F426438

General Info

Members Datasets Scaffolds Average Seq Length
373 276 746 405

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0001544|Ga0466969_0001544_9606_11096
Length 496
Sequence MFDHDVESACSRDAWNRALEQPLAGRGETEHQPLRISSGASRGGEPLVGDSNMPGTNGQIPNIRQHHRTQAHEPPDTGKMTHMETDTVDNGDRSGSALEVLRIFLRLGLTSFGGPIAHIGYFHNEFVVRRRWLDEQTFTDLVALCQFLPGPASSQVGFSIGLLRAGYVGALAAWTGFTLPSAIALVLFAFGAHALNPSIAAGLLHGLRLVAVAIVAQAVWSMARTLCPDRERASIAVAAAVVXXXXTAPILQIATLAAGAIAGMLLCKQTSTTAPGSIATPSGRRTLAVPISPRAGLIALTAFGTLLLGLPILRAASGSTGIALFEAFYRSGALVFGGGHVVLPLLRNAFVTPGWVSDDTFLAGYGAAQAVPGPLFTFSAFLGAVVNTTPRGLGGAALGVIGIFLPGMLILLGTLPYWDRLRQRGSAQATMRGINAAVVGFLIAALYNPVWTSSVGSGPDFALALVGFALLTVWRAPPLIVVALGAIGGLCSAPGT

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
54 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
55 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
56 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
114 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
235 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
236 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
237 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
238 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
239 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
240 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
241 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
242 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
243 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
244 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
245 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
246 2643221569 Achromobacter sp. Root565 Isolate Unclassified
247 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
248 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
249 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
250 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
251 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
252 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
253 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
254 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
255 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
256 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
257 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
258 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
259 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
260 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
261 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
262 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
263 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
264 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
265 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
266 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
267 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
268 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
269 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
270 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
271 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
272 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
273 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
274 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
275 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
276 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.2
Metatranscriptomes 0.27
Isolates 11.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 4.56
Rhizoplane 6.43
Rhizosphere 73.99
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0001544 3300044656 Bacteria 12376
2 JGI25155J39150_1000043 3300002704 Bacteria 87185
3 JGI25156J39149_1000056 3300002705 Bacteria 87185
4 JGI25154J39366_1000086 3300002738 Bacteria 87185
5 JGI25157J39369_1001951 3300002741 Bacteria 6143
