ga0157369_10099763 3300013105 Bacteria 3095
174 Ga0157374_10005708 3300013296 Bacteria 10498
175 Ga0157374_10057535 3300013296 Bacteria 3631
176 Ga0157378_10001112 3300013297 Bacteria 24468
177 Ga0157378_10033955 3300013297 Bacteria 4512
178 Ga0157378_10098226 3300013297 Bacteria 2670
179 Ga0157378_10314425 3300013297 Bacteria 1520
180 Ga0157378_10346871 3300013297 Unclassified 1449
181 Ga0163162_10371458 3300013306 Bacteria 1563
182 Ga0157372_10000049 3300013307 Bacteria 142350
183 Ga0157372_10010693 3300013307 Bacteria 9765
184 Ga0157372_10024244 3300013307 Bacteria 6587
185 Ga0157372_10035355 3300013307 Bacteria 5500
186 Ga0157372_10054588 3300013307 Bacteria 4458
187 Ga0157372_10121006 3300013307 Bacteria 3006
188 Ga0157372_10188842 3300013307 Unclassified 2386
189 Ga0157372_10321900 3300013307 Bacteria 1800
190 Ga0157375_10001018 3300013308 Bacteria 24251
191 Ga0157375_10035677 3300013308 Bacteria 4749
192 Ga0163163_10001812 3300014325 Bacteria 18020
193 Ga0157380_10252622 3300014326 Bacteria 1597
194 Ga0157377_10041668 3300014745 Bacteria 2548
195 Ga0157379_10000232 3300014968 Bacteria 43528
196 Ga0157379_10076890 3300014968 Bacteria 2989
197 Ga0157376_10001933 3300014969 Bacteria 13831
198 Ga0207656_10019237 3300025321 Bacteria 2700
199 Ga0207656_10051847 3300025321 Unclassified 1775
200 Ga0207710_10005662 3300025900 Bacteria 5376
201 Ga0207684_10000966 3300025910 Bacteria 32224
202 Ga0207654_10000470 3300025911 Bacteria 23002
203 Ga0207654_10002356 3300025911 Bacteria 9686
204 Ga0207654_10065324 3300025911 Unclassified 2142
205 Ga0207654_10191737 3300025911 Bacteria 1340
206 Ga0207707_10000202 3300025912 Bacteria 63576
207 Ga0207707_10002271 3300025912 Bacteria 17382
208 Ga0207707_10005457 3300025912 Bacteria 11116
209 Ga0207707_10022340 3300025912 Bacteria 5531
210 Ga0207707_10160531 3300025912 Bacteria 1965
211 Ga0207707_10189182 3300025912 Unclassified 1796
212 Ga0207695_10000096 3300025913 Bacteria 265048
213 Ga0207695_10000105 3300025913 Bacteria 254764
214 Ga0207695_10000166 3300025913 Bacteria 195439
215 Ga0207695_10000518 3300025913 Bacteria 81729
216 Ga0207695_10003839 3300025913 Bacteria 20799
217 Ga0207695_10007362 3300025913 Bacteria 14045
218 Ga0207695_10018267 3300025913 Bacteria 8115
219 Ga0207695_10019695 3300025913 Bacteria 7760
220 Ga0207695_10020085 3300025913 Bacteria 7664
221 Ga0207695_10025204 3300025913 Bacteria 6665
222 Ga0207695_10138869 3300025913 Bacteria 2381
223 Ga0207695_10165624 3300025913 Bacteria 2139
224 Ga0207695_10643208 3300025913 Bacteria 941
225 Ga0207671_10000258 3300025914 Bacteria 79486
226 Ga0207671_10000953 3300025914 Bacteria 35931
227 Ga0207671_10220062 3300025914 Bacteria 1487
228 Ga0207671_10286286 3300025914 Bacteria 1300
229 Ga0207671_10338241 3300025914 Bacteria 1192
230 Ga0207671_10390124 3300025914 Bacteria 1107
231 Ga0207671_10403892 3300025914 Bacteria 1086
232 Ga0207660_10004800 3300025917 Bacteria 8794
233 Ga0207660_10165661 3300025917 Bacteria 1708
234 Ga0207649_10545661 3300025920 Bacteria 886
235 Ga0207652_10002197 3300025921 Bacteria 16654
236 Ga0207652_10073347 3300025921 Bacteria 2977
237 Ga0207652_10079279 3300025921 Bacteria 2869
238 Ga0207652_10089222 3300025921 Bacteria 2707
239 Ga0207652_10222199 3300025921 Bacteria 1702
240 Ga0207646_10054170 3300025922 Bacteria 3589
241 Ga0207694_10000561 3300025924 Bacteria 33644
242 Ga0207694_10002454 3300025924 Bacteria 15131
243 Ga0207694_10008745 3300025924 Bacteria 7640
244 Ga0207694_10009213 3300025924 Bacteria 7449
245 Ga0207694_10028300 3300025924 Bacteria 4273
246 Ga0207694_10031530 3300025924 Bacteria 4050
247 Ga0207694_10070491 3300025924 Bacteria 2731
248 Ga0207694_10100146 3300025924 Bacteria 2296
249 Ga0207687_10003324 3300025927 Bacteria 10862
250 Ga0207700_10016845 3300025928 Bacteria 4867
251 Ga0207700_10187151 3300025928 Bacteria 1737
252 Ga0207664_10071621 3300025929 Bacteria 2793
253 Ga0207644_10009284 3300025931 Bacteria 6454
254 Ga0207690_10084833 3300025932 Bacteria 2221
255 Ga0207686_10027901 3300025934 Bacteria 3312
256 Ga0207670_10115286 3300025936 Bacteria 1943
257 Ga0207670_10536270 3300025936 Bacteria 954
258 Ga0207669_10025854 3300025937 Bacteria 3182
