F426465
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 373 | 244 | 372 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300046514|Ga0495618_0015074|Ga0495618_0015074_879_1886 |
| Length | 335 |
| Sequence | MKFASLVQNRKALIGLILFGITALVGIFPGLFASKADADTIGAFSPNLGVSTAHLLGTTSYGQDIFSQLVFGARQVLVIALVAGAFATVLAVLIGITAAYMGGIVDEVLSLFTNVVLILPTFPLMIILARYAGTSNWVMIIVLVVTGWSYGANQMRAQALSLRNRDFLEAARVRGERRSYIILFEMMPTMTSLIVANFLGSALYSVLAASGLQFIGLGDKTSDSWGTMLYWADSQEALQAGNALWIIAPGLAIAVLSAAFALMNYAFDEIGNPALRPVRRKDLRKARKADAEAQRGAEHVYCLSRCLIRPSRCWTCGICGSSTTRRVARWRRVPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 140 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 145 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 146 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 149 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 163 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 164 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 165 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 166 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 167 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 168 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 228 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 0.8 |
| Isolates | 0.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.8 |
| Nodule | 0 |
| Rhizoplane | 5.9 |
| Rhizosphere | 89.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002148 | 3300001976 | Bacteria | 2633 |
| 2 | JGI24740J21852_10013421 | 3300001979 | Bacteria | 3056 |
| 3 | JGI24739J22299_10000936 | 3300001989 | Bacteria | 10868 |
| 4 | JGI24751J29686_10001163 | 3300002459 | Bacteria | 5628 |
| 5 | rootH2_10024901 | 3300003320 | Bacteria | 5117 |
| 6 | Ga0055540_1001492 | 3300003792 | Bacteria | 13904 |
| 7 | Ga0070658_10002248 | 3300005327 | Bacteria | 16196 |
| 8 | Ga0070658_10037938 | 3300005327 | Bacteria | 3885 |
| 9 | Ga0070658_10042503 | 3300005327 | Bacteria | 3671 |
| 10 | Ga0068869_100080091 | 3300005334 | Bacteria | 2435 |
| 11 | Ga0070680_100003841 | 3300005336 | Bacteria | 11228 |
| 12 | Ga0068868_100009852 | 3300005338 | Bacteria | 6899 |
| 13 | Ga0070660_100006399 | 3300005339 | Bacteria | 8164 |
| 14 | Ga0070691_10002949 | 3300005341 | Bacteria | 7627 |
| 15 | Ga0070661_100022644 | 3300005344 | Bacteria | 4499 |
| 16 | Ga0070692_10001488 | 3300005345 | Bacteria | 8550 |
| 17 | Ga0070668_100162654 | 3300005347 | Bacteria | 1812 |
| 18 | Ga0070675_100013299 | 3300005354 | Bacteria | 6467 |
| 19 | Ga0070671_100103133 | 3300005355 | Bacteria | 2393 |
| 20 | Ga0070673_100008420 | 3300005364 | Bacteria | 6858 |
| 21 | Ga0070659_100005968 | 3300005366 | Bacteria | 8782 |
| 22 | Ga0070667_100128205 | 3300005367 | Bacteria | 2213 |
| 23 | Ga0070709_10185763 | 3300005434 | Bacteria | 1463 |
| 24 | Ga0070714_100007089 | 3300005435 | Bacteria | 8692 |
| 25 | Ga0070713_100004044 | 3300005436 | Bacteria | 9769 |
| 26 | Ga0070713_100125388 | 3300005436 | Bacteria | 2258 |
| 27 | Ga0070701_10095939 | 3300005438 | Bacteria | 1634 |
| 28 | Ga0070711_100029896 | 3300005439 | Bacteria | 3601 |
| 29 | Ga0070663_100012554 | 3300005455 | Bacteria | 5364 |
| 30 | Ga0070662_100339384 | 3300005457 | Bacteria | 1229 |
| 31 | Ga0070681_10437439 | 3300005458 | Bacteria | 1220 |
| 32 | Ga0070706_100000400 | 3300005467 | Bacteria | 52368 |
| 33 | Ga0070706_100122025 | 3300005467 | Bacteria | 2429 |
| 34 | Ga0070706_100292530 | 3300005467 | Bacteria | 1520 |
| 35 | Ga0070707_100024348 | 3300005468 | Bacteria | 5733 |
| 36 | Ga0070698_100103518 | 3300005471 | Bacteria | 2817 |
| 37 | Ga0070699_100267580 | 3300005518 | Bacteria | 1529 |
| 38 | Ga0070679_100010266 | 3300005530 | Bacteria | 8877 |
| 39 | Ga0070679_100016122 | 3300005530 | Bacteria | 7199 |
| 40 | Ga0070679_100091820 | 3300005530 | Bacteria | 3024 |
| 41 | Ga0068853_100078072 | 3300005539 | Bacteria | 2893 |
| 42 | Ga0068853_100213900 | 3300005539 | Bacteria | 1758 |
| 43 | Ga0070686_100112790 | 3300005544 | Bacteria | 1855 |
| 44 | Ga0070693_100002658 | 3300005547 | Bacteria | 8229 |
| 45 | Ga0070665_100010846 | 3300005548 | Bacteria | 9216 |
| 46 | Ga0070704_100189156 | 3300005549 | Bacteria | 1653 |
| 47 | Ga0068855_100002594 | 3300005563 | Bacteria | 22270 |
| 48 | Ga0068855_100005004 | 3300005563 | Bacteria | 16171 |
| 49 | Ga0068855_100012152 | 3300005563 | Bacteria | 10404 |
| 50 | Ga0068855_100134281 | 3300005563 | Bacteria | 2824 |
| 51 | Ga0068855_100387891 | 3300005563 | Bacteria | 1533 |
| 52 | Ga0068857_100248912 | 3300005577 | Bacteria | 1629 |
| 53 | Ga0068854_100002542 | 3300005578 | Bacteria | 11293 |
| 54 | Ga0068854_100073178 | 3300005578 | Bacteria | 2511 |
| 55 | Ga0068856_100012979 | 3300005614 | Bacteria | 8067 |
| 56 | Ga0068856_100013286 | 3300005614 | Bacteria | 7975 |
| 57 | Ga0068852_100004937 | 3300005616 | Bacteria | 9472 |
| 58 | Ga0068852_100109928 | 3300005616 | Bacteria | 2504 |
| 59 | Ga0068859_100052159 | 3300005617 | Bacteria | 4112 |
| 60 | Ga0068864_100043428 | 3300005618 | Bacteria | 3849 |
| 61 | Ga0068864_100128638 | 3300005618 | Bacteria | 2272 |
| 62 | Ga0068861_100175835 | 3300005719 | Bacteria | 1778 |
| 63 | Ga0068851_10135338 | 3300005834 | Bacteria | 1336 |
| 64 | Ga0068870_10000206 | 3300005840 | Bacteria | 21149 |
| 65 | Ga0068863_100170175 | 3300005841 | Bacteria | 2089 |
| 66 | Ga0068863_100176671 | 3300005841 | Bacteria | 2049 |
| 67 | Ga0068858_100025174 | 3300005842 | Bacteria | 5537 |
| 68 | Ga0068858_100594090 | 3300005842 | Bacteria | 1073 |
| 69 | Ga0081455_10011020 | 3300005937 | Bacteria | 9105 |
| 70 | Ga0081455_10078961 | 3300005937 | Bacteria | 2703 |
| 71 | Ga0081540_1011090 | 3300005983 | Bacteria | 6050 |
| 72 | Ga0070717_10053784 | 3300006028 | Bacteria | 3319 |
| 73 | Ga0097621_100007330 | 3300006237 | Bacteria | 7883 |
| 74 | Ga0068871_100008339 | 3300006358 | Bacteria | 7450 |
| 75 | Ga0075433_10006126 | 3300006852 | Bacteria | 9472 |
| 76 | Ga0075434_100005408 | 3300006871 | Bacteria | 11620 |
| 77 | Ga0075436_100000490 | 3300006914 | Bacteria | 25561 |
| 78 | Ga0097620_100052159 | 3300006931 | Bacteria | 4112 |
| 79 | Ga0075435_100000491 | 3300007076 | Bacteria | 24044 |
| 80 | Ga0105240_10010252 | 3300009093 | Bacteria | 13190 |
| 81 | Ga0105240_10018132 | 3300009093 | Bacteria | 9463 |
| 82 | Ga0105240_10087504 | 3300009093 | Bacteria | 3815 |
| 83 | Ga0105240_10091504 | 3300009093 | Bacteria | 3716 |
| 84 | Ga0111539_10006134 | 3300009094 | Bacteria | 15519 |
| 85 | Ga0105245_10010100 | 3300009098 | Bacteria | 8224 |
| 86 | Ga0105247_10015340 | 3300009101 | Bacteria | 4590 |