6 JGI25151J46595_10015855 3300003187 Bacteria 3309
7 rootH1_10315523 3300003323 Bacteria 1575
8 Ga0055542_1002036 3300003762 Bacteria 7680
9 Ga0055541_1003631 3300003841 Bacteria 2876
10 Ga0070658_10007331 3300005327 Bacteria 8909
11 Ga0070666_10048820 3300005335 Bacteria 2844
12 Ga0070671_100001331 3300005355 Bacteria 18540
13 Ga0070673_100008464 3300005364 Bacteria 6841
14 Ga0070709_10002985 3300005434 Bacteria 9106
15 Ga0070714_100013754 3300005435 Bacteria 6490
16 Ga0070713_100083861 3300005436 Bacteria 2725
17 Ga0070711_100007420 3300005439 Bacteria 6670
18 Ga0070706_100150783 3300005467 Bacteria 2170
19 Ga0070699_100024234 3300005518 Bacteria 5228
20 Ga0070684_100203144 3300005535 Bacteria 1805
21 Ga0070696_100047141 3300005546 Bacteria 2989
22 Ga0070665_100190316 3300005548 Bacteria 2053
23 Ga0070704_100093012 3300005549 Bacteria 2252
24 Ga0068856_100001092 3300005614 Bacteria 28600
25 Ga0068852_100229198 3300005616 Bacteria 1770
26 Ga0081455_10000092 3300005937 Bacteria 97240
27 Ga0081455_10056795 3300005937 Bacteria 3321
28 Ga0070717_10166889 3300006028 Bacteria 1913
29 Ga0075364_10034049 3300006051 Bacteria 3284
30 Ga0075364_10068668 3300006051 Unclassified 2331
31 Ga0070715_10019542 3300006163 Bacteria 2600
32 Ga0068871_100017154 3300006358 Bacteria 5472
33 Ga0075428_100005142 3300006844 Bacteria 14546
34 Ga0075430_100044412 3300006846 Bacteria 3758
35 Ga0075434_100053851 3300006871 Bacteria 3998
36 Ga0075436_100034167 3300006914 Bacteria 3506
37 Ga0105251_10032506 3300009011 Bacteria 2599
38 Ga0105240_10004610 3300009093 Bacteria 20893
39 Ga0111539_10000098 3300009094 Bacteria 91568
40 Ga0111539_10072065 3300009094 Bacteria 4075
41 Ga0111539_10316951 3300009094 Bacteria 1815
42 Ga0114129_10004134 3300009147 Bacteria 20509
43 Ga0105248_10018451 3300009177 Bacteria 7709
44 Ga0105237_10010295 3300009545 Bacteria 9961
45 Ga0105237_10047227 3300009545 Bacteria 4328
46 Ga0105238_10003214 3300009551 Bacteria 16317
47 Ga0105238_10099985 3300009551 Bacteria 2883
48 Ga0105239_10076647 3300010375 Bacteria 3678
49 Ga0157369_10001066 3300013105 Bacteria 34424
50 Ga0157369_10100496 3300013105 Bacteria 3083
51 Ga0157374_10165844 3300013296 Bacteria 2153
52 Ga0157378_10019640 3300013297 Bacteria 5940
53 Ga0163162_10027349 3300013306 Bacteria 5640
54 Ga0157372_10000637 3300013307 Bacteria 38480
55 Ga0157375_10019876 3300013308 Bacteria 6122
56 Ga0157379_10013121 3300014968 Bacteria 7254
57 Ga0157376_10013076 3300014969 Bacteria 6180
58 Ga0183361_10004 3300016635 Bacteria 484183
59 Ga0213872_10032901 3300021361 Bacteria 2376
60 Ga0224572_1000634 3300024225 Bacteria 4381
61 Ga0228598_1003485 3300024227 Bacteria 3385
62 Ga0228598_1008526 3300024227 Bacteria 2067
63 Ga0209435_100039 3300025206 Bacteria 116879
64 Ga0209672_100287 3300025228 Bacteria 35521
65 Ga0209646_1000137 3300025246 Bacteria 116791
66 Ga0209026_1000135 3300025250 Bacteria 117001
67 Ga0209148_1000126 3300025254 Bacteria 181590
68 Ga0209148_1011071 3300025254 Bacteria 1687
69 Ga0209759_1000154 3300025256 Bacteria 119427
70 Ga0209233_1001295 3300025261 Bacteria 9996
71 Ga0209455_1000105 3300025272 Bacteria 199725
72 Ga0209455_1010650 3300025272 Bacteria 2323
73 Ga0209673_1002063 3300025273 Bacteria 15160
74 Ga0207426_1002029 3300025302 Bacteria 14200
75 Ga0207713_1006080 3300025735 Bacteria 7437
76 Ga0207692_10003165 3300025898 Bacteria 6389
77 Ga0207695_10017328 3300025913 Bacteria 8386
78 Ga0207693_10003071 3300025915 Bacteria 14397
79 Ga0207693_10040956 3300025915 Bacteria 3648
80 Ga0207663_10001512 3300025916 Bacteria 10861
81 Ga0207646_10102431 3300025922 Bacteria 2567
82 Ga0207700_10002771 3300025928 Bacteria 10100
83 Ga0207664_10019656 3300025929 Bacteria 4997
84 Ga0207644_10000779 3300025931 Bacteria 20223
85 Ga0207665_10045393 3300025939 Bacteria 2942
86 Ga0207679_10065772 3300025945 Bacteria 2715
87 Ga0207651_10009674 3300025960 Bacteria 5296