259 Ga0207665_10022373 3300025939 Bacteria 4158
260 Ga0207711_10005794 3300025941 Bacteria 10439
261 Ga0207711_10007356 3300025941 Bacteria 9216
262 Ga0207689_10001771 3300025942 Bacteria 20387
263 Ga0207689_10028268 3300025942 Bacteria 4691
264 Ga0207661_10125369 3300025944 Unclassified 2192
265 Ga0207661_10256206 3300025944 Unclassified 1557
266 Ga0207667_10002989 3300025949 Bacteria 21004
267 Ga0207667_10020121 3300025949 Bacteria 7432
268 Ga0207667_10024971 3300025949 Bacteria 6552
269 Ga0207667_10057759 3300025949 Bacteria 4072
270 Ga0207658_10008541 3300025986 Bacteria 6966
271 Ga0207658_10167696 3300025986 Bacteria 1806
272 Ga0207677_10014977 3300026023 Bacteria 4545
273 Ga0207703_10010351 3300026035 Bacteria 7299
274 Ga0207639_10001162 3300026041 Bacteria 17856
275 Ga0207639_10014970 3300026041 Bacteria 5465
276 Ga0207678_10131372 3300026067 Bacteria 2136
277 Ga0207702_10001833 3300026078 Bacteria 20908
278 Ga0207702_10001922 3300026078 Bacteria 20316
279 Ga0207702_10030623 3300026078 Bacteria 4483
280 Ga0207702_10055710 3300026078 Bacteria 3354
281 Ga0207641_10063724 3300026088 Bacteria 3149
282 Ga0207641_10180019 3300026088 Bacteria 1936
283 Ga0207648_10192604 3300026089 Bacteria 1807
284 Ga0207676_10001831 3300026095 Bacteria 15573
285 Ga0207674_10004324 3300026116 Bacteria 17128
286 Ga0207674_10547417 3300026116 Bacteria 1118
287 Ga0207674_10654601 3300026116 Unclassified 1014
288 Ga0207683_10471131 3300026121 Bacteria 1159
289 Ga0207698_10000020 3300026142 Bacteria 139630
290 Ga0207698_10007447 3300026142 Bacteria 6854
291 Ga0207698_10094925 3300026142 Bacteria 2454
292 Ga0207698_10204395 3300026142 Bacteria 1772
293 Ga0207698_10311419 3300026142 Bacteria 1470
294 Ga0207428_10014428 3300027907 Bacteria 6866
295 Ga0207428_10076143 3300027907 Bacteria 2628
296 Ga0265354_1000110 3300028016 Bacteria 14184
297 Ga0268266_10167865 3300028379 Bacteria 1990
298 Ga0268265_10028609 3300028380 Unclassified 3992
299 Ga0268264_10040550 3300028381 Bacteria 3847
300 Ga0268264_10231463 3300028381 Bacteria 1707
301 Ga0265318_10019260 3300028577 Archaea 2770
302 Ga0265318_10026443 3300028577 Archaea 2285
303 Ga0265338_10004672 3300028800 Bacteria 18373
304 Ga0265338_10007067 3300028800 Bacteria 14075
305 Ga0265770_1005723 3300030878 Bacteria 1720
306 Ga0265770_1027072 3300030878 Unclassified 941
307 Ga0265760_10011666 3300031090 Bacteria 2510
308 Ga0265332_10002009 3300031238 Bacteria 10697
309 Ga0265320_10114294 3300031240 Unclassified 1235
310 Ga0265329_10038402 3300031242 Bacteria 1540
311 Ga0265339_10005777 3300031249 Bacteria 8215
312 Ga0265331_10001979 3300031250 Bacteria 14301
313 Ga0265327_10084004 3300031251 Bacteria 1565
314 Ga0265316_10001296 3300031344 Bacteria 26900
315 Ga0265316_10002078 3300031344 Bacteria 21040
316 Ga0265316_10088724 3300031344 Unclassified 2361
317 Ga0265313_10017267 3300031595 Unclassified 4109
318 Ga0265314_10019349 3300031711 Bacteria 5276
319 Ga0265314_10058225 3300031711 Bacteria 2648
320 Ga0265342_10000013 3300031712 Bacteria 202181
321 Ga0265342_10001593 3300031712 Bacteria 20945
322 Ga0265342_10035894 3300031712 Unclassified 3031
323 Ga0316212_1002409 3300033547 Bacteria 2665
324 Ga0395900_0263655 3300037418 Bacteria 1720
325 Ga0436362_0833523 3300039453 Bacteria 2168
326 Ga0439464_0064236 3300042439 Bacteria 1078
327 Ga0451577_0002866 3300042876 Bacteria 19815
328 Ga0451577_0020793 3300042876 Bacteria 6017
329 Ga0453683_0001941 3300044673 Bacteria 16803
330 Ga0453684_0000008 3300044712 Bacteria 1200052
331 Ga0453684_0000079 3300044712 Bacteria 421360
332 Ga0453684_0087011 3300044712 Bacteria 3874
333 Ga0466959_0419323 3300045049 Unclassified 909
334 Ga0451576_0000010 3300045051 Bacteria 679007
335 Ga0466967_0070827 3300045976 Bacteria 3120
336 Ga0495603_0044384 3300046455 Bacteria 2653
337 Ga0495580_0042568 3300046472 Bacteria 3235
338 Ga0495645_0024163 3300046543 Bacteria 4409
339 Ga0495667_0005313 3300046559 Bacteria 8707
340 Ga0495613_0145196 3300046689 Bacteria 1694
341 Ga0496100_0084150 3300048903 Bacteria 2156
342 Ga0496102_0240818 3300048905 Bacteria 1706
343 Ga0496107_0136089 3300048910 Bacteria 1815
344 Ga0496108_0353217 3300048911 Unclassified 1283
345 Ga0496114_0003639 3300048917 Bacteria 11853