| 87 | Ga0105241_10003469 | 3300009174 | Bacteria | 11734 |
| 88 | Ga0105241_10006616 | 3300009174 | Bacteria | 8539 |
| 89 | Ga0105248_10119344 | 3300009177 | Bacteria | 2975 |
| 90 | Ga0105237_10026178 | 3300009545 | Bacteria | 5962 |
| 91 | Ga0105237_10042340 | 3300009545 | Bacteria | 4593 |
| 92 | Ga0105238_10002739 | 3300009551 | Bacteria | 17556 |
| 93 | Ga0105238_10031540 | 3300009551 | Bacteria | 5396 |
| 94 | Ga0105249_10782320 | 3300009553 | Bacteria | 1018 |
| 95 | Ga0105239_10040701 | 3300010375 | Bacteria | 5092 |
| 96 | Ga0105246_10001215 | 3300011119 | Bacteria | 15095 |
| 97 | Ga0157371_10062700 | 3300013102 | Bacteria | 2635 |
| 98 | Ga0157370_10006967 | 3300013104 | Bacteria | 12345 |
| 99 | Ga0157370_10014083 | 3300013104 | Bacteria | 8204 |
| 100 | Ga0157370_10394172 | 3300013104 | Bacteria | 1275 |
| 101 | Ga0157369_10010186 | 3300013105 | Bacteria | 10726 |
| 102 | Ga0157369_10018418 | 3300013105 | Bacteria | 7830 |
| 103 | Ga0157369_10286606 | 3300013105 | Bacteria | 1715 |
| 104 | Ga0157374_10009748 | 3300013296 | Bacteria | 8246 |
| 105 | Ga0157372_10011766 | 3300013307 | Bacteria | 9319 |
| 106 | Ga0157372_10060447 | 3300013307 | Bacteria | 4240 |
| 107 | Ga0157372_10160972 | 3300013307 | Bacteria | 2594 |
| 108 | Ga0157372_10161785 | 3300013307 | Bacteria | 2587 |
| 109 | Ga0157375_10576387 | 3300013308 | Bacteria | 1286 |
| 110 | Ga0163163_10160768 | 3300014325 | Bacteria | 2291 |
| 111 | Ga0157377_10005230 | 3300014745 | Bacteria | 6076 |
| 112 | Ga0157377_10054214 | 3300014745 | Bacteria | 2269 |
| 113 | Ga0157379_10049331 | 3300014968 | Bacteria | 3758 |
| 114 | Ga0157376_10049939 | 3300014969 | Bacteria | 3468 |
| 115 | Ga0157376_10316732 | 3300014969 | Bacteria | 1482 |
| 116 | Ga0206356_11870205 | 3300020070 | Bacteria | 2489 |
| 117 | Ga0206354_10109562 | 3300020081 | Bacteria | 3494 |
| 118 | Ga0206353_10123281 | 3300020082 | Bacteria | 5671 |
| 119 | Ga0213875_10001053 | 3300021388 | Bacteria | 19406 |
| 120 | Ga0209051_1003334 | 3300025303 | Bacteria | 10614 |
| 121 | Ga0207656_10006016 | 3300025321 | Bacteria | 4338 |
| 122 | Ga0207710_10007632 | 3300025900 | Bacteria | 4576 |
| 123 | Ga0207688_10002927 | 3300025901 | Bacteria | 9280 |
| 124 | Ga0207647_10004918 | 3300025904 | Bacteria | 9854 |
| 125 | Ga0207647_10108975 | 3300025904 | Bacteria | 1638 |
| 126 | Ga0207647_10115699 | 3300025904 | Bacteria | 1583 |
| 127 | Ga0207699_10007023 | 3300025906 | Bacteria | 5485 |
| 128 | Ga0207645_10020923 | 3300025907 | Bacteria | 4274 |
| 129 | Ga0207643_10000816 | 3300025908 | Bacteria | 18940 |
| 130 | Ga0207705_10012126 | 3300025909 | Bacteria | 6230 |
| 131 | Ga0207705_10044155 | 3300025909 | Bacteria | 3203 |
| 132 | Ga0207705_10053893 | 3300025909 | Bacteria | 2898 |
| 133 | Ga0207684_10001109 | 3300025910 | Bacteria | 30110 |
| 134 | Ga0207684_10080375 | 3300025910 | Bacteria | 2773 |
| 135 | Ga0207684_10228198 | 3300025910 | Bacteria | 1607 |
| 136 | Ga0207654_10005779 | 3300025911 | Bacteria | 6246 |
| 137 | Ga0207707_10361353 | 3300025912 | Bacteria | 1250 |
| 138 | Ga0207695_10001306 | 3300025913 | Bacteria | 42341 |
| 139 | Ga0207695_10033487 | 3300025913 | Bacteria | 5602 |
| 140 | Ga0207695_10381716 | 3300025913 | Bacteria | 1295 |
| 141 | Ga0207671_10000970 | 3300025914 | Bacteria | 35528 |
| 142 | Ga0207671_10070622 | 3300025914 | Bacteria | 2604 |
| 143 | Ga0207693_10220136 | 3300025915 | Bacteria | 1491 |
| 144 | Ga0207660_10009296 | 3300025917 | Bacteria | 6364 |
| 145 | Ga0207657_10008273 | 3300025919 | Bacteria | 10588 |
| 146 | Ga0207649_10008895 | 3300025920 | Bacteria | 5484 |
| 147 | Ga0207652_10014129 | 3300025921 | Bacteria | 6464 |
| 148 | Ga0207652_10029837 | 3300025921 | Bacteria | 4564 |
| 149 | Ga0207652_10037427 | 3300025921 | Bacteria | 4107 |
| 150 | Ga0207646_10012214 | 3300025922 | Bacteria | 8263 |
| 151 | Ga0207694_10002442 | 3300025924 | Bacteria | 15147 |
| 152 | Ga0207694_10011791 | 3300025924 | Bacteria | 6594 |
| 153 | Ga0207650_10009680 | 3300025925 | Bacteria | 6588 |
| 154 | Ga0207650_10102015 | 3300025925 | Bacteria | 2210 |
| 155 | Ga0207659_10002300 | 3300025926 | Bacteria | 11379 |
| 156 | Ga0207687_10032208 | 3300025927 | Bacteria | 3549 |
| 157 | Ga0207700_10005422 | 3300025928 | Bacteria | 7630 |
| 158 | Ga0207664_10001906 | 3300025929 | Bacteria | 13698 |
| 159 | Ga0207691_10445591 | 3300025940 | Bacteria | 1102 |
| 160 | Ga0207711_10038327 | 3300025941 | Bacteria | 4075 |
| 161 | Ga0207689_10084403 | 3300025942 | Bacteria | 2611 |
| 162 | Ga0207689_10165965 | 3300025942 | Bacteria | 1819 |
| 163 | Ga0207661_10050437 | 3300025944 | Bacteria | 3316 |
| 164 | Ga0207679_10013112 | 3300025945 | Bacteria | 5427 |
| 165 | Ga0207667_10033476 | 3300025949 | Bacteria | 5524 |
| 166 | Ga0207651_10029045 | 3300025960 | Bacteria | 3498 |
| 167 | Ga0207712_10157360 | 3300025961 | Bacteria | 1761 |
| 168 | Ga0207668_10034546 | 3300025972 | Bacteria | 3359 |
| 169 | Ga0207640_10004331 | 3300025981 | Bacteria | 7688 |
| 170 | Ga0207640_10014924 | 3300025981 | Bacteria | 4484 |
| 171 | Ga0207658_10222712 | 3300025986 | Bacteria | 1588 |
| 172 | Ga0207677_10003273 | 3300026023 | Bacteria | 8556 |
| 173 | Ga0207703_10066964 | 3300026035 | Bacteria | 2955 |
| 174 | Ga0207639_10162472 | 3300026041 | Bacteria | 1883 |
| 175 | Ga0207639_10199795 | 3300026041 | Bacteria | 1714 |
| 176 | Ga0207678_10003464 | 3300026067 | Bacteria | 14200 |
| 177 | Ga0207708_10074529 | 3300026075 | Bacteria | 2601 |
| 178 | Ga0207702_10002143 | 3300026078 | Bacteria | 18963 |
| 179 | Ga0207702_10009643 | 3300026078 | Bacteria | 8106 |
| 180 | Ga0207702_10038741 | 3300026078 | Bacteria | 3992 |
| 181 | Ga0207702_10203205 | 3300026078 | Bacteria | 1838 |
| 182 | Ga0207641_10015123 | 3300026088 | Bacteria | 6323 |
| 183 | Ga0207641_10131180 | 3300026088 | Bacteria | 2251 |
| 184 | Ga0207676_10002108 | 3300026095 | Bacteria | 14407 |
| 185 | Ga0207674_10118586 | 3300026116 | Bacteria | 2616 |
| 186 | Ga0207674_10239981 | 3300026116 | Bacteria | 1759 |
| 187 | Ga0207675_100026066 | 3300026118 | Bacteria | 5441 |
| 188 | Ga0207683_10000446 | 3300026121 | Bacteria | 38241 |
| 189 | Ga0207698_10039974 | 3300026142 | Bacteria | 3479 |
| 190 | Ga0207698_10060692 | 3300026142 | Bacteria | 2942 |
| 191 | Ga0207428_10002274 | 3300027907 | Bacteria | 19270 |
| 192 | Ga0307517_10134587 | 3300028786 | Bacteria | 1763 |
| 193 | Ga0265338_10040707 | 3300028800 | Bacteria | 4359 |
| 194 | Ga0265338_10069257 | 3300028800 | Bacteria | 3032 |
| 195 | Ga0265338_10116454 | 3300028800 | Bacteria | 2141 |
| 196 | Ga0307511_10073983 | 3300030521 | Bacteria | 2459 |