88 Ga0207702_10000014 3300026078 Bacteria 253304
89 Ga0207683_10116894 3300026121 Bacteria 2391
90 Ga0207428_10000432 3300027907 Bacteria 51578
91 Ga0265337_1000818 3300028556 Bacteria 16346
92 Ga0265318_10003163 3300028577 Bacteria 8414
93 Ga0265338_10000082 3300028800 Bacteria 176343
94 Ga0265338_10081631 3300028800 Bacteria 2710
95 Ga0265760_10001321 3300031090 Bacteria 7264
96 Ga0265328_10014704 3300031239 Bacteria 3077
97 Ga0265320_10033665 3300031240 Bacteria 2613
98 Ga0265325_10012961 3300031241 Bacteria 4755
99 Ga0265339_10016332 3300031249 Bacteria 4428
100 Ga0265331_10001037 3300031250 Bacteria 21675
101 Ga0265327_10017532 3300031251 Bacteria 4486
102 Ga0265314_10093284 3300031711 Bacteria 1955
103 Ga0265342_10046900 3300031712 Bacteria 2595
104 Ga0373954_0007255 3300035118 Bacteria 4843
105 Ga0373943_0043801 3300035170 Bacteria 2175
106 Ga0373946_0010788 3300035171 Bacteria 3393
107 Ga0373946_0025575 3300035171 Bacteria 2322
108 Ga0373955_0090845 3300035172 Bacteria 1740
109 Ga0373924_0002395 3300035410 Bacteria 6309
110 Ga0373931_0007496 3300035691 Bacteria 5138
111 Ga0373935_0010232 3300035692 Bacteria 5621
112 Ga0373927_0013262 3300035695 Bacteria 5478
113 Ga0373927_0028192 3300035695 Bacteria 3663
114 Ga0373927_0031685 3300035695 Bacteria 3444
115 Ga0373947_0009767 3300035725 Bacteria 5508
116 Ga0373947_0049052 3300035725 Bacteria 2534
117 Ga0373947_0058866 3300035725 Bacteria 2328
118 Ga0373937_0039144 3300036401 Bacteria 4321
119 Ga0373937_0073544 3300036401 Bacteria 3153
120 Ga0373937_0172827 3300036401 Bacteria 2027
121 Ga0373925_0049979 3300037068 Bacteria 3118
122 Ga0373925_0085184 3300037068 Bacteria 2409
123 Ga0373925_0112481 3300037068 Bacteria 2105
124 Ga0395900_0004620 3300037418 Bacteria 14529
125 Ga0395898_0015111 3300037466 Bacteria 7924
126 Ga0395905_0092247 3300037471 Bacteria 2840
127 Ga0436364_0365007 3300037853 Bacteria 6806
128 Ga0395901_0009450 3300038443 Bacteria 9893
129 Ga0436365_0244711 3300039437 Bacteria 3311
130 Ga0436365_0600268 3300039437 Bacteria 3727
131 Ga0436365_1604716 3300039437 Bacteria 3097
132 Ga0436360_0797500 3300039438 Bacteria 2437
133 Ga0436361_0593175 3300039447 Bacteria 8012
134 Ga0439465_0002548 3300041413 Bacteria 5937
135 Ga0439449_0027192 3300042007 Bacteria 2135
136 Ga0439463_030634 3300042016 Bacteria 1357
137 Ga0450901_000803 3300042533 Bacteria 3671
138 Ga0453683_0058606 3300044673 Bacteria 2409
139 Ga0466966_0000461 3300044684 Bacteria 26075
140 Ga0466961_0038373 3300044693 Bacteria 3072
141 Ga0466971_0025639 3300044719 Bacteria 2632
142 Ga0466970_0019926 3300044765 Bacteria 3480
143 Ga0466959_0012959 3300045049 Bacteria 6035
144 Ga0451576_0023623 3300045051 Bacteria 6654
145 Ga0451576_0047545 3300045051 Bacteria 4510
146 Ga0466967_0142202 3300045976 Bacteria 2236
147 Ga0466967_0219079 3300045976 Bacteria 1808
148 Ga0495592_0030988 3300046454 Bacteria 4044
149 Ga0495603_0001001 3300046455 Bacteria 16316
150 Ga0495603_0089787 3300046455 Bacteria 1798
151 Ga0495629_0010803 3300046459 Bacteria 6642
152 Ga0495629_0134280 3300046459 Bacteria 1723
153 Ga0495641_0024202 3300046461 Bacteria 3001
154 Ga0495641_0075348 3300046461 Bacteria 1513
155 Ga0495651_0039092 3300046462 Bacteria 3694
156 Ga0495653_0055932 3300046463 Bacteria 3010
157 Ga0495580_0001125 3300046472 Bacteria 23556
158 Ga0495580_0062569 3300046472 Bacteria 2611
159 Ga0495582_0019101 3300046473 Bacteria 3750
160 Ga0495639_0004439 3300046475 Bacteria 6014
161 Ga0495662_0012298 3300046476 Bacteria 4177
162 Ga0495664_0008661 3300046477 Bacteria 5677
163 Ga0495664_0022819 3300046477 Bacteria 3630
164 Ga0495664_0034010 3300046477 Bacteria 2997
165 Ga0495594_0006868 3300046499 Bacteria 5851
166 Ga0495594_0096885 3300046499 Bacteria 1658
167 Ga0495608_0070962 3300046511 Bacteria 2273
168 Ga0495610_0082500 3300046512 Bacteria 1473