346 Ga0496126_0000575 3300048929 Bacteria 70082
347 Ga0501032_0181295 3300049569 Bacteria 1379
348 Ga0501043_0443671 3300049579 Bacteria 976
349 Ga0501070_0073651 3300049586 Bacteria 2826
350 Ga0501071_0135009 3300049587 Bacteria 1835
351 Ga0501076_0136853 3300049592 Bacteria 1989
352 Ga0501083_0009571 3300049744 Bacteria 6846
353 Ga0501044_0004905 3300049823 Bacteria 14957
354 nmdc:mga05p37_7993_c2 3300050507 Bacteria 8627
355 nmdc:mga09592_135364_c1 3300050508 Archaea 2122
356 nmdc:mga09592_168143_c1 3300050508 Bacteria 1895
357 nmdc:mga0qj67_14836_c1 3300050509 Bacteria 5894
358 nmdc:mga0qj67_371119_c1 3300050509 Bacteria 1156
359 nmdc:mga06r32_159494_c1 3300050510 Unclassified 2238
360 nmdc:mga08y16_17626_c1 3300050511 Bacteria 7522
361 nmdc:mga08y16_1790_c1 3300050511 Bacteria 21774
362 nmdc:mga08y16_51871_c1 3300050511 Bacteria 4292
363 nmdc:mga0n895_35470_c1 3300050512 Bacteria 4809
364 nmdc:mga0n895_408911_c1 3300050512 Bacteria 1372
365 nmdc:mga08x19_85132_c1 3300050514 Bacteria 2080
366 nmdc:mga0a205_158909_c1 3300050515 Bacteria 2158
367 nmdc:mga0a205_19520_c1 3300050515 Bacteria 5068
368 Ga0500641_0007372 3300053096 Bacteria 3921
369 Ga0500559_0232517 3300053136 Unclassified 869
370 Ga0500568_0003673 3300053139 Bacteria 8434
371 Ga0501084_0039414 3300054114 Bacteria 3952
372 Ga0501084_0558694 3300054114 Bacteria 967
373 Ga0501082_0683580 3300060353 Bacteria 898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100129713 Ga0075436_1001297132 220
2 3300050514 nmdc:mga08x19_85132_c1 nmdc:mga08x19_85132_c1_891_1637 220
3 3300005467 Ga0070706_100453244 Ga0070706_1004532441 222
4 3300005536 Ga0070697_100396942 Ga0070697_1003969422 222
5 3300060353 Ga0501082_0683580 Ga0501082_0683580_175_888 226
6 3300037418 Ga0395900_0263655 Ga0395900_0263655_180_926 227
7 3300009098 Ga0105245_11248982 Ga0105245_112489821 228
8 3300014326 Ga0157380_10252622 Ga0157380_102526222 228
9 3300050508 nmdc:mga09592_168143_c1 nmdc:mga09592_168143_c1_976_1722 229
10 3300031250 Ga0265331_10001979 Ga0265331_100019799 233
11 3300031711 Ga0265314_10058225 Ga0265314_100582252 233
12 3300005444 Ga0070694_100049893 Ga0070694_1000498932 236
13 3300005468 Ga0070707_100163073 Ga0070707_1001630732 236
14 3300005546 Ga0070696_100036122 Ga0070696_1000361223 236
15 3300030878 Ga0265770_1027072 Ga0265770_10270722 236
16 3300049569 Ga0501032_0181295 Ga0501032_0181295_471_1223 237
17 3300049579 Ga0501043_0443671 Ga0501043_0443671_22_774 237
18 3300049592 Ga0501076_0136853 Ga0501076_0136853_397_1149 237
19 3300054114 Ga0501084_0039414 Ga0501084_0039414_3176_3937 237
20 3300006846 Ga0075430_100150349 Ga0075430_1001503492 238
21 3300006847 Ga0075431_100292177 Ga0075431_1002921772 238
22 3300025922 Ga0207646_10054170 Ga0207646_100541702 238
23 3300050509 nmdc:mga0qj67_371119_c1 nmdc:mga0qj67_371119_c1_302_1048 238
24 3300050510 nmdc:mga06r32_159494_c1 nmdc:mga06r32_159494_c1_1279_2025 238
25 3300009147 Ga0114129_10003691 Ga0114129_100036917 239
26 3300028577 Ga0265318_10019260 Ga0265318_100192602 239
27 3300028800 Ga0265338_10007067 Ga0265338_1000706714 239
28 3300031240 Ga0265320_10114294 Ga0265320_101142942 239
29 3300031595 Ga0265313_10017267 Ga0265313_100172673 239
30 3300031712 Ga0265342_10001593 Ga0265342_1000159314 239
31 3300050507 nmdc:mga05p37_7993_c2 nmdc:mga05p37_7993_c2_6170_6916 239
32 3300009177 Ga0105248_10002961 Ga0105248_1000296111 240
33 3300025941 Ga0207711_10007356 Ga0207711_100073564 240
34 3300028577 Ga0265318_10026443 Ga0265318_100264432 241
35 3300045049 Ga0466959_0419323 Ga0466959_0419323_13_759 242
36 3300031251 Ga0265327_10084004 Ga0265327_100840042 246
37 3300053139 Ga0500568_0003673 Ga0500568_0003673_453_1196 246
38 3300005336 Ga0070680_100044726 Ga0070680_1000447263 247
39 3300005336 Ga0070680_100257690 Ga0070680_1002576902 247
40 3300005337 Ga0070682_100154062 Ga0070682_1001540621 247
41 3300005340 Ga0070689_100417438 Ga0070689_1004174382 247
42 3300005340 Ga0070689_100564874 Ga0070689_1005648742 247
43 3300005344 Ga0070661_100111961 Ga0070661_1001119613 247
44 3300005356 Ga0070674_100001651 Ga0070674_1000016511 247
45 3300005364 Ga0070673_100094151 Ga0070673_1000941513 247
46 3300005364 Ga0070673_100672577 Ga0070673_1006725771 247