| 197 | Ga0265325_10007012 | 3300031241 | Bacteria | 6791 |
| 198 | Ga0265340_10015011 | 3300031247 | Bacteria | 4034 |
| 199 | Ga0265339_10060075 | 3300031249 | Bacteria | 2049 |
| 200 | Ga0265339_10097861 | 3300031249 | Bacteria | 1530 |
| 201 | Ga0265316_10103139 | 3300031344 | Bacteria | 2166 |
| 202 | Ga0307509_10014108 | 3300031507 | Bacteria | 9423 |
| 203 | Ga0307509_10041583 | 3300031507 | Bacteria | 4987 |
| 204 | Ga0307508_10007971 | 3300031616 | Bacteria | 9823 |
| 205 | Ga0307508_10085136 | 3300031616 | Bacteria | 2744 |
| 206 | Ga0265314_10030389 | 3300031711 | Bacteria | 3999 |
| 207 | Ga0265314_10063301 | 3300031711 | Bacteria | 2510 |
| 208 | Ga0265342_10026997 | 3300031712 | Bacteria | 3594 |
| 209 | Ga0307518_10105562 | 3300031838 | Bacteria | 2012 |
| 210 | Ga0373934_0044563 | 3300035086 | Bacteria | 1753 |
| 211 | Ga0373923_0042348 | 3300035111 | Bacteria | 1880 |
| 212 | Ga0373953_0000423 | 3300035117 | Bacteria | 11519 |
| 213 | Ga0373956_0067234 | 3300035119 | Bacteria | 1631 |
| 214 | Ga0373957_0002041 | 3300035120 | Bacteria | 5655 |
| 215 | Ga0373955_0003724 | 3300035172 | Bacteria | 6713 |
| 216 | Ga0373924_0016378 | 3300035410 | Bacteria | 2828 |
| 217 | Ga0373933_0035432 | 3300035724 | Bacteria | 2914 |
| 218 | Ga0373937_0114760 | 3300036401 | Bacteria | 2507 |
| 219 | Ga0395899_0060226 | 3300037312 | Bacteria | 2797 |
| 220 | Ga0395900_0041472 | 3300037418 | Bacteria | 4745 |
| 221 | Ga0436364_0331782 | 3300037853 | Bacteria | 57289 |
| 222 | Ga0436364_1548394 | 3300037853 | Bacteria | 98245 |
| 223 | Ga0395901_0428298 | 3300038443 | Bacteria | 1356 |
| 224 | Ga0439448_0011385 | 3300042005 | Bacteria | 2651 |
| 225 | Ga0439459_0006988 | 3300042438 | Bacteria | 1895 |
| 226 | Ga0466969_0013417 | 3300044656 | Bacteria | 4314 |
| 227 | Ga0466969_0052240 | 3300044656 | Bacteria | 2008 |
| 228 | Ga0466966_0005133 | 3300044684 | Bacteria | 8603 |
| 229 | Ga0466966_0009028 | 3300044684 | Bacteria | 6606 |
| 230 | Ga0466966_0025230 | 3300044684 | Bacteria | 3884 |
| 231 | Ga0466961_0003109 | 3300044693 | Bacteria | 10334 |
| 232 | Ga0466961_0144732 | 3300044693 | Bacteria | 1487 |
| 233 | Ga0466961_0181048 | 3300044693 | Bacteria | 1308 |
| 234 | Ga0466963_0043138 | 3300044694 | Bacteria | 2964 |
| 235 | Ga0466963_0046944 | 3300044694 | Bacteria | 2849 |
| 236 | Ga0466971_0000661 | 3300044719 | Bacteria | 13719 |
| 237 | Ga0466957_0034387 | 3300044842 | Bacteria | 3041 |
| 238 | Ga0466957_0282070 | 3300044842 | Bacteria | 1112 |
| 239 | Ga0466959_0001596 | 3300045049 | Bacteria | 13982 |
| 240 | Ga0466959_0003066 | 3300045049 | Bacteria | 10818 |
| 241 | Ga0466958_0023558 | 3300045836 | Bacteria | 3615 |
| 242 | Ga0466958_0026875 | 3300045836 | Bacteria | 3402 |
| 243 | Ga0466958_0029794 | 3300045836 | Bacteria | 3239 |
| 244 | Ga0466958_0074543 | 3300045836 | Bacteria | 2080 |
| 245 | Ga0466967_0000744 | 3300045976 | Bacteria | 16732 |
| 246 | Ga0466967_0000876 | 3300045976 | Bacteria | 16017 |
| 247 | Ga0466967_0006476 | 3300045976 | Bacteria | 8294 |
| 248 | Ga0466967_0051836 | 3300045976 | Bacteria | 3599 |
| 249 | Ga0466967_0060211 | 3300045976 | Bacteria | 3364 |
| 250 | Ga0466967_0192661 | 3300045976 | Bacteria | 1927 |
| 251 | Ga0466967_0412019 | 3300045976 | Bacteria | 1316 |
| 252 | Ga0495592_0014493 | 3300046454 | Bacteria | 5983 |
| 253 | Ga0495592_0099896 | 3300046454 | Bacteria | 2069 |
| 254 | Ga0495603_0011267 | 3300046455 | Bacteria | 5418 |
| 255 | Ga0495629_0030302 | 3300046459 | Bacteria | 3837 |
| 256 | Ga0495629_0111097 | 3300046459 | Bacteria | 1911 |
| 257 | Ga0495651_0001059 | 3300046462 | Bacteria | 21248 |
| 258 | Ga0495651_0004623 | 3300046462 | Bacteria | 10524 |
| 259 | Ga0495651_0019145 | 3300046462 | Bacteria | 5304 |
| 260 | Ga0495651_0139168 | 3300046462 | Bacteria | 1762 |
| 261 | Ga0495653_0006860 | 3300046463 | Bacteria | 9355 |
| 262 | Ga0495653_0014002 | 3300046463 | Bacteria | 6540 |
| 263 | Ga0495653_0014006 | 3300046463 | Bacteria | 6539 |
| 264 | Ga0495580_0032221 | 3300046472 | Bacteria | 3784 |
| 265 | Ga0495662_0011070 | 3300046476 | Bacteria | 4409 |
| 266 | Ga0495664_0005036 | 3300046477 | Bacteria | 7236 |
| 267 | Ga0495664_0031484 | 3300046477 | Bacteria | 3110 |
| 268 | Ga0495585_0017747 | 3300046492 | Bacteria | 4109 |
| 269 | Ga0495607_0084482 | 3300046501 | Bacteria | 1736 |
| 270 | Ga0495606_0073176 | 3300046507 | Bacteria | 2151 |
| 271 | Ga0495608_0001470 | 3300046511 | Bacteria | 16742 |
| 272 | Ga0495608_0009048 | 3300046511 | Bacteria | 6967 |
| 273 | Ga0495618_0015074 | 3300046514 | Bacteria | 4715 |
| 274 | Ga0495618_0075744 | 3300046514 | Bacteria | 2143 |
| 275 | Ga0495628_0003366 | 3300046516 | Bacteria | 14295 |
| 276 | Ga0495628_0017230 | 3300046516 | Bacteria | 6015 |
| 277 | Ga0495628_0116150 | 3300046516 | Bacteria | 2055 |
| 278 | Ga0495630_0053026 | 3300046517 | Bacteria | 3036 |
| 279 | Ga0495630_0104020 | 3300046517 | Bacteria | 2148 |
| 280 | Ga0495666_0044036 | 3300046526 | Bacteria | 2155 |
| 281 | Ga0495652_0001619 | 3300046529 | Bacteria | 24580 |
| 282 | Ga0495652_0008945 | 3300046529 | Bacteria | 9113 |
| 283 | Ga0495652_0019661 | 3300046529 | Bacteria | 6012 |
| 284 | Ga0495665_0046631 | 3300046531 | Bacteria | 2300 |
| 285 | Ga0495640_0016404 | 3300046533 | Bacteria | 5541 |
| 286 | Ga0495640_0037028 | 3300046533 | Bacteria | 3444 |
| 287 | Ga0495587_0012800 | 3300046536 | Bacteria | 5277 |
| 288 | Ga0495645_0000732 | 3300046543 | Bacteria | 22436 |
| 289 | Ga0495645_0012475 | 3300046543 | Bacteria | 5988 |
| 290 | Ga0495645_0053534 | 3300046543 | Bacteria | 2933 |
| 291 | Ga0495667_0010525 | 3300046559 | Bacteria | 6258 |
| 292 | Ga0495667_0081740 | 3300046559 | Bacteria | 2099 |
| 293 | Ga0495634_0024330 | 3300046642 | Bacteria | 4249 |
| 294 | Ga0495634_0130089 | 3300046642 | Bacteria | 1605 |
| 295 | Ga0495625_0120572 | 3300046660 | Bacteria | 1785 |
| 296 | Ga0495635_0001464 | 3300046663 | Bacteria | 15788 |
| 297 | Ga0495635_0001507 | 3300046663 | Bacteria | 15611 |
| 298 | Ga0495657_0009048 | 3300046675 | Bacteria | 7572 |
| 299 | Ga0495657_0012817 | 3300046675 | Bacteria | 6214 |
| 300 | Ga0495657_0063380 | 3300046675 | Bacteria | 2439 |
| 301 | Ga0495599_0009154 | 3300046678 | Bacteria | 6040 |
| 302 | Ga0495599_0055513 | 3300046678 | Bacteria | 2480 |
| 303 | Ga0495623_0108829 | 3300046679 | Bacteria | 1681 |
| 304 | Ga0495646_0010666 | 3300046680 | Bacteria | 5837 |
| 305 | Ga0495646_0029750 | 3300046680 | Bacteria | 3412 |
| 306 | Ga0495613_0047893 | 3300046689 | Bacteria | 3157 |