169 Ga0495618_0013944 3300046514 Bacteria 4892
170 Ga0495620_0026672 3300046515 Bacteria 2714
171 Ga0495628_0026029 3300046516 Bacteria 4776
172 Ga0495666_0008370 3300046526 Bacteria 5185
173 Ga0495652_0199026 3300046529 Bacteria 1522
174 Ga0495665_0022876 3300046531 Bacteria 3357
175 Ga0495640_0012080 3300046533 Bacteria 6615
176 Ga0495640_0038261 3300046533 Bacteria 3375
177 Ga0495640_0123021 3300046533 Bacteria 1684
178 Ga0495586_0040110 3300046535 Bacteria 2518
179 Ga0495587_0029479 3300046536 Bacteria 3331
180 Ga0495587_0103422 3300046536 Bacteria 1640
181 Ga0495667_0148082 3300046559 Bacteria 1512
182 Ga0495668_0010579 3300046616 Bacteria 5576
183 Ga0495634_0043264 3300046642 Bacteria 3053
184 Ga0495634_0061076 3300046642 Bacteria 2506
185 Ga0495634_0090832 3300046642 Bacteria 1983
186 Ga0495635_0050039 3300046663 Bacteria 2880
187 Ga0495635_0107372 3300046663 Unclassified 1907
188 Ga0495588_0124548 3300046674 Bacteria 1359
189 Ga0495646_0042574 3300046680 Bacteria 2786
190 Ga0495646_0067413 3300046680 Unclassified 2115
191 Ga0495647_0000529 3300046681 Bacteria 11184
192 Ga0495647_0020003 3300046681 Bacteria 2400
193 Ga0495658_0017413 3300046683 Bacteria 3711
194 Ga0495658_0018737 3300046683 Bacteria 3603
195 Ga0495613_0072452 3300046689 Bacteria 2511
196 Ga0495624_0035920 3300046690 Bacteria 3197
197 Ga0495624_0082612 3300046690 Bacteria 1988
198 Ga0495649_0017626 3300046694 Bacteria 4027
199 Ga0495649_0050143 3300046694 Bacteria 2266
200 Ga0495600_0138428 3300046809 Bacteria 1580
201 Ga0495581_0024467 3300047315 Bacteria 3499
202 Ga0495581_0035444 3300047315 Bacteria 2887
203 Ga0495604_0049294 3300047317 Unclassified 3273
204 Ga0495674_0006348 3300047319 Bacteria 11331
205 Ga0495674_0021508 3300047319 Bacteria 5966
206 Ga0495674_0031950 3300047319 Bacteria 4777
207 Ga0495674_0037949 3300047319 Bacteria 4328
208 Ga0495674_0074529 3300047319 Bacteria 2922
209 Ga0495674_0076938 3300047319 Unclassified 2870
210 Ga0495672_0019507 3300047320 Bacteria 4470
211 Ga0495676_0233801 3300047321 Bacteria 1261
212 Ga0495680_0054152 3300047322 Bacteria 3117
213 Ga0495683_0003685 3300047323 Bacteria 8879
214 Ga0495687_000005 3300047443 Bacteria 610401
215 Ga0495675_0015194 3300047444 Bacteria 4867
216 Ga0495679_025977 3300047446 Bacteria 1950
217 Ga0495684_0016562 3300047471 Bacteria 5678
218 Ga0495684_0153800 3300047471 Bacteria 1719
219 Ga0495602_0003512 3300048088 Bacteria 16217
220 Ga0495602_0176693 3300048088 Bacteria 1651
221 Ga0495602_0224160 3300048088 Bacteria 1417
222 Ga0496100_0014726 3300048903 Bacteria 4548
223 Ga0496101_0010506 3300048904 Bacteria 6114
224 Ga0496102_0002302 3300048905 Bacteria 16319
225 Ga0496102_0129601 3300048905 Bacteria 2360
226 Ga0496103_0005172 3300048906 Bacteria 7850
227 Ga0496104_0038377 3300048907 Bacteria 4481
228 Ga0496104_0062289 3300048907 Bacteria 3537
229 Ga0496106_0031656 3300048909 Bacteria 3942
230 Ga0496106_0189246 3300048909 Bacteria 1636
231 Ga0496107_0016268 3300048910 Bacteria 5220
232 Ga0496107_0067303 3300048910 Bacteria 2599
233 Ga0496108_0135999 3300048911 Bacteria 2115
234 Ga0496109_0207193 3300048912 Bacteria 1844
235 Ga0496110_0007470 3300048913 Bacteria 8736
236 Ga0496110_0014885 3300048913 Bacteria 6464
237 Ga0496111_0005338 3300048914 Bacteria 8214
238 Ga0496111_0029240 3300048914 Bacteria 3913
239 Ga0496112_0031461 3300048915 Bacteria 5147
240 Ga0496112_0067347 3300048915 Bacteria 3534
241 Ga0496112_0105037 3300048915 Bacteria 2794
242 Ga0496113_0005891 3300048916 Bacteria 7694
243 Ga0496113_0083299 3300048916 Bacteria 2454
244 Ga0496114_0029223 3300048917 Bacteria 4529
245 Ga0496115_0008697 3300048918 Bacteria 7522
246 Ga0496116_0011562 3300048919 Bacteria 7288
247 Ga0496116_0019169 3300048919 Bacteria 5246
248 Ga0496117_0080501 3300048920 Bacteria 2142
249 Ga0496118_0008084 3300048921 Bacteria 10966
250 Ga0496118_0015245 3300048921 Bacteria 7128