47 3300005365 Ga0070688_100124039 Ga0070688_1001240391 247
48 3300005366 Ga0070659_100445929 Ga0070659_1004459291 247
49 3300005435 Ga0070714_100265949 Ga0070714_1002659492 247
50 3300005436 Ga0070713_100054898 Ga0070713_1000548982 247
51 3300005436 Ga0070713_100118075 Ga0070713_1001180753 247
52 3300005445 Ga0070708_100029276 Ga0070708_1000292762 247
53 3300005458 Ga0070681_10004147 Ga0070681_100041476 247
54 3300005458 Ga0070681_10016961 Ga0070681_100169615 247
55 3300005458 Ga0070681_10042182 Ga0070681_100421826 247
56 3300005458 Ga0070681_10055693 Ga0070681_100556933 247
57 3300005459 Ga0068867_100424006 Ga0068867_1004240061 247
58 3300005467 Ga0070706_100000434 Ga0070706_10000043425 247
59 3300005518 Ga0070699_100044371 Ga0070699_1000443713 247
60 3300005530 Ga0070679_100039829 Ga0070679_1000398294 247
61 3300005530 Ga0070679_100082291 Ga0070679_1000822913 247
62 3300005530 Ga0070679_100107918 Ga0070679_1001079183 247
63 3300005530 Ga0070679_100394532 Ga0070679_1003945322 247
64 3300005530 Ga0070679_100535324 Ga0070679_1005353241 247
65 3300005530 Ga0070679_100647149 Ga0070679_1006471491 247
66 3300005536 Ga0070697_100001114 Ga0070697_1000011143 247
67 3300005539 Ga0068853_100891281 Ga0068853_1008912811 247
68 3300005544 Ga0070686_100051592 Ga0070686_1000515922 247
69 3300005548 Ga0070665_100040854 Ga0070665_1000408544 247
70 3300005563 Ga0068855_100002418 Ga0068855_10000241817 247
71 3300005563 Ga0068855_100016532 Ga0068855_10001653210 247
72 3300005563 Ga0068855_100070429 Ga0068855_1000704292 247
73 3300005564 Ga0070664_100418568 Ga0070664_1004185682 247
74 3300005577 Ga0068857_100241996 Ga0068857_1002419962 247
75 3300005577 Ga0068857_100772467 Ga0068857_1007724672 247
76 3300005614 Ga0068856_100245611 Ga0068856_1002456112 247
77 3300005614 Ga0068856_100840523 Ga0068856_1008405232 247
78 3300005616 Ga0068852_100278659 Ga0068852_1002786592 247
79 3300005617 Ga0068859_100018631 Ga0068859_1000186313 247
80 3300005719 Ga0068861_100424642 Ga0068861_1004246422 247
81 3300005841 Ga0068863_100332937 Ga0068863_1003329371 247
82 3300006028 Ga0070717_10300854 Ga0070717_103008542 247
83 3300006028 Ga0070717_10330297 Ga0070717_103302972 247
84 3300006173 Ga0070716_100030532 Ga0070716_1000305324 247
85 3300006237 Ga0097621_100274893 Ga0097621_1002748932 247
86 3300006358 Ga0068871_100092702 Ga0068871_1000927023 247
87 3300006358 Ga0068871_100445461 Ga0068871_1004454612 247
88 3300006844 Ga0075428_100001739 Ga0075428_1000017392 247
89 3300006844 Ga0075428_100555146 Ga0075428_1005551462 247
90 3300006846 Ga0075430_100028787 Ga0075430_1000287872 247
91 3300006847 Ga0075431_100048210 Ga0075431_1000482103 247
92 3300006852 Ga0075433_10141952 Ga0075433_101419523 247
93 3300006871 Ga0075434_100022111 Ga0075434_1000221114 247
94 3300006871 Ga0075434_100121735 Ga0075434_1001217352 247
95 3300006880 Ga0075429_100137222 Ga0075429_1001372222 247
96 3300006880 Ga0075429_100439790 Ga0075429_1004397902 247
97 3300006931 Ga0097620_100018631 Ga0097620_1000186317 247
98 3300009093 Ga0105240_10020051 Ga0105240_100200514 247
99 3300009093 Ga0105240_10026495 Ga0105240_100264952 247
100 3300009093 Ga0105240_10079463 Ga0105240_100794632 247
101 3300009093 Ga0105240_10329923 Ga0105240_103299232 247
102 3300009094 Ga0111539_10117300 Ga0111539_101173002 247
103 3300009148 Ga0105243_10544406 Ga0105243_105444061 247
104 3300009176 Ga0105242_10060496 Ga0105242_100604963 247
105 3300009176 Ga0105242_10404949 Ga0105242_104049492 247
106 3300009545 Ga0105237_10346418 Ga0105237_103464182 247
107 3300009545 Ga0105237_10628162 Ga0105237_106281621 247
108 3300009551 Ga0105238_10014130 Ga0105238_100141306 247
109 3300009551 Ga0105238_10076722 Ga0105238_100767223 247
110 3300009551 Ga0105238_10231848 Ga0105238_102318483 247
111 3300013104 Ga0157370_10013611 Ga0157370_100136114 247
112 3300013104 Ga0157370_10564456 Ga0157370_105644562 247
113 3300013105 Ga0157369_10032558 Ga0157369_100325585 247
114 3300013105 Ga0157369_10099763 Ga0157369_100997634 247
115 3300013297 Ga0157378_10314425 Ga0157378_103144251 247
116 3300013307 Ga0157372_10121006 Ga0157372_101210063 247
117 3300014745 Ga0157377_10041668 Ga0157377_100416683 247