| 307 | Ga0495670_0091856 | 3300046691 | Bacteria | 1554 |
| 308 | Ga0495589_0017900 | 3300046794 | Bacteria | 3634 |
| 309 | Ga0495600_0008011 | 3300046809 | Bacteria | 6476 |
| 310 | Ga0495600_0017105 | 3300046809 | Bacteria | 4610 |
| 311 | Ga0495600_0034124 | 3300046809 | Bacteria | 3303 |
| 312 | Ga0495600_0111677 | 3300046809 | Bacteria | 1779 |
| 313 | Ga0495581_0020225 | 3300047315 | Bacteria | 3864 |
| 314 | Ga0495604_0001000 | 3300047317 | Bacteria | 23520 |
| 315 | Ga0495604_0034631 | 3300047317 | Bacteria | 3994 |
| 316 | Ga0495604_0061992 | 3300047317 | Bacteria | 2859 |
| 317 | Ga0495674_0016193 | 3300047319 | Bacteria | 6955 |
| 318 | Ga0495674_0158246 | 3300047319 | Bacteria | 1896 |
| 319 | Ga0495680_0125340 | 3300047322 | Bacteria | 1892 |
| 320 | Ga0495683_0041916 | 3300047323 | Bacteria | 2309 |
| 321 | Ga0495675_0071796 | 3300047444 | Bacteria | 2184 |
| 322 | Ga0495684_0010544 | 3300047471 | Bacteria | 7143 |
| 323 | Ga0495684_0130901 | 3300047471 | Bacteria | 1884 |
| 324 | Ga0495686_0024203 | 3300047472 | Bacteria | 3993 |
| 325 | Ga0495602_0076764 | 3300048088 | Bacteria | 2829 |
| 326 | Ga0496100_0006848 | 3300048903 | Bacteria | 6244 |
| 327 | Ga0496102_0000319 | 3300048905 | Bacteria | 60314 |
| 328 | Ga0496102_0015079 | 3300048905 | Bacteria | 6728 |
| 329 | Ga0496103_0038447 | 3300048906 | Bacteria | 2936 |
| 330 | Ga0496104_0007131 | 3300048907 | Bacteria | 9853 |
| 331 | Ga0496105_0002982 | 3300048908 | Bacteria | 12442 |
| 332 | Ga0496105_0035268 | 3300048908 | Bacteria | 4117 |
| 333 | Ga0496106_0013020 | 3300048909 | Bacteria | 6137 |
| 334 | Ga0496108_0004925 | 3300048911 | Bacteria | 10785 |
| 335 | Ga0496108_0013116 | 3300048911 | Bacteria | 6756 |
| 336 | Ga0496108_0039190 | 3300048911 | Bacteria | 3950 |
| 337 | Ga0496109_0010642 | 3300048912 | Bacteria | 7867 |
| 338 | Ga0496109_0016368 | 3300048912 | Bacteria | 6482 |
| 339 | Ga0496109_0092376 | 3300048912 | Bacteria | 2799 |
| 340 | Ga0496110_0003418 | 3300048913 | Bacteria | 12144 |
| 341 | Ga0496111_0000654 | 3300048914 | Bacteria | 18257 |
| 342 | Ga0496112_0111419 | 3300048915 | Bacteria | 2706 |
| 343 | Ga0496112_0153944 | 3300048915 | Bacteria | 2266 |
| 344 | Ga0496112_0304659 | 3300048915 | Bacteria | 1538 |
| 345 | Ga0496113_0002535 | 3300048916 | Bacteria | 10647 |
| 346 | Ga0496113_0004740 | 3300048916 | Bacteria | 8395 |
| 347 | Ga0496113_0085305 | 3300048916 | Bacteria | 2426 |
| 348 | Ga0496119_0050878 | 3300048922 | Bacteria | 2550 |
| 349 | Ga0501042_0048789 | 3300049578 | Bacteria | 3019 |
| 350 | Ga0501069_0006545 | 3300049585 | Bacteria | 6093 |
| 351 | Ga0501070_0003626 | 3300049586 | Bacteria | 13335 |
| 352 | Ga0501073_0315223 | 3300049589 | Bacteria | 1079 |
| 353 | Ga0501080_0046707 | 3300049742 | Bacteria | 4031 |
| 354 | Ga0501044_0068861 | 3300049823 | Bacteria | 3604 |
| 355 | nmdc:mga08y16_65083_c1 | 3300050511 | Bacteria | 3806 |
| 356 | nmdc:mga0n895_12207_c1 | 3300050512 | Bacteria | 7697 |
| 357 | nmdc:mga0rr50_1297_c1 | 3300050513 | Bacteria | 13631 |
| 358 | nmdc:mga08x19_3218_c1 | 3300050514 | Bacteria | 9792 |
| 359 | nmdc:mga0a205_15078_c1 | 3300050515 | Bacteria | 7217 |
| 360 | Ga0495601_0001254 | 3300053077 | Bacteria | 13909 |
| 361 | Ga0495601_0010450 | 3300053077 | Bacteria | 5524 |
| 362 | Ga0495601_0034254 | 3300053077 | Bacteria | 3167 |
| 363 | Ga0495612_0001755 | 3300053078 | Bacteria | 8884 |
| 364 | Ga0495612_0003851 | 3300053078 | Bacteria | 6228 |
| 365 | Ga0495595_0064554 | 3300053084 | Bacteria | 1721 |
| 366 | Ga0495619_0165333 | 3300053085 | Bacteria | 1529 |
| 367 | Ga0500559_0025346 | 3300053136 | Bacteria | 2523 |
| 368 | Ga0466962_0001104 | 3300061719 | Bacteria | 12420 |
| 369 | Ga0466962_0039043 | 3300061719 | Bacteria | 2274 |
| 370 | Ga0466962_0065500 | 3300061719 | Bacteria | 1735 |
| 371 | Ga0466962_0106427 | 3300061719 | Bacteria | 1349 |
| 372 | Ga0466962_0156854 | 3300061719 | Bacteria | 1106 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046463 | Ga0495653_0014002 | Ga0495653_0014002_3288_4262 | 245 |
| 2 | 3300013307 | Ga0157372_10161785 | Ga0157372_101617852 | 246 |
| 3 | 3300046459 | Ga0495629_0111097 | Ga0495629_0111097_331_1194 | 247 |
| 4 | 3300053136 | Ga0500559_0025346 | Ga0500559_0025346_722_1666 | 251 |
| 5 | 3300005327 | Ga0070658_10037938 | Ga0070658_100379382 | 253 |
| 6 | 3300005563 | Ga0068855_100002594 | Ga0068855_10000259411 | 253 |
| 7 | 3300025909 | Ga0207705_10044155 | Ga0207705_100441553 | 253 |
| 8 | 3300025949 | Ga0207667_10033476 | Ga0207667_100334765 | 253 |
| 9 | 3300028800 | Ga0265338_10040707 | Ga0265338_100407073 | 256 |
| 10 | 3300031241 | Ga0265325_10007012 | Ga0265325_100070126 | 256 |
| 11 | 3300031249 | Ga0265339_10097861 | Ga0265339_100978612 | 256 |
| 12 | 3300031711 | Ga0265314_10030389 | Ga0265314_100303892 | 256 |
| 13 | 3300031712 | Ga0265342_10026997 | Ga0265342_100269973 | 256 |
| 14 | 3300049589 | Ga0501073_0315223 | Ga0501073_0315223_228_1067 | 258 |
| 15 | 3300026078 | Ga0207702_10038741 | Ga0207702_100387414 | 260 |
| 16 | 3300046462 | Ga0495651_0004623 | Ga0495651_0004623_1316_2176 | 260 |
| 17 | 3300046463 | Ga0495653_0014006 | Ga0495653_0014006_4544_5404 | 260 |
| 18 | 3300046472 | Ga0495580_0032221 | Ga0495580_0032221_1526_2386 | 260 |
| 19 | 3300046476 | Ga0495662_0011070 | Ga0495662_0011070_489_1349 | 260 |
| 20 | 3300046477 | Ga0495664_0005036 | Ga0495664_0005036_3273_4133 | 260 |
| 21 | 3300046511 | Ga0495608_0001470 | Ga0495608_0001470_3031_3891 | 260 |
| 22 | 3300046516 | Ga0495628_0017230 | Ga0495628_0017230_4227_5087 | 260 |
| 23 | 3300046517 | Ga0495630_0104020 | Ga0495630_0104020_658_1518 | 260 |
| 24 | 3300046526 | Ga0495666_0044036 | Ga0495666_0044036_922_1782 | 260 |
| 25 | 3300046529 | Ga0495652_0019661 | Ga0495652_0019661_489_1349 | 260 |
| 26 | 3300046531 | Ga0495665_0046631 | Ga0495665_0046631_623_1483 | 260 |
| 27 | 3300046533 | Ga0495640_0016404 | Ga0495640_0016404_1136_1996 | 260 |
| 28 | 3300046543 | Ga0495645_0000732 | Ga0495645_0000732_7912_8772 | 260 |
| 29 | 3300046559 | Ga0495667_0010525 | Ga0495667_0010525_2323_3183 | 260 |
| 30 | 3300046642 | Ga0495634_0130089 | Ga0495634_0130089_88_948 | 260 |
| 31 | 3300046675 | Ga0495657_0012817 | Ga0495657_0012817_2323_3183 | 260 |
| 32 | 3300046678 | Ga0495599_0009154 | Ga0495599_0009154_2105_2965 | 260 |
| 33 | 3300046679 | Ga0495623_0108829 | Ga0495623_0108829_786_1646 | 260 |
| 34 | 3300046680 | Ga0495646_0029750 | Ga0495646_0029750_2465_3325 | 260 |
| 35 | 3300046809 | Ga0495600_0111677 | Ga0495600_0111677_88_948 | 260 |
| 36 | 3300047315 | Ga0495581_0020225 | Ga0495581_0020225_1877_2737 | 260 |