251 Ga0496118_0021595 3300048921 Bacteria 5660
252 Ga0496121_0012045 3300048924 Bacteria 9501
253 Ga0496121_0041085 3300048924 Bacteria 4048
254 Ga0496122_0037136 3300048925 Bacteria 3927
255 Ga0496124_0051561 3300048927 Bacteria 3501
256 Ga0496125_0008075 3300048928 Bacteria 11095
257 Ga0496125_0077542 3300048928 Bacteria 2561
258 Ga0496126_0065846 3300048929 Bacteria 3241
259 Ga0495678_000919 3300049459 Bacteria 25836
260 Ga0501031_0171915 3300049568 Bacteria 1416
261 Ga0501033_0049155 3300049570 Bacteria 3131
262 Ga0501033_0100937 3300049570 Bacteria 2105
263 Ga0501034_0070552 3300049571 Bacteria 3505
264 Ga0501034_0249696 3300049571 Bacteria 1719
265 Ga0501037_0000203 3300049573 Bacteria 53647
266 Ga0501038_0124976 3300049574 Bacteria 2118
267 Ga0501039_0095797 3300049575 Bacteria 2314
268 Ga0501040_0014531 3300049576 Bacteria 5190
269 Ga0501040_0023409 3300049576 Bacteria 4142
270 Ga0501040_0076529 3300049576 Bacteria 2314
271 Ga0501043_0048075 3300049579 Bacteria 3354
272 Ga0501046_0000224 3300049580 Bacteria 58986
273 Ga0501047_0002910 3300049581 Bacteria 16257
274 Ga0501047_0105067 3300049581 Bacteria 2705
275 Ga0501067_0005540 3300049583 Bacteria 6997
276 Ga0501068_0006467 3300049584 Bacteria 6464
277 Ga0501068_0059080 3300049584 Bacteria 2328
278 Ga0501070_0009046 3300049586 Bacteria 8425
279 Ga0501072_0060177 3300049588 Bacteria 2995
280 Ga0501073_0000002 3300049589 Bacteria 323865
281 Ga0501073_0001853 3300049589 Bacteria 15756
282 Ga0501073_0198563 3300049589 Bacteria 1387
283 Ga0501074_0095162 3300049590 Bacteria 2133
284 Ga0501075_0178104 3300049591 Bacteria 1622
285 Ga0501076_0045683 3300049592 Bacteria 3458
286 Ga0501076_0070103 3300049592 Bacteria 2802
287 Ga0501077_0000010 3300049593 Bacteria 97557
288 Ga0501077_0077553 3300049593 Bacteria 2105
289 Ga0501079_0030841 3300049741 Bacteria 4120
290 Ga0501079_0121304 3300049741 Bacteria 2033
291 Ga0501080_0007739 3300049742 Bacteria 9714
292 Ga0501080_0070736 3300049742 Bacteria 3245
293 Ga0501080_0218366 3300049742 Bacteria 1745
294 Ga0501081_0002499 3300049743 Bacteria 11592
295 Ga0501081_0039964 3300049743 Bacteria 3211
296 Ga0501081_0247447 3300049743 Bacteria 1301
297 Ga0501083_0023028 3300049744 Bacteria 4323
298 Ga0501083_0050193 3300049744 Bacteria 2809
299 Ga0501035_0014165 3300049822 Bacteria 7358
300 Ga0501044_0004961 3300049823 Bacteria 14881
301 Ga0501044_0024499 3300049823 Bacteria 6404
302 Ga0501044_0249547 3300049823 Bacteria 1716
303 Ga0501045_0138529 3300049824 Bacteria 1809
304 nmdc:mga00v17_20596_c1 3300050491 Bacteria 3780
305 nmdc:mga00v17_59933_c1 3300050491 Unclassified 2336
306 nmdc:mga00v17_67010_c1 3300050491 Bacteria 2217
307 nmdc:mga05p37_117097_c1 3300050507 Bacteria 3275
308 nmdc:mga05p37_216548_c1 3300050507 Bacteria 2313
309 nmdc:mga09592_37055_c1 3300050508 Bacteria 4089
310 nmdc:mga06r32_59720_c1 3300050510 Bacteria 3669
311 nmdc:mga08y16_216_c1 3300050511 Bacteria 51710
312 nmdc:mga08x19_5647_c1 3300050514 Bacteria 7392
313 Ga0495601_0007503 3300053077 Bacteria 6398
314 Ga0495601_0089180 3300053077 Unclassified 1983
315 Ga0495612_0013989 3300053078 Bacteria 3231
316 Ga0495612_0017759 3300053078 Bacteria 2848
317 Ga0495612_0050809 3300053078 Bacteria 1703
318 Ga0495595_0065372 3300053084 Bacteria 1711
319 Ga0495595_0071929 3300053084 Bacteria 1636
320 Ga0495619_0041455 3300053085 Bacteria 3011
321 Ga0495619_0051634 3300053085 Bacteria 2717
322 Ga0495619_0055200 3300053085 Bacteria 2630
323 Ga0495619_0173816 3300053085 Bacteria 1490
324 Ga0501084_0004797 3300054114 Bacteria 11057
325 Ga0501084_0018817 3300054114 Bacteria 5749
326 Ga0501082_0053489 3300060353 Bacteria 3480
327 Ga0501082_0066587 3300060353 Bacteria 3102
328 Ga0466962_0007103 3300061719 Bacteria 5368
329 Ga0530510_0118899 3300061734 Bacteria 1939
330 Ga0530510_0283071 3300061734 Bacteria 1239