118 3300014968 Ga0157379_10076890 Ga0157379_100768902 247
119 3300025910 Ga0207684_10000966 Ga0207684_1000096620 247
120 3300025912 Ga0207707_10000202 Ga0207707_1000020212 247
121 3300025912 Ga0207707_10002271 Ga0207707_1000227116 247
122 3300025912 Ga0207707_10005457 Ga0207707_1000545711 247
123 3300025912 Ga0207707_10022340 Ga0207707_100223406 247
124 3300025912 Ga0207707_10160531 Ga0207707_101605312 247
125 3300025912 Ga0207707_10189182 Ga0207707_101891823 247
126 3300025913 Ga0207695_10018267 Ga0207695_100182679 247
127 3300025913 Ga0207695_10019695 Ga0207695_100196954 247
128 3300025913 Ga0207695_10020085 Ga0207695_100200855 247
129 3300025913 Ga0207695_10643208 Ga0207695_106432081 247
130 3300025914 Ga0207671_10220062 Ga0207671_102200622 247
131 3300025914 Ga0207671_10338241 Ga0207671_103382411 247
132 3300025914 Ga0207671_10403892 Ga0207671_104038921 247
133 3300025917 Ga0207660_10004800 Ga0207660_100048007 247
134 3300025917 Ga0207660_10165661 Ga0207660_101656612 247
135 3300025921 Ga0207652_10002197 Ga0207652_1000219710 247
136 3300025921 Ga0207652_10073347 Ga0207652_100733472 247
137 3300025921 Ga0207652_10089222 Ga0207652_100892223 247
138 3300025921 Ga0207652_10222199 Ga0207652_102221992 247
139 3300025924 Ga0207694_10009213 Ga0207694_100092137 247
140 3300025924 Ga0207694_10070491 Ga0207694_100704912 247
141 3300025924 Ga0207694_10100146 Ga0207694_101001462 247
142 3300025928 Ga0207700_10016845 Ga0207700_100168453 247
143 3300025928 Ga0207700_10187151 Ga0207700_101871512 247
144 3300025934 Ga0207686_10027901 Ga0207686_100279014 247
145 3300025936 Ga0207670_10115286 Ga0207670_101152862 247
146 3300025936 Ga0207670_10536270 Ga0207670_105362701 247
147 3300025937 Ga0207669_10025854 Ga0207669_100258542 247
148 3300025939 Ga0207665_10022373 Ga0207665_100223734 247
149 3300025942 Ga0207689_10028268 Ga0207689_100282682 247
150 3300025949 Ga0207667_10024971 Ga0207667_100249714 247
151 3300025949 Ga0207667_10057759 Ga0207667_100577592 247
152 3300025986 Ga0207658_10167696 Ga0207658_101676962 247
153 3300026088 Ga0207641_10063724 Ga0207641_100637242 247
154 3300026088 Ga0207641_10180019 Ga0207641_101800192 247
155 3300026089 Ga0207648_10192604 Ga0207648_101926042 247
156 3300026116 Ga0207674_10547417 Ga0207674_105474172 247
157 3300026121 Ga0207683_10471131 Ga0207683_104711312 247
158 3300027907 Ga0207428_10014428 Ga0207428_100144286 247
159 3300027907 Ga0207428_10076143 Ga0207428_100761432 247
160 3300028016 Ga0265354_1000110 Ga0265354_10001107 247
161 3300028379 Ga0268266_10167865 Ga0268266_101678652 247
162 3300028381 Ga0268264_10231463 Ga0268264_102314632 247
163 3300030878 Ga0265770_1005723 Ga0265770_10057232 247
164 3300031090 Ga0265760_10011666 Ga0265760_100116662 247
165 3300031238 Ga0265332_10002009 Ga0265332_100020096 247
166 3300031242 Ga0265329_10038402 Ga0265329_100384022 247
167 3300031249 Ga0265339_10005777 Ga0265339_100057777 247
168 3300031344 Ga0265316_10001296 Ga0265316_100012965 247
169 3300031344 Ga0265316_10002078 Ga0265316_1000207816 247
170 3300031344 Ga0265316_10088724 Ga0265316_100887242 247
171 3300031712 Ga0265342_10000013 Ga0265342_10000013124 247
172 3300031712 Ga0265342_10035894 Ga0265342_100358943 247
173 3300033547 Ga0316212_1002409 Ga0316212_10024092 247
174 3300039453 Ga0436362_0833523 Ga0436362_0833523_1291_2127 247
175 3300042439 Ga0439464_0064236 Ga0439464_0064236_194_940 247
176 3300042876 Ga0451577_0002866 Ga0451577_0002866_17224_17970 247
177 3300042876 Ga0451577_0020793 Ga0451577_0020793_523_1269 247
178 3300044673 Ga0453683_0001941 Ga0453683_0001941_5215_5961 247
179 3300044712 Ga0453684_0000008 Ga0453684_0000008_428154_428900 247
180 3300044712 Ga0453684_0000079 Ga0453684_0000079_191182_191928 247
181 3300044712 Ga0453684_0087011 Ga0453684_0087011_2679_3425 247
182 3300045051 Ga0451576_0000010 Ga0451576_0000010_190162_190908 247
183 3300046455 Ga0495603_0044384 Ga0495603_0044384_877_1623 247
184 3300046472 Ga0495580_0042568 Ga0495580_0042568_1404_2150 247
185 3300046543 Ga0495645_0024163 Ga0495645_0024163_3321_4067 247
186 3300046559 Ga0495667_0005313 Ga0495667_0005313_3256_4002 247
187 3300046689 Ga0495613_0145196 Ga0495613_0145196_609_1355 247
188 3300048903 Ga0496100_0084150 Ga0496100_0084150_1016_1762 247