| 37 | 3300047317 | Ga0495604_0001000 | Ga0495604_0001000_19803_20663 | 260 |
| 38 | 3300047319 | Ga0495674_0016193 | Ga0495674_0016193_3031_3891 | 260 |
| 39 | 3300047471 | Ga0495684_0130901 | Ga0495684_0130901_658_1518 | 260 |
| 40 | 3300053077 | Ga0495601_0010450 | Ga0495601_0010450_1973_2833 | 260 |
| 41 | 3300005435 | Ga0070714_100007089 | Ga0070714_1000070893 | 263 |
| 42 | 3300006028 | Ga0070717_10053784 | Ga0070717_100537842 | 263 |
| 43 | 3300025904 | Ga0207647_10115699 | Ga0207647_101156991 | 263 |
| 44 | 3300025929 | Ga0207664_10001906 | Ga0207664_100019063 | 263 |
| 45 | 3300005563 | Ga0068855_100134281 | Ga0068855_1001342813 | 264 |
| 46 | 3300009093 | Ga0105240_10091504 | Ga0105240_100915043 | 264 |
| 47 | 3300025942 | Ga0207689_10165965 | Ga0207689_101659652 | 264 |
| 48 | 3300044684 | Ga0466966_0025230 | Ga0466966_0025230_1913_2830 | 265 |
| 49 | 3300045049 | Ga0466959_0003066 | Ga0466959_0003066_4883_5800 | 265 |
| 50 | 3300045836 | Ga0466958_0029794 | Ga0466958_0029794_659_1576 | 265 |
| 51 | 3300053078 | Ga0495612_0001755 | Ga0495612_0001755_6925_7911 | 266 |
| 52 | 3300005467 | Ga0070706_100000400 | Ga0070706_10000040041 | 269 |
| 53 | 3300005471 | Ga0070698_100103518 | Ga0070698_1001035182 | 269 |
| 54 | 3300025910 | Ga0207684_10001109 | Ga0207684_1000110910 | 269 |
| 55 | 3300037853 | Ga0436364_0331782 | Ga0436364_0331782_47287_48219 | 269 |
| 56 | 3300049742 | Ga0501080_0046707 | Ga0501080_0046707_46_918 | 269 |
| 57 | 3300049823 | Ga0501044_0068861 | Ga0501044_0068861_392_1225 | 269 |
| 58 | 3300031838 | Ga0307518_10105562 | Ga0307518_101055622 | 270 |
| 59 | 3300045976 | Ga0466967_0006476 | Ga0466967_0006476_1155_2003 | 272 |
| 60 | 3300048909 | Ga0496106_0013020 | Ga0496106_0013020_11_868 | 272 |
| 61 | 3300048915 | Ga0496112_0111419 | Ga0496112_0111419_1839_2696 | 272 |
| 62 | 3300025925 | Ga0207650_10102015 | Ga0207650_101020151 | 273 |
| 63 | 3300049585 | Ga0501069_0006545 | Ga0501069_0006545_1093_2037 | 274 |
| 64 | 3300049586 | Ga0501070_0003626 | Ga0501070_0003626_9445_10389 | 274 |
| 65 | 3300021388 | Ga0213875_10001053 | Ga0213875_100010538 | 275 |
| 66 | 3300028786 | Ga0307517_10134587 | Ga0307517_101345872 | 275 |
| 67 | 3300031507 | Ga0307509_10014108 | Ga0307509_100141088 | 277 |
| 68 | 3300044693 | Ga0466961_0144732 | Ga0466961_0144732_480_1418 | 277 |
| 69 | 3300044694 | Ga0466963_0043138 | Ga0466963_0043138_862_1794 | 278 |
| 70 | 3300044842 | Ga0466957_0034387 | Ga0466957_0034387_1102_2034 | 278 |
| 71 | 3300045836 | Ga0466958_0026875 | Ga0466958_0026875_1473_2405 | 278 |
| 72 | 3300061719 | Ga0466962_0039043 | Ga0466962_0039043_165_1097 | 278 |
| 73 | 3300005458 | Ga0070681_10437439 | Ga0070681_104374391 | 279 |
| 74 | 3300005467 | Ga0070706_100122025 | Ga0070706_1001220253 | 279 |
| 75 | 3300005468 | Ga0070707_100024348 | Ga0070707_1000243484 | 279 |
| 76 | 3300005618 | Ga0068864_100043428 | Ga0068864_1000434283 | 279 |
| 77 | 3300005841 | Ga0068863_100176671 | Ga0068863_1001766712 | 279 |
| 78 | 3300005842 | Ga0068858_100594090 | Ga0068858_1005940902 | 279 |
| 79 | 3300009177 | Ga0105248_10119344 | Ga0105248_101193443 | 279 |
| 80 | 3300014325 | Ga0163163_10160768 | Ga0163163_101607682 | 279 |
| 81 | 3300025912 | Ga0207707_10361353 | Ga0207707_103613532 | 279 |
| 82 | 3300025922 | Ga0207646_10012214 | Ga0207646_100122145 | 279 |
| 83 | 3300025941 | Ga0207711_10038327 | Ga0207711_100383272 | 279 |
| 84 | 3300025944 | Ga0207661_10050437 | Ga0207661_100504372 | 279 |
| 85 | 3300026078 | Ga0207702_10203205 | Ga0207702_102032052 | 279 |
| 86 | 3300048907 | Ga0496104_0007131 | Ga0496104_0007131_7406_8320 | 279 |
| 87 | 3300048908 | Ga0496105_0035268 | Ga0496105_0035268_631_1545 | 279 |
| 88 | 3300048911 | Ga0496108_0013116 | Ga0496108_0013116_4838_5752 | 279 |
| 89 | 3300048912 | Ga0496109_0092376 | Ga0496109_0092376_58_972 | 279 |
| 90 | 3300048915 | Ga0496112_0304659 | Ga0496112_0304659_566_1480 | 279 |
| 91 | 3300048916 | Ga0496113_0004740 | Ga0496113_0004740_7012_7926 | 279 |
| 92 | 3300048905 | Ga0496102_0000319 | Ga0496102_0000319_55539_56477 | 280 |
| 93 | 3300048906 | Ga0496103_0038447 | Ga0496103_0038447_1493_2431 | 280 |
| 94 | 3300030521 | Ga0307511_10073983 | Ga0307511_100739832 | 281 |
| 95 | 3300031507 | Ga0307509_10041583 | Ga0307509_100415835 | 281 |
| 96 | 3300031616 | Ga0307508_10007971 | Ga0307508_100079716 | 281 |
| 97 | 3300044656 | Ga0466969_0013417 | Ga0466969_0013417_428_1348 | 281 |
| 98 | 3300044684 | Ga0466966_0005133 | Ga0466966_0005133_6645_7565 | 281 |
| 99 | 3300044693 | Ga0466961_0003109 | Ga0466961_0003109_6638_7558 | 281 |
| 100 | 3300044719 | Ga0466971_0000661 | Ga0466971_0000661_3737_4657 | 281 |
| 101 | 3300045049 | Ga0466959_0001596 | Ga0466959_0001596_7615_8535 | 281 |
| 102 | 3300045836 | Ga0466958_0023558 | Ga0466958_0023558_1858_2778 | 281 |
| 103 | 3300046454 | Ga0495592_0014493 | Ga0495592_0014493_257_1174 | 281 |
| 104 | 3300046462 | Ga0495651_0019145 | Ga0495651_0019145_762_1679 | 281 |
| 105 | 3300046477 | Ga0495664_0031484 | Ga0495664_0031484_234_1151 | 281 |
| 106 | 3300046514 | Ga0495618_0015074 | Ga0495618_0015074_879_1886 | 281 |
| 107 | 3300046529 | Ga0495652_0008945 | Ga0495652_0008945_3407_4324 | 281 |
| 108 | 3300046543 | Ga0495645_0053534 | Ga0495645_0053534_931_1848 | 281 |
| 109 | 3300046663 | Ga0495635_0001507 | Ga0495635_0001507_4361_5281 | 281 |
| 110 | 3300046680 | Ga0495646_0010666 | Ga0495646_0010666_2291_3208 | 281 |
| 111 | 3300046809 | Ga0495600_0034124 | Ga0495600_0034124_1763_2683 | 281 |
| 112 | 3300053077 | Ga0495601_0001254 | Ga0495601_0001254_742_1659 | 281 |
| 113 | 3300053078 | Ga0495612_0003851 | Ga0495612_0003851_3058_3978 | 281 |
| 114 | 3300061719 | Ga0466962_0001104 | Ga0466962_0001104_1820_2740 | 281 |
| 115 | 3300003320 | rootH2_10024901 | rootH2_100249012 | 282 |
| 116 | 3300005327 | Ga0070658_10002248 | Ga0070658_100022486 | 282 |
| 117 | 3300013308 | Ga0157375_10576387 | Ga0157375_105763872 | 282 |
| 118 | 3300025909 | Ga0207705_10053893 | Ga0207705_100538932 | 282 |
| 119 | 3300025940 | Ga0207691_10445591 | Ga0207691_104455911 | 282 |
| 120 | 3300009093 | Ga0105240_10010252 | Ga0105240_100102526 | 283 |
| 121 | 3300044656 | Ga0466969_0052240 | Ga0466969_0052240_300_1226 | 283 |
| 122 | 3300044684 | Ga0466966_0009028 | Ga0466966_0009028_2250_3191 | 283 |
| 123 | 3300053077 | Ga0495601_0034254 | Ga0495601_0034254_2175_3089 | 283 |
| 124 | 3300001979 | JGI24740J21852_10013421 | JGI24740J21852_100134212 | 284 |
| 125 | 3300001989 | JGI24739J22299_10000936 | JGI24739J22299_1000093611 | 284 |