331 2512345880 2512047030 Bacteria 9031815
332 2512530759 2512047086 Bacteria 6850303
333 2513885743 2513237140 Bacteria 7076289
334 2513894221 2513237141 Bacteria 8496279
335 2513928876 2513237146 Bacteria 7166346
336 2515612665 2515154107 Bacteria 6795637
337 2563061014 2562617112 Bacteria 10918404
338 2578339290 2576861424 Bacteria 5270569
339 2596373070 2595698237 Bacteria 6712432
340 2599414893 2599185170 Bacteria 7295545
341 2643775694 2643221551 Bacteria 3750538
342 2643794141 2643221555 Bacteria 3749717
343 2643859773 2643221569 Bacteria 6064337
344 2757571119 2757320392 Bacteria 3737298
345 2792624244 2791355091 Bacteria 6135441
346 2792630384 2791355092 Bacteria 6248105
347 2808982694 2808606386 Bacteria 4471946
348 2809130195 2808606415 Bacteria 4576710
349 2809150328 2808606419 Bacteria 4576925
350 2821271078 2821268502 Bacteria 3750023
351 2838039387 2838035591 Bacteria 7166484
352 2838081089 2838074704 Bacteria 6785777
353 2838667562 2838661181 Bacteria 7385261
354 2842779812 2842775625 Bacteria 5587290
355 2844318403 2844315083 Bacteria 8138177
356 2871471835 2871466892 Bacteria 6923287
357 2883358017 2883354860 Bacteria 5865246
358 2885317327 2885312484 Bacteria 6415165
359 2885379489 2885374607 Bacteria 8927485
360 2887378823 2887375801 Bacteria 5334027
361 2889794214 2889790730 Bacteria 5689708
362 2889918189 2889914905 Bacteria 5702301
363 2896385061 2896384573 Bacteria 7700774
364 2899262167 2899259804 Bacteria 3320927
365 2903774119 2903768456 Bacteria 9749579
366 2904116497 2904113452 Bacteria 7796941
367 2906606008 2906602504 Bacteria 8295279
368 2921645352 2921643360 Bacteria 11448031
369 2928128740 2928125067 Bacteria 5937560
370 2933020646 2933016740 Bacteria 6355406
371 2971514108 2971511577 Bacteria 5404012
372 2980180316 2980176882 Bacteria 5397533
373 642597487 642555112 Bacteria 8676562
374 Ga0466969_0001544
375 JGI25155J39150_1000043
376 JGI25156J39149_1000056
377 JGI25154J39366_1000086
378 JGI25157J39369_1001951
379 JGI25151J46595_10015855
380 rootH1_10315523
381 Ga0055542_1002036
382 Ga0055541_1003631
383 Ga0070658_10007331
384 Ga0070666_10048820
385 Ga0070671_100001331
386 Ga0070673_100008464
387 Ga0070709_10002985
388 Ga0070714_100013754
389 Ga0070713_100083861
390 Ga0070711_100007420
391 Ga0070706_100150783
392 Ga0070699_100024234
393 Ga0070684_100203144
394 Ga0070696_100047141
395 Ga0070665_100190316
396 Ga0070704_100093012
397 Ga0068856_100001092
398 Ga0068852_100229198
399 Ga0081455_10000092
400 Ga0081455_10056795
401 Ga0070717_10166889
402 Ga0075364_10034049
403 Ga0075364_10068668
404 Ga0070715_10019542
405 Ga0068871_100017154
406 Ga0075428_100005142
407 Ga0075430_100044412
408 Ga0075434_100053851
409 Ga0075436_100034167
410 Ga0105251_10032506
411 Ga0105240_10004610
412 Ga0111539_10000098
413 Ga0111539_10072065
414 Ga0111539_10316951
415 Ga0114129_10004134
416 Ga0105248_10018451
417 Ga0105237_10010295
418 Ga0105237_10047227
419 Ga0105238_10003214
420 Ga0105238_10099985
421 Ga0105239_10076647
422 Ga0157369_10001066
423 Ga0157369_10100496
424 Ga0157374_10165844
425 Ga0157378_10019640
426 Ga0163162_10027349
427 Ga0157372_10000637
428 Ga0157375_10019876
429 Ga0157379_10013121
430 Ga0157376_10013076
431 Ga0183361_10004
432 Ga0213872_10032901
433 Ga0224572_1000634
434 Ga0228598_1003485
435 Ga0228598_1008526
436 Ga0209435_100039
437 Ga0209672_100287
438 Ga0209646_1000137
439 Ga0209026_1000135
440 Ga0209148_1000126
441 Ga0209148_1011071
442 Ga0209759_1000154
443 Ga0209233_1001295
444 Ga0209455_1000105
445 Ga0209455_1010650
446 Ga0209673_1002063
447 Ga0207426_1002029
448 Ga0207713_1006080
449 Ga0207692_10003165
450 Ga0207695_10017328
451 Ga0207693_10003071
452 Ga0207693_10040956
453 Ga0207663_10001512
454 Ga0207646_10102431
455 Ga0207700_10002771
456 Ga0207664_10019656
457 Ga0207644_10000779
458 Ga0207665_10045393
459 Ga0207679_10065772
460 Ga0207651_10009674