189 3300048905 Ga0496102_0240818 Ga0496102_0240818_597_1343 247
190 3300048910 Ga0496107_0136089 Ga0496107_0136089_878_1624 247
191 3300048911 Ga0496108_0353217 Ga0496108_0353217_241_987 247
192 3300048917 Ga0496114_0003639 Ga0496114_0003639_5389_6135 247
193 3300048929 Ga0496126_0000575 Ga0496126_0000575_44997_45743 247
194 3300049586 Ga0501070_0073651 Ga0501070_0073651_1971_2732 247
195 3300049587 Ga0501071_0135009 Ga0501071_0135009_676_1422 247
196 3300049744 Ga0501083_0009571 Ga0501083_0009571_866_1612 247
197 3300049823 Ga0501044_0004905 Ga0501044_0004905_12115_12876 247
198 3300050508 nmdc:mga09592_135364_c1 nmdc:mga09592_135364_c1_1265_2011 247
199 3300050509 nmdc:mga0qj67_14836_c1 nmdc:mga0qj67_14836_c1_2366_3112 247
200 3300050511 nmdc:mga08y16_17626_c1 nmdc:mga08y16_17626_c1_872_1618 247
201 3300050511 nmdc:mga08y16_1790_c1 nmdc:mga08y16_1790_c1_18715_19461 247
202 3300050511 nmdc:mga08y16_51871_c1 nmdc:mga08y16_51871_c1_2045_2791 247
203 3300050512 nmdc:mga0n895_35470_c1 nmdc:mga0n895_35470_c1_2718_3464 247
204 3300050512 nmdc:mga0n895_408911_c1 nmdc:mga0n895_408911_c1_590_1336 247
205 3300050515 nmdc:mga0a205_158909_c1 nmdc:mga0a205_158909_c1_223_969 247
206 3300050515 nmdc:mga0a205_19520_c1 nmdc:mga0a205_19520_c1_3667_4413 247
207 3300053096 Ga0500641_0007372 Ga0500641_0007372_2097_2843 247
208 3300053136 Ga0500559_0232517 Ga0500559_0232517_74_820 247
209 3300054114 Ga0501084_0558694 Ga0501084_0558694_16_762 247
210 3300005327 Ga0070658_10015795 Ga0070658_100157952 249
211 3300005329 Ga0070683_100018261 Ga0070683_1000182618 249
212 3300005331 Ga0070670_100016668 Ga0070670_1000166688 249
213 3300005334 Ga0068869_100005462 Ga0068869_1000054628 249
214 3300005335 Ga0070666_10170713 Ga0070666_101707132 249
215 3300005337 Ga0070682_100153836 Ga0070682_1001538362 249
216 3300005337 Ga0070682_100160318 Ga0070682_1001603181 249
217 3300005338 Ga0068868_100000334 Ga0068868_10000033415 249
218 3300005339 Ga0070660_100068022 Ga0070660_1000680222 249
219 3300005341 Ga0070691_10109105 Ga0070691_101091052 249
220 3300005355 Ga0070671_100003655 Ga0070671_1000036555 249
221 3300005366 Ga0070659_100009195 Ga0070659_1000091953 249
222 3300005367 Ga0070667_100005910 Ga0070667_1000059106 249
223 3300005435 Ga0070714_100027330 Ga0070714_1000273304 249
224 3300005535 Ga0070684_100001161 Ga0070684_10000116113 249
225 3300005535 Ga0070684_100256751 Ga0070684_1002567511 249
226 3300005539 Ga0068853_100000800 Ga0068853_1000008007 249
227 3300005548 Ga0070665_100114987 Ga0070665_1001149873 249
228 3300005563 Ga0068855_100000808 Ga0068855_10000080812 249
229 3300005563 Ga0068855_100004110 Ga0068855_1000041102 249
230 3300005564 Ga0070664_100017236 Ga0070664_1000172366 249
231 3300005577 Ga0068857_100000395 Ga0068857_10000039516 249
232 3300005577 Ga0068857_100624079 Ga0068857_1006240791 249
233 3300005578 Ga0068854_100011707 Ga0068854_1000117073 249
234 3300005614 Ga0068856_100006431 Ga0068856_1000064313 249
235 3300005614 Ga0068856_100016868 Ga0068856_1000168686 249
236 3300005614 Ga0068856_100017024 Ga0068856_1000170242 249
237 3300005614 Ga0068856_100262551 Ga0068856_1002625512 249
238 3300005616 Ga0068852_100000009 Ga0068852_100000009100 249
239 3300005616 Ga0068852_100002047 Ga0068852_1000020478 249
240 3300005616 Ga0068852_100046843 Ga0068852_1000468432 249
241 3300005616 Ga0068852_100436425 Ga0068852_1004364252 249
242 3300005616 Ga0068852_100763486 Ga0068852_1007634862 249
243 3300005617 Ga0068859_100028554 Ga0068859_1000285548 249
244 3300005618 Ga0068864_100000703 Ga0068864_10000070311 249
245 3300005834 Ga0068851_10016410 Ga0068851_100164103 249
246 3300005834 Ga0068851_10089122 Ga0068851_100891222 249
247 3300005834 Ga0068851_10104064 Ga0068851_101040642 249
248 3300005841 Ga0068863_100002707 Ga0068863_1000027077 249
249 3300005842 Ga0068858_100004230 Ga0068858_1000042305 249
250 3300005843 Ga0068860_100001296 Ga0068860_10000129619 249
251 3300005844 Ga0068862_100047848 Ga0068862_1000478485 249
252 3300006237 Ga0097621_100000518 Ga0097621_10000051820 249
253 3300006358 Ga0068871_100000818 Ga0068871_1000008186 249
254 3300006931 Ga0097620_100028554 Ga0097620_1000285548 249