| 126 | 3300005347 | Ga0070668_100162654 | Ga0070668_1001626542 | 284 |
| 127 | 3300005367 | Ga0070667_100128205 | Ga0070667_1001282052 | 284 |
| 128 | 3300005434 | Ga0070709_10185763 | Ga0070709_101857632 | 284 |
| 129 | 3300005467 | Ga0070706_100292530 | Ga0070706_1002925302 | 284 |
| 130 | 3300005518 | Ga0070699_100267580 | Ga0070699_1002675802 | 284 |
| 131 | 3300005577 | Ga0068857_100248912 | Ga0068857_1002489122 | 284 |
| 132 | 3300013105 | Ga0157369_10286606 | Ga0157369_102866062 | 284 |
| 133 | 3300013307 | Ga0157372_10060447 | Ga0157372_100604472 | 284 |
| 134 | 3300025910 | Ga0207684_10080375 | Ga0207684_100803752 | 284 |
| 135 | 3300025910 | Ga0207684_10228198 | Ga0207684_102281982 | 284 |
| 136 | 3300025972 | Ga0207668_10034546 | Ga0207668_100345463 | 284 |
| 137 | 3300025986 | Ga0207658_10222712 | Ga0207658_102227122 | 284 |
| 138 | 3300026116 | Ga0207674_10239981 | Ga0207674_102399812 | 284 |
| 139 | 3300044694 | Ga0466963_0046944 | Ga0466963_0046944_852_1775 | 284 |
| 140 | 3300045976 | Ga0466967_0412019 | Ga0466967_0412019_101_1021 | 284 |
| 141 | 3300049578 | Ga0501042_0048789 | Ga0501042_0048789_1019_2008 | 284 |
| 142 | 3300061719 | Ga0466962_0106427 | Ga0466962_0106427_38_961 | 284 |
| 143 | iso_pu_bacteria | 2902792274 | 2902797587 | 284 |
| 144 | 3300005614 | Ga0068856_100013286 | Ga0068856_1000132868 | 285 |
| 145 | 3300026078 | Ga0207702_10009643 | Ga0207702_100096432 | 285 |
| 146 | 3300026088 | Ga0207641_10131180 | Ga0207641_101311802 | 285 |
| 147 | 3300044842 | Ga0466957_0282070 | Ga0466957_0282070_39_965 | 285 |
| 148 | 3300045976 | Ga0466967_0000744 | Ga0466967_0000744_12568_13494 | 285 |
| 149 | 3300046492 | Ga0495585_0017747 | Ga0495585_0017747_2138_3070 | 285 |
| 150 | 3300005549 | Ga0070704_100189156 | Ga0070704_1001891562 | 286 |
| 151 | 3300005617 | Ga0068859_100052159 | Ga0068859_1000521592 | 286 |
| 152 | 3300005937 | Ga0081455_10011020 | Ga0081455_100110208 | 286 |
| 153 | 3300006931 | Ga0097620_100052159 | Ga0097620_1000521592 | 286 |
| 154 | 3300014745 | Ga0157377_10054214 | Ga0157377_100542142 | 286 |
| 155 | 3300014969 | Ga0157376_10049939 | Ga0157376_100499392 | 286 |
| 156 | 3300014969 | Ga0157376_10316732 | Ga0157376_103167322 | 286 |
| 157 | 3300031247 | Ga0265340_10015011 | Ga0265340_100150113 | 286 |
| 158 | 3300035086 | Ga0373934_0044563 | Ga0373934_0044563_289_1221 | 286 |
| 159 | 3300035111 | Ga0373923_0042348 | Ga0373923_0042348_499_1431 | 286 |
| 160 | 3300035117 | Ga0373953_0000423 | Ga0373953_0000423_895_1827 | 286 |
| 161 | 3300035119 | Ga0373956_0067234 | Ga0373956_0067234_341_1273 | 286 |
| 162 | 3300035120 | Ga0373957_0002041 | Ga0373957_0002041_663_1595 | 286 |
| 163 | 3300035172 | Ga0373955_0003724 | Ga0373955_0003724_5180_6112 | 286 |
| 164 | 3300035410 | Ga0373924_0016378 | Ga0373924_0016378_1050_1982 | 286 |
| 165 | 3300035724 | Ga0373933_0035432 | Ga0373933_0035432_1117_2049 | 286 |
| 166 | 3300036401 | Ga0373937_0114760 | Ga0373937_0114760_1045_1977 | 286 |
| 167 | 3300037853 | Ga0436364_1548394 | Ga0436364_1548394_39923_40909 | 286 |
| 168 | 3300038443 | Ga0395901_0428298 | Ga0395901_0428298_61_996 | 286 |
| 169 | 3300046462 | Ga0495651_0139168 | Ga0495651_0139168_643_1575 | 286 |
| 170 | 3300046463 | Ga0495653_0006860 | Ga0495653_0006860_3354_4286 | 286 |
| 171 | 3300046511 | Ga0495608_0009048 | Ga0495608_0009048_2613_3545 | 286 |
| 172 | 3300046514 | Ga0495618_0075744 | Ga0495618_0075744_696_1628 | 286 |
| 173 | 3300046516 | Ga0495628_0116150 | Ga0495628_0116150_528_1460 | 286 |
| 174 | 3300046517 | Ga0495630_0053026 | Ga0495630_0053026_1655_2587 | 286 |
| 175 | 3300046533 | Ga0495640_0037028 | Ga0495640_0037028_1072_2004 | 286 |
| 176 | 3300046536 | Ga0495587_0012800 | Ga0495587_0012800_4005_4937 | 286 |
| 177 | 3300046559 | Ga0495667_0081740 | Ga0495667_0081740_456_1388 | 286 |
| 178 | 3300046642 | Ga0495634_0024330 | Ga0495634_0024330_881_1813 | 286 |
| 179 | 3300046663 | Ga0495635_0001464 | Ga0495635_0001464_5718_6650 | 286 |
| 180 | 3300046675 | Ga0495657_0009048 | Ga0495657_0009048_1258_2190 | 286 |
| 181 | 3300046678 | Ga0495599_0055513 | Ga0495599_0055513_1021_1953 | 286 |
| 182 | 3300046689 | Ga0495613_0047893 | Ga0495613_0047893_1116_2048 | 286 |
| 183 | 3300046809 | Ga0495600_0008011 | Ga0495600_0008011_1404_2336 | 286 |
| 184 | 3300047317 | Ga0495604_0034631 | Ga0495604_0034631_911_1843 | 286 |
| 185 | 3300047319 | Ga0495674_0158246 | Ga0495674_0158246_546_1478 | 286 |
| 186 | 3300047322 | Ga0495680_0125340 | Ga0495680_0125340_567_1499 | 286 |
| 187 | 3300047444 | Ga0495675_0071796 | Ga0495675_0071796_118_1050 | 286 |
| 188 | 3300047471 | Ga0495684_0010544 | Ga0495684_0010544_1186_2118 | 286 |
| 189 | 3300047472 | Ga0495686_0024203 | Ga0495686_0024203_1599_2537 | 286 |
| 190 | 3300048088 | Ga0495602_0076764 | Ga0495602_0076764_987_1919 | 286 |
| 191 | 3300053084 | Ga0495595_0064554 | Ga0495595_0064554_225_1157 | 286 |
| 192 | 3300053085 | Ga0495619_0165333 | Ga0495619_0165333_157_1089 | 286 |
| 193 | 3300061719 | Ga0466962_0065500 | Ga0466962_0065500_776_1717 | 286 |
| 194 | 3300005530 | Ga0070679_100016122 | Ga0070679_1000161224 | 287 |
| 195 | 3300005530 | Ga0070679_100091820 | Ga0070679_1000918202 | 287 |
| 196 | 3300005563 | Ga0068855_100012152 | Ga0068855_1000121522 | 287 |
| 197 | 3300005616 | Ga0068852_100109928 | Ga0068852_1001099282 | 287 |
| 198 | 3300005937 | Ga0081455_10078961 | Ga0081455_100789612 | 287 |
| 199 | 3300009093 | Ga0105240_10018132 | Ga0105240_100181324 | 287 |
| 200 | 3300013104 | Ga0157370_10006967 | Ga0157370_100069674 | 287 |
| 201 | 3300013105 | Ga0157369_10010186 | Ga0157369_100101866 | 287 |
| 202 | 3300013307 | Ga0157372_10160972 | Ga0157372_101609723 | 287 |
| 203 | 3300025913 | Ga0207695_10033487 | Ga0207695_100334872 | 287 |
| 204 | 3300025921 | Ga0207652_10029837 | Ga0207652_100298373 | 287 |
| 205 | 3300025921 | Ga0207652_10037427 | Ga0207652_100374273 | 287 |
| 206 | 3300026142 | Ga0207698_10060692 | Ga0207698_100606922 | 287 |
| 207 | 3300028800 | Ga0265338_10069257 | Ga0265338_100692573 | 287 |
| 208 | 3300028800 | Ga0265338_10116454 | Ga0265338_101164542 | 287 |
| 209 | 3300031249 | Ga0265339_10060075 | Ga0265339_100600752 | 287 |
| 210 | 3300031344 | Ga0265316_10103139 | Ga0265316_101031392 | 287 |
| 211 | 3300031711 | Ga0265314_10063301 | Ga0265314_100633012 | 287 |
| 212 | 3300037312 | Ga0395899_0060226 | Ga0395899_0060226_566_1510 | 287 |
| 213 | 3300037418 | Ga0395900_0041472 | Ga0395900_0041472_1558_2502 | 287 |
| 214 | 3300045836 | Ga0466958_0074543 | Ga0466958_0074543_126_1067 | 287 |
| 215 | 3300045976 | Ga0466967_0000876 | Ga0466967_0000876_10101_11039 | 287 |