461 Ga0207702_10000014
462 Ga0207683_10116894
463 Ga0207428_10000432
464 Ga0265337_1000818
465 Ga0265318_10003163
466 Ga0265338_10000082
467 Ga0265338_10081631
468 Ga0265760_10001321
469 Ga0265328_10014704
470 Ga0265320_10033665
471 Ga0265325_10012961
472 Ga0265339_10016332
473 Ga0265331_10001037
474 Ga0265327_10017532
475 Ga0265314_10093284
476 Ga0265342_10046900
477 Ga0373954_0007255
478 Ga0373943_0043801
479 Ga0373946_0010788
480 Ga0373946_0025575
481 Ga0373955_0090845
482 Ga0373924_0002395
483 Ga0373931_0007496
484 Ga0373935_0010232
485 Ga0373927_0013262
486 Ga0373927_0028192
487 Ga0373927_0031685
488 Ga0373947_0009767
489 Ga0373947_0049052
490 Ga0373947_0058866
491 Ga0373937_0039144
492 Ga0373937_0073544
493 Ga0373937_0172827
494 Ga0373925_0049979
495 Ga0373925_0085184
496 Ga0373925_0112481
497 Ga0395900_0004620
498 Ga0395898_0015111
499 Ga0395905_0092247
500 Ga0436364_0365007
501 Ga0395901_0009450
502 Ga0436365_0244711
503 Ga0436365_0600268
504 Ga0436365_1604716
505 Ga0436360_0797500
506 Ga0436361_0593175
507 Ga0439465_0002548
508 Ga0439449_0027192
509 Ga0439463_030634
510 Ga0450901_000803
511 Ga0453683_0058606
512 Ga0466966_0000461
513 Ga0466961_0038373
514 Ga0466971_0025639
515 Ga0466970_0019926
516 Ga0466959_0012959
517 Ga0451576_0023623
518 Ga0451576_0047545
519 Ga0466967_0142202
520 Ga0466967_0219079
521 Ga0495592_0030988
522 Ga0495603_0001001
523 Ga0495603_0089787
524 Ga0495629_0010803
525 Ga0495629_0134280
526 Ga0495641_0024202
527 Ga0495641_0075348
528 Ga0495651_0039092
529 Ga0495653_0055932
530 Ga0495580_0001125
531 Ga0495580_0062569
532 Ga0495582_0019101
533 Ga0495639_0004439
534 Ga0495662_0012298
535 Ga0495664_0008661
536 Ga0495664_0022819
537 Ga0495664_0034010
538 Ga0495594_0006868
539 Ga0495594_0096885
540 Ga0495608_0070962
541 Ga0495610_0082500
542 Ga0495618_0013944
543 Ga0495620_0026672
544 Ga0495628_0026029
545 Ga0495666_0008370
546 Ga0495652_0199026
547 Ga0495665_0022876
548 Ga0495640_0012080
549 Ga0495640_0038261
550 Ga0495640_0123021
551 Ga0495586_0040110
552 Ga0495587_0029479
553 Ga0495587_0103422
554 Ga0495667_0148082
555 Ga0495668_0010579
556 Ga0495634_0043264
557 Ga0495634_0061076
558 Ga0495634_0090832
559 Ga0495635_0050039
560 Ga0495635_0107372
561 Ga0495588_0124548
562 Ga0495646_0042574
563 Ga0495646_0067413
564 Ga0495647_0000529
565 Ga0495647_0020003
566 Ga0495658_0017413
567 Ga0495658_0018737
568 Ga0495613_0072452
569 Ga0495624_0035920
570 Ga0495624_0082612
571 Ga0495649_0017626
572 Ga0495649_0050143
573 Ga0495600_0138428
574 Ga0495581_0024467
575 Ga0495581_0035444
576 Ga0495604_0049294
577 Ga0495674_0006348
578 Ga0495674_0021508
579 Ga0495674_0031950
580 Ga0495674_0037949
581 Ga0495674_0074529
582 Ga0495674_0076938
583 Ga0495672_0019507
584 Ga0495676_0233801
585 Ga0495680_0054152
586 Ga0495683_0003685
587 Ga0495687_000005
588 Ga0495675_0015194
589 Ga0495679_025977
590 Ga0495684_0016562
591 Ga0495684_0153800
592 Ga0495602_0003512
593 Ga0495602_0176693
594 Ga0495602_0224160
595 Ga0496100_0014726
596 Ga0496101_0010506
597 Ga0496102_0002302
598 Ga0496102_0129601
599 Ga0496103_0005172
600 Ga0496104_0038377
601 Ga0496104_0062289
602 Ga0496106_0031656
603 Ga0496106_0189246
604 Ga0496107_0016268
605 Ga0496107_0067303
606 Ga0496108_0135999
607 Ga0496109_0207193
608 Ga0496110_0007470
609 Ga0496110_0014885
610 Ga0496111_0005338
611 Ga0496111_0029240
612 Ga0496112_0031461
613 Ga0496112_0067347
614 Ga0496112_0105037
615 Ga0496113_0005891
616 Ga0496113_0083299
617 Ga0496114_0029223
618 Ga0496115_0008697
619 Ga0496116_0011562
620 Ga0496116_0019169
621 Ga0496117_0080501
622 Ga0496118_0008084
623 Ga0496118_0015245
624 Ga0496118_0021595
625 Ga0496121_0012045
626 Ga0496121_0041085
627 Ga0496122_0037136
628 Ga0496124_0051561
629 Ga0496125_0008075
630 Ga0496125_0077542
631 Ga0496126_0065846
632 Ga0495678_000919
633 Ga0501031_0171915
634 Ga0501033_0049155