255 3300009093 Ga0105240_10000148 Ga0105240_10000148102 249
256 3300009093 Ga0105240_10000184 Ga0105240_1000018446 249
257 3300009093 Ga0105240_10003298 Ga0105240_100032987 249
258 3300009093 Ga0105240_10004349 Ga0105240_1000434912 249
259 3300009093 Ga0105240_10010183 Ga0105240_100101836 249
260 3300009093 Ga0105240_10011941 Ga0105240_100119419 249
261 3300009093 Ga0105240_10021102 Ga0105240_1002110210 249
262 3300009093 Ga0105240_10028713 Ga0105240_100287133 249
263 3300009093 Ga0105240_10145691 Ga0105240_101456911 249
264 3300009093 Ga0105240_11015850 Ga0105240_110158502 249
265 3300009098 Ga0105245_10001000 Ga0105245_100010008 249
266 3300009098 Ga0105245_10016213 Ga0105245_100162134 249
267 3300009101 Ga0105247_10003975 Ga0105247_100039757 249
268 3300009174 Ga0105241_10000869 Ga0105241_1000086912 249
269 3300009174 Ga0105241_10002836 Ga0105241_100028368 249
270 3300009174 Ga0105241_10037355 Ga0105241_100373552 249
271 3300009177 Ga0105248_10004803 Ga0105248_100048038 249
272 3300009545 Ga0105237_10001697 Ga0105237_100016979 249
273 3300009545 Ga0105237_10008032 Ga0105237_100080325 249
274 3300009545 Ga0105237_10195686 Ga0105237_101956862 249
275 3300009545 Ga0105237_10332382 Ga0105237_103323822 249
276 3300009545 Ga0105237_10341042 Ga0105237_103410422 249
277 3300009551 Ga0105238_10001126 Ga0105238_1000112618 249
278 3300009551 Ga0105238_10002350 Ga0105238_100023507 249
279 3300009551 Ga0105238_10015039 Ga0105238_100150392 249
280 3300009551 Ga0105238_10040172 Ga0105238_100401723 249
281 3300009551 Ga0105238_10064370 Ga0105238_100643702 249
282 3300009553 Ga0105249_10014871 Ga0105249_100148713 249
283 3300010375 Ga0105239_10003426 Ga0105239_1000342610 249
284 3300010375 Ga0105239_10048017 Ga0105239_100480173 249
285 3300010375 Ga0105239_10056049 Ga0105239_100560493 249
286 3300010375 Ga0105239_10057259 Ga0105239_100572593 249
287 3300010375 Ga0105239_10083927 Ga0105239_100839274 249
288 3300011119 Ga0105246_10001916 Ga0105246_100019168 249
289 3300013104 Ga0157370_10000059 Ga0157370_1000005981 249
290 3300013104 Ga0157370_10168288 Ga0157370_101682882 249
291 3300013104 Ga0157370_10507946 Ga0157370_105079462 249
292 3300013105 Ga0157369_10000035 Ga0157369_10000035106 249
293 3300013105 Ga0157369_10026388 Ga0157369_100263887 249
294 3300013105 Ga0157369_10086935 Ga0157369_100869352 249
295 3300013296 Ga0157374_10005708 Ga0157374_100057085 249
296 3300013296 Ga0157374_10057535 Ga0157374_100575352 249
297 3300013297 Ga0157378_10001112 Ga0157378_1000111218 249
298 3300013297 Ga0157378_10033955 Ga0157378_100339555 249
299 3300013297 Ga0157378_10098226 Ga0157378_100982262 249
300 3300013297 Ga0157378_10346871 Ga0157378_103468712 249
301 3300013306 Ga0163162_10371458 Ga0163162_103714582 249
302 3300013307 Ga0157372_10000049 Ga0157372_10000049100 249
303 3300013307 Ga0157372_10010693 Ga0157372_100106937 249
304 3300013307 Ga0157372_10024244 Ga0157372_100242443 249
305 3300013307 Ga0157372_10035355 Ga0157372_100353552 249
306 3300013307 Ga0157372_10054588 Ga0157372_100545885 249
307 3300013307 Ga0157372_10188842 Ga0157372_101888422 249
308 3300013307 Ga0157372_10321900 Ga0157372_103219002 249
309 3300013308 Ga0157375_10001018 Ga0157375_100010186 249
310 3300013308 Ga0157375_10035677 Ga0157375_100356774 249
311 3300014325 Ga0163163_10001812 Ga0163163_100018128 249
312 3300014968 Ga0157379_10000232 Ga0157379_1000023216 249
313 3300014969 Ga0157376_10001933 Ga0157376_100019338 249
314 3300025321 Ga0207656_10019237 Ga0207656_100192372 249
315 3300025321 Ga0207656_10051847 Ga0207656_100518472 249
316 3300025900 Ga0207710_10005662 Ga0207710_100056622 249
317 3300025911 Ga0207654_10000470 Ga0207654_1000047019 249
318 3300025911 Ga0207654_10002356 Ga0207654_100023568 249
319 3300025911 Ga0207654_10065324 Ga0207654_100653242 249
320 3300025911 Ga0207654_10191737 Ga0207654_101917372 249
321 3300025913 Ga0207695_10000096 Ga0207695_10000096224 249
322 3300025913 Ga0207695_10000105 Ga0207695_10000105127 249
323 3300025913 Ga0207695_10000166 Ga0207695_1000016656 249
324 3300025913 Ga0207695_10000518 Ga0207695_1000051848 249
325 3300025913 Ga0207695_10003839 Ga0207695_1000383912 249
326 3300025913 Ga0207695_10007362 Ga0207695_1000736213 249