| 216 | 3300045976 | Ga0466967_0060211 | Ga0466967_0060211_73_1029 | 287 |
| 217 | 3300045976 | Ga0466967_0192661 | Ga0466967_0192661_212_1150 | 287 |
| 218 | 3300046455 | Ga0495603_0011267 | Ga0495603_0011267_4306_5229 | 287 |
| 219 | 3300046501 | Ga0495607_0084482 | Ga0495607_0084482_538_1461 | 287 |
| 220 | 3300046660 | Ga0495625_0120572 | Ga0495625_0120572_642_1565 | 287 |
| 221 | 3300046691 | Ga0495670_0091856 | Ga0495670_0091856_551_1474 | 287 |
| 222 | 3300046794 | Ga0495589_0017900 | Ga0495589_0017900_1127_2050 | 287 |
| 223 | 3300047323 | Ga0495683_0041916 | Ga0495683_0041916_690_1613 | 287 |
| 224 | 3300048911 | Ga0496108_0039190 | Ga0496108_0039190_400_1338 | 287 |
| 225 | 3300048912 | Ga0496109_0016368 | Ga0496109_0016368_3270_4208 | 287 |
| 226 | 3300048916 | Ga0496113_0085305 | Ga0496113_0085305_26_964 | 287 |
| 227 | 3300061719 | Ga0466962_0156854 | Ga0466962_0156854_35_976 | 287 |
| 228 | 3300001976 | JGI24752J21851_1002148 | JGI24752J21851_10021482 | 288 |
| 229 | 3300002459 | JGI24751J29686_10001163 | JGI24751J29686_100011632 | 288 |
| 230 | 3300003792 | Ga0055540_1001492 | Ga0055540_10014929 | 288 |
| 231 | 3300005327 | Ga0070658_10042503 | Ga0070658_100425032 | 288 |
| 232 | 3300005334 | Ga0068869_100080091 | Ga0068869_1000800912 | 288 |
| 233 | 3300005336 | Ga0070680_100003841 | Ga0070680_1000038414 | 288 |
| 234 | 3300005338 | Ga0068868_100009852 | Ga0068868_1000098525 | 288 |
| 235 | 3300005339 | Ga0070660_100006399 | Ga0070660_1000063994 | 288 |
| 236 | 3300005341 | Ga0070691_10002949 | Ga0070691_100029493 | 288 |
| 237 | 3300005344 | Ga0070661_100022644 | Ga0070661_1000226443 | 288 |
| 238 | 3300005345 | Ga0070692_10001488 | Ga0070692_100014884 | 288 |
| 239 | 3300005354 | Ga0070675_100013299 | Ga0070675_1000132992 | 288 |
| 240 | 3300005355 | Ga0070671_100103133 | Ga0070671_1001031332 | 288 |
| 241 | 3300005364 | Ga0070673_100008420 | Ga0070673_1000084204 | 288 |
| 242 | 3300005366 | Ga0070659_100005968 | Ga0070659_1000059684 | 288 |
| 243 | 3300005436 | Ga0070713_100004044 | Ga0070713_1000040447 | 288 |
| 244 | 3300005436 | Ga0070713_100125388 | Ga0070713_1001253882 | 288 |
| 245 | 3300005438 | Ga0070701_10095939 | Ga0070701_100959392 | 288 |
| 246 | 3300005439 | Ga0070711_100029896 | Ga0070711_1000298962 | 288 |
| 247 | 3300005455 | Ga0070663_100012554 | Ga0070663_1000125541 | 288 |
| 248 | 3300005457 | Ga0070662_100339384 | Ga0070662_1003393841 | 288 |
| 249 | 3300005530 | Ga0070679_100010266 | Ga0070679_1000102664 | 288 |
| 250 | 3300005539 | Ga0068853_100078072 | Ga0068853_1000780722 | 288 |
| 251 | 3300005539 | Ga0068853_100213900 | Ga0068853_1002139002 | 288 |
| 252 | 3300005544 | Ga0070686_100112790 | Ga0070686_1001127902 | 288 |
| 253 | 3300005547 | Ga0070693_100002658 | Ga0070693_1000026584 | 288 |
| 254 | 3300005548 | Ga0070665_100010846 | Ga0070665_1000108469 | 288 |
| 255 | 3300005563 | Ga0068855_100005004 | Ga0068855_1000050046 | 288 |
| 256 | 3300005563 | Ga0068855_100387891 | Ga0068855_1003878912 | 288 |
| 257 | 3300005578 | Ga0068854_100002542 | Ga0068854_1000025423 | 288 |
| 258 | 3300005578 | Ga0068854_100073178 | Ga0068854_1000731782 | 288 |
| 259 | 3300005614 | Ga0068856_100012979 | Ga0068856_1000129794 | 288 |
| 260 | 3300005616 | Ga0068852_100004937 | Ga0068852_1000049378 | 288 |
| 261 | 3300005618 | Ga0068864_100128638 | Ga0068864_1001286382 | 288 |
| 262 | 3300005719 | Ga0068861_100175835 | Ga0068861_1001758352 | 288 |
| 263 | 3300005834 | Ga0068851_10135338 | Ga0068851_101353382 | 288 |
| 264 | 3300005840 | Ga0068870_10000206 | Ga0068870_1000020611 | 288 |
| 265 | 3300005841 | Ga0068863_100170175 | Ga0068863_1001701752 | 288 |
| 266 | 3300005842 | Ga0068858_100025174 | Ga0068858_1000251744 | 288 |
| 267 | 3300005983 | Ga0081540_1011090 | Ga0081540_10110902 | 288 |
| 268 | 3300006237 | Ga0097621_100007330 | Ga0097621_1000073305 | 288 |
| 269 | 3300006358 | Ga0068871_100008339 | Ga0068871_1000083395 | 288 |
| 270 | 3300006852 | Ga0075433_10006126 | Ga0075433_100061265 | 288 |
| 271 | 3300006871 | Ga0075434_100005408 | Ga0075434_10000540810 | 288 |
| 272 | 3300006914 | Ga0075436_100000490 | Ga0075436_10000049015 | 288 |
| 273 | 3300007076 | Ga0075435_100000491 | Ga0075435_10000049115 | 288 |
| 274 | 3300009093 | Ga0105240_10087504 | Ga0105240_100875042 | 288 |
| 275 | 3300009094 | Ga0111539_10006134 | Ga0111539_100061343 | 288 |
| 276 | 3300009098 | Ga0105245_10010100 | Ga0105245_100101004 | 288 |
| 277 | 3300009101 | Ga0105247_10015340 | Ga0105247_100153404 | 288 |
| 278 | 3300009174 | Ga0105241_10003469 | Ga0105241_100034697 | 288 |
| 279 | 3300009174 | Ga0105241_10006616 | Ga0105241_100066164 | 288 |
| 280 | 3300009545 | Ga0105237_10026178 | Ga0105237_100261782 | 288 |
| 281 | 3300009545 | Ga0105237_10042340 | Ga0105237_100423403 | 288 |
| 282 | 3300009551 | Ga0105238_10002739 | Ga0105238_100027397 | 288 |
| 283 | 3300009551 | Ga0105238_10031540 | Ga0105238_100315402 | 288 |
| 284 | 3300009553 | Ga0105249_10782320 | Ga0105249_107823201 | 288 |
| 285 | 3300010375 | Ga0105239_10040701 | Ga0105239_100407012 | 288 |
| 286 | 3300011119 | Ga0105246_10001215 | Ga0105246_100012158 | 288 |
| 287 | 3300013102 | Ga0157371_10062700 | Ga0157371_100627002 | 288 |
| 288 | 3300013104 | Ga0157370_10014083 | Ga0157370_100140834 | 288 |
| 289 | 3300013104 | Ga0157370_10394172 | Ga0157370_103941721 | 288 |
| 290 | 3300013105 | Ga0157369_10018418 | Ga0157369_100184185 | 288 |
| 291 | 3300013296 | Ga0157374_10009748 | Ga0157374_100097484 | 288 |
| 292 | 3300013307 | Ga0157372_10011766 | Ga0157372_100117665 | 288 |
| 293 | 3300014745 | Ga0157377_10005230 | Ga0157377_100052304 | 288 |
| 294 | 3300014968 | Ga0157379_10049331 | Ga0157379_100493312 | 288 |
| 295 | 3300020070 | Ga0206356_11870205 | Ga0206356_118702052 | 288 |
| 296 | 3300020081 | Ga0206354_10109562 | Ga0206354_101095623 | 288 |
| 297 | 3300020082 | Ga0206353_10123281 | Ga0206353_101232812 | 288 |
| 298 | 3300025303 | Ga0209051_1003334 | Ga0209051_10033348 | 288 |
| 299 | 3300025321 | Ga0207656_10006016 | Ga0207656_100060164 | 288 |
| 300 | 3300025900 | Ga0207710_10007632 | Ga0207710_100076322 | 288 |
| 301 | 3300025901 | Ga0207688_10002927 | Ga0207688_100029272 | 288 |
| 302 | 3300025904 | Ga0207647_10004918 | Ga0207647_100049183 | 288 |
| 303 | 3300025904 | Ga0207647_10108975 | Ga0207647_101089752 | 288 |
| 304 | 3300025906 | Ga0207699_10007023 | Ga0207699_100070234 | 288 |
| 305 | 3300025907 | Ga0207645_10020923 | Ga0207645_100209232 | 288 |
| 306 | 3300025908 | Ga0207643_10000816 | Ga0207643_1000081615 | 288 |