635 Ga0501033_0100937
636 Ga0501034_0070552
637 Ga0501034_0249696
638 Ga0501037_0000203
639 Ga0501038_0124976
640 Ga0501039_0095797
641 Ga0501040_0014531
642 Ga0501040_0023409
643 Ga0501040_0076529
644 Ga0501043_0048075
645 Ga0501046_0000224
646 Ga0501047_0002910
647 Ga0501047_0105067
648 Ga0501067_0005540
649 Ga0501068_0006467
650 Ga0501068_0059080
651 Ga0501070_0009046
652 Ga0501072_0060177
653 Ga0501073_0000002
654 Ga0501073_0001853
655 Ga0501073_0198563
656 Ga0501074_0095162
657 Ga0501075_0178104
658 Ga0501076_0045683
659 Ga0501076_0070103
660 Ga0501077_0000010
661 Ga0501077_0077553
662 Ga0501079_0030841
663 Ga0501079_0121304
664 Ga0501080_0007739
665 Ga0501080_0070736
666 Ga0501080_0218366
667 Ga0501081_0002499
668 Ga0501081_0039964
669 Ga0501081_0247447
670 Ga0501083_0023028
671 Ga0501083_0050193
672 Ga0501035_0014165
673 Ga0501044_0004961
674 Ga0501044_0024499
675 Ga0501044_0249547
676 Ga0501045_0138529
677 nmdc:mga00v17_20596_c1
678 nmdc:mga00v17_59933_c1
679 nmdc:mga00v17_67010_c1
680 nmdc:mga05p37_117097_c1
681 nmdc:mga05p37_216548_c1
682 nmdc:mga09592_37055_c1
683 nmdc:mga06r32_59720_c1
684 nmdc:mga08y16_216_c1
685 nmdc:mga08x19_5647_c1
686 Ga0495601_0007503
687 Ga0495601_0089180
688 Ga0495612_0013989
689 Ga0495612_0017759
690 Ga0495612_0050809
691 Ga0495595_0065372
692 Ga0495595_0071929
693 Ga0495619_0041455
694 Ga0495619_0051634
695 Ga0495619_0055200
696 Ga0495619_0173816
697 Ga0501084_0004797
698 Ga0501084_0018817
699 Ga0501082_0053489
700 Ga0501082_0066587
701 Ga0466962_0007103
702 Ga0530510_0118899
703 Ga0530510_0283071
704 2512345880
705 2512530759
706 2513885743
707 2513894221
708 2513928876
709 2515612665
710 2563061014
711 2578339290
712 2596373070
713 2599414893
714 2643775694
715 2643794141
716 2643859773
717 2757571119
718 2792624244
719 2792630384
720 2808982694
721 2809130195
722 2809150328
723 2821271078
724 2838039387
725 2838081089
726 2838667562
727 2842779812
728 2844318403
729 2871471835
730 2883358017
731 2885317327
732 2885379489
733 2887378823
734 2889794214
735 2889918189
736 2896385061
737 2899262167
738 2903774119
739 2904116497
740 2906606008
741 2921645352
742 2928128740
743 2933020646
744 2971514108
745 2980180316
746 642597487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

322

490

0.91

PF02417

Chromate_transp

Chromate transporter

98

264

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pgi-assembly1.cif.gz_A asymmetric functions of a binuclear metal cluster within the transport pathway of the zip transition metal transporters 0.3203 73 397
6pgi-assembly1.cif.gz_A asymmetric functions of a binuclear metal cluster within the transport pathway of the zip transition metal transporters 0.3149 73 397
5da0-assembly1.cif.gz_A structure of the the slc26 transporter slc26dg in complex with a nanobody 0.314 16 398
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.3134 16 398
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.311 15 403
ID Description Score Start End Superfamily
af_K7KAW4_24_173_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3222 202 321 1.20.140.40
af_I1LDE6_35_179_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3082 202 320 1.20.140.40
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.307 11 357 1.20.1250.20
af_A4ICC3_65_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2934 55 402 1.20.1740.10
af_A0A1D8PNR5_26_494_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.2845 19 402 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A7I8C0W6-F1-model_v4 Chromate transporter 0.9975 19 108 GO:0005886
GO:0015109
AF-A0A679JBY9-F1-model_v4 Putative chromate transport protein 0.9842 12 404 GO:0005886
GO:0015109
AF-A0A2W4QVS8-F1-model_v4 deleted 0.9838 37 400
AF-A0A023XLP2-F1-model_v4 deleted 0.9834 83 404
AF-A0A5K1I966-F1-model_v4 Putative chromate transport protein 0.9833 13 400 GO:0005886
GO:0015109

Map