327 3300025913 Ga0207695_10025204 Ga0207695_100252044 249
328 3300025913 Ga0207695_10138869 Ga0207695_101388693 249
329 3300025913 Ga0207695_10165624 Ga0207695_101656242 249
330 3300025914 Ga0207671_10000258 Ga0207671_1000025821 249
331 3300025914 Ga0207671_10000953 Ga0207671_1000095326 249
332 3300025914 Ga0207671_10286286 Ga0207671_102862862 249
333 3300025914 Ga0207671_10390124 Ga0207671_103901242 249
334 3300025920 Ga0207649_10545661 Ga0207649_105456612 249
335 3300025921 Ga0207652_10079279 Ga0207652_100792793 249
336 3300025924 Ga0207694_10000561 Ga0207694_1000056115 249
337 3300025924 Ga0207694_10002454 Ga0207694_1000245414 249
338 3300025924 Ga0207694_10008745 Ga0207694_100087456 249
339 3300025924 Ga0207694_10028300 Ga0207694_100283003 249
340 3300025924 Ga0207694_10031530 Ga0207694_100315302 249
341 3300025927 Ga0207687_10003324 Ga0207687_100033247 249
342 3300025929 Ga0207664_10071621 Ga0207664_100716212 249
343 3300025931 Ga0207644_10009284 Ga0207644_100092842 249
344 3300025932 Ga0207690_10084833 Ga0207690_100848332 249
345 3300025941 Ga0207711_10005794 Ga0207711_100057946 249
346 3300025942 Ga0207689_10001771 Ga0207689_1000177114 249
347 3300025944 Ga0207661_10125369 Ga0207661_101253692 249
348 3300025944 Ga0207661_10256206 Ga0207661_102562062 249
349 3300025949 Ga0207667_10002989 Ga0207667_100029894 249
350 3300025949 Ga0207667_10020121 Ga0207667_100201217 249
351 3300025986 Ga0207658_10008541 Ga0207658_100085418 249
352 3300026023 Ga0207677_10014977 Ga0207677_100149775 249
353 3300026035 Ga0207703_10010351 Ga0207703_100103513 249
354 3300026041 Ga0207639_10001162 Ga0207639_1000116222 249
355 3300026041 Ga0207639_10014970 Ga0207639_100149706 249
356 3300026067 Ga0207678_10131372 Ga0207678_101313722 249
357 3300026078 Ga0207702_10001833 Ga0207702_1000183326 249
358 3300026078 Ga0207702_10001922 Ga0207702_100019227 249
359 3300026078 Ga0207702_10030623 Ga0207702_100306232 249
360 3300026078 Ga0207702_10055710 Ga0207702_100557102 249
361 3300026095 Ga0207676_10001831 Ga0207676_1000183112 249
362 3300026116 Ga0207674_10004324 Ga0207674_100043246 249
363 3300026116 Ga0207674_10654601 Ga0207674_106546011 249
364 3300026142 Ga0207698_10000020 Ga0207698_1000002093 249
365 3300026142 Ga0207698_10007447 Ga0207698_100074478 249
366 3300026142 Ga0207698_10094925 Ga0207698_100949253 249
367 3300026142 Ga0207698_10204395 Ga0207698_102043952 249
368 3300026142 Ga0207698_10311419 Ga0207698_103114192 249
369 3300028380 Ga0268265_10028609 Ga0268265_100286095 249
370 3300028381 Ga0268264_10040550 Ga0268264_100405502 249
371 3300028800 Ga0265338_10004672 Ga0265338_100046724 249
372 3300031711 Ga0265314_10019349 Ga0265314_100193496 249
373 3300045976 Ga0466967_0070827 Ga0466967_0070827_1457_2215 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

32

244

0.93

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

72

271

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7roq-assembly1.cif.gz_A alternative structure of human abca1 0.7479 52 241
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.7387 3 245
5xjy-assembly1.cif.gz_A cryo-em structure of human abca1 0.7322 52 240
8i3c-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with chs 0.7304 2 245
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.7257 3 245
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8646 54 241 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8479 51 241 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8102 54 238 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6676 54 241 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6653 51 241 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A554MAT6-F1-model_v4 Transport permease protein 0.9612 3 247 GO:0043190
GO:0140359
AF-A0A0G1XZ24-F1-model_v4 Transport permease protein 0.9607 2 247 GO:0043190
GO:0140359
AF-A0A7V4PCJ6-F1-model_v4 Transport permease protein 0.9606 3 247 GO:0043190
GO:0140359
AF-A0A2G9PQH7-F1-model_v4 Multidrug ABC transporter permease 0.96 3 247 GO:0043190
GO:0140359
AF-A0A537JQB9-F1-model_v4 Transport permease protein 0.96 1 247 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
84.01 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map