| 307 | 3300025909 | Ga0207705_10012126 | Ga0207705_100121264 | 288 |
| 308 | 3300025911 | Ga0207654_10005779 | Ga0207654_100057792 | 288 |
| 309 | 3300025913 | Ga0207695_10001306 | Ga0207695_1000130629 | 288 |
| 310 | 3300025913 | Ga0207695_10381716 | Ga0207695_103817162 | 288 |
| 311 | 3300025914 | Ga0207671_10000970 | Ga0207671_1000097023 | 288 |
| 312 | 3300025914 | Ga0207671_10070622 | Ga0207671_100706222 | 288 |
| 313 | 3300025915 | Ga0207693_10220136 | Ga0207693_102201362 | 288 |
| 314 | 3300025917 | Ga0207660_10009296 | Ga0207660_100092965 | 288 |
| 315 | 3300025919 | Ga0207657_10008273 | Ga0207657_100082735 | 288 |
| 316 | 3300025920 | Ga0207649_10008895 | Ga0207649_100088955 | 288 |
| 317 | 3300025921 | Ga0207652_10014129 | Ga0207652_100141292 | 288 |
| 318 | 3300025924 | Ga0207694_10002442 | Ga0207694_100024426 | 288 |
| 319 | 3300025924 | Ga0207694_10011791 | Ga0207694_100117913 | 288 |
| 320 | 3300025925 | Ga0207650_10009680 | Ga0207650_100096802 | 288 |
| 321 | 3300025926 | Ga0207659_10002300 | Ga0207659_100023007 | 288 |
| 322 | 3300025927 | Ga0207687_10032208 | Ga0207687_100322083 | 288 |
| 323 | 3300025928 | Ga0207700_10005422 | Ga0207700_100054222 | 288 |
| 324 | 3300025942 | Ga0207689_10084403 | Ga0207689_100844032 | 288 |
| 325 | 3300025945 | Ga0207679_10013112 | Ga0207679_100131124 | 288 |
| 326 | 3300025960 | Ga0207651_10029045 | Ga0207651_100290453 | 288 |
| 327 | 3300025961 | Ga0207712_10157360 | Ga0207712_101573602 | 288 |
| 328 | 3300025981 | Ga0207640_10004331 | Ga0207640_100043315 | 288 |
| 329 | 3300025981 | Ga0207640_10014924 | Ga0207640_100149242 | 288 |
| 330 | 3300026023 | Ga0207677_10003273 | Ga0207677_100032732 | 288 |
| 331 | 3300026035 | Ga0207703_10066964 | Ga0207703_100669643 | 288 |
| 332 | 3300026041 | Ga0207639_10162472 | Ga0207639_101624722 | 288 |
| 333 | 3300026041 | Ga0207639_10199795 | Ga0207639_101997952 | 288 |
| 334 | 3300026067 | Ga0207678_10003464 | Ga0207678_100034644 | 288 |
| 335 | 3300026075 | Ga0207708_10074529 | Ga0207708_100745292 | 288 |
| 336 | 3300026078 | Ga0207702_10002143 | Ga0207702_1000214310 | 288 |
| 337 | 3300026088 | Ga0207641_10015123 | Ga0207641_100151235 | 288 |
| 338 | 3300026095 | Ga0207676_10002108 | Ga0207676_100021088 | 288 |
| 339 | 3300026116 | Ga0207674_10118586 | Ga0207674_101185862 | 288 |
| 340 | 3300026118 | Ga0207675_100026066 | Ga0207675_1000260662 | 288 |
| 341 | 3300026121 | Ga0207683_10000446 | Ga0207683_1000044623 | 288 |
| 342 | 3300026142 | Ga0207698_10039974 | Ga0207698_100399742 | 288 |
| 343 | 3300027907 | Ga0207428_10002274 | Ga0207428_1000227410 | 288 |
| 344 | 3300031616 | Ga0307508_10085136 | Ga0307508_100851362 | 288 |
| 345 | 3300042005 | Ga0439448_0011385 | Ga0439448_0011385_711_1667 | 288 |
| 346 | 3300042438 | Ga0439459_0006988 | Ga0439459_0006988_590_1534 | 288 |
| 347 | 3300044693 | Ga0466961_0181048 | Ga0466961_0181048_167_1153 | 288 |
| 348 | 3300045976 | Ga0466967_0051836 | Ga0466967_0051836_2249_3181 | 288 |
| 349 | 3300046454 | Ga0495592_0099896 | Ga0495592_0099896_683_1678 | 288 |
| 350 | 3300046459 | Ga0495629_0030302 | Ga0495629_0030302_2136_3032 | 288 |
| 351 | 3300046462 | Ga0495651_0001059 | Ga0495651_0001059_17895_18890 | 288 |
| 352 | 3300046507 | Ga0495606_0073176 | Ga0495606_0073176_595_1539 | 288 |
| 353 | 3300046516 | Ga0495628_0003366 | Ga0495628_0003366_5685_6680 | 288 |
| 354 | 3300046529 | Ga0495652_0001619 | Ga0495652_0001619_9028_10023 | 288 |
| 355 | 3300046543 | Ga0495645_0012475 | Ga0495645_0012475_2062_3057 | 288 |
| 356 | 3300046675 | Ga0495657_0063380 | Ga0495657_0063380_1023_2018 | 288 |
| 357 | 3300046809 | Ga0495600_0017105 | Ga0495600_0017105_1989_2984 | 288 |
| 358 | 3300047317 | Ga0495604_0061992 | Ga0495604_0061992_760_1755 | 288 |
| 359 | 3300048903 | Ga0496100_0006848 | Ga0496100_0006848_1079_2035 | 288 |
| 360 | 3300048905 | Ga0496102_0015079 | Ga0496102_0015079_4506_5462 | 288 |
| 361 | 3300048908 | Ga0496105_0002982 | Ga0496105_0002982_5842_6798 | 288 |
| 362 | 3300048911 | Ga0496108_0004925 | Ga0496108_0004925_1377_2333 | 288 |
| 363 | 3300048912 | Ga0496109_0010642 | Ga0496109_0010642_1967_2923 | 288 |
| 364 | 3300048913 | Ga0496110_0003418 | Ga0496110_0003418_4868_5824 | 288 |
| 365 | 3300048914 | Ga0496111_0000654 | Ga0496111_0000654_8679_9635 | 288 |
| 366 | 3300048915 | Ga0496112_0153944 | Ga0496112_0153944_954_1910 | 288 |
| 367 | 3300048916 | Ga0496113_0002535 | Ga0496113_0002535_7783_8739 | 288 |
| 368 | 3300048922 | Ga0496119_0050878 | Ga0496119_0050878_500_1444 | 288 |
| 369 | 3300050511 | nmdc:mga08y16_65083_c1 | nmdc:mga08y16_65083_c1_1000_1956 | 288 |
| 370 | 3300050512 | nmdc:mga0n895_12207_c1 | nmdc:mga0n895_12207_c1_4648_5604 | 288 |
| 371 | 3300050513 | nmdc:mga0rr50_1297_c1 | nmdc:mga0rr50_1297_c1_4541_5497 | 288 |
| 372 | 3300050514 | nmdc:mga08x19_3218_c1 | nmdc:mga08x19_3218_c1_8083_9039 | 288 |
| 373 | 3300050515 | nmdc:mga0a205_15078_c1 | nmdc:mga0a205_15078_c1_4769_5725 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
91
276
0.88
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7766 | 71 | 274 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7706 | 68 | 274 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7351 | 68 | 274 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7322 | 71 | 274 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.7061 | 71 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75799_92_298_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9474 | 67 | 276 | 1.10.3720.10 |
| af_P75799_92_298_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.943 | 67 | 276 | 1.10.3720.10 |
| af_P77463_85_288_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9429 | 69 | 273 | 1.10.3720.10 |
| af_L0TEV4_50_262_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9424 | 66 | 280 | 1.10.3720.10 |
| af_L0TEV4_50_262_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9382 | 66 | 280 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E4J4E8-F1-model_v4 | Binding-protein-dependent transport system inner membrane component | 0.9767 | 13 | 275 |
GO:0005886
GO:0055085 |
| AF-A0A6B2CAS1-F1-model_v4 | ABC transporter permease subunit | 0.9755 | 10 | 280 |
GO:0005886
GO:0055085 |
| AF-A0A7C5TZL0-F1-model_v4 | ABC transporter permease | 0.9753 | 10 | 280 |
GO:0005886
GO:0055085 |
| AF-F7YW59-F1-model_v4 | Binding-protein-dependent transport systems inner membrane component | 0.975 | 13 | 280 |
GO:0005886
GO:0071916 |
| AF-A0A0D8HHW1-F1-model_v4 | Dipeptide transport system permease protein DppC | 0.9742 | 2 | 280 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar