F426465

General Info

Members Datasets Scaffolds Average Seq Length
373 244 372 298

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0015074|Ga0495618_0015074_879_1886
Length 335
Sequence MKFASLVQNRKALIGLILFGITALVGIFPGLFASKADADTIGAFSPNLGVSTAHLLGTTSYGQDIFSQLVFGARQVLVIALVAGAFATVLAVLIGITAAYMGGIVDEVLSLFTNVVLILPTFPLMIILARYAGTSNWVMIIVLVVTGWSYGANQMRAQALSLRNRDFLEAARVRGERRSYIILFEMMPTMTSLIVANFLGSALYSVLAASGLQFIGLGDKTSDSWGTMLYWADSQEALQAGNALWIIAPGLAIAVLSAAFALMNYAFDEIGNPALRPVRRKDLRKARKADAEAQRGAEHVYCLSRCLIRPSRCWTCGICGSSTTRRVARWRRVPG

Samples

Sample ID Description Type Environment
1 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.8
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 5.9
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 3.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002148 3300001976 Bacteria 2633
2 JGI24740J21852_10013421 3300001979 Bacteria 3056
3 JGI24739J22299_10000936 3300001989 Bacteria 10868
4 JGI24751J29686_10001163 3300002459 Bacteria 5628
5 rootH2_10024901 3300003320 Bacteria 5117
6 Ga0055540_1001492 3300003792 Bacteria 13904
7 Ga0070658_10002248 3300005327 Bacteria 16196
8 Ga0070658_10037938 3300005327 Bacteria 3885
9 Ga0070658_10042503 3300005327 Bacteria 3671
10 Ga0068869_100080091 3300005334 Bacteria 2435
11 Ga0070680_100003841 3300005336 Bacteria 11228
12 Ga0068868_100009852 3300005338 Bacteria 6899
13 Ga0070660_100006399 3300005339 Bacteria 8164
14 Ga0070691_10002949 3300005341 Bacteria 7627
15 Ga0070661_100022644 3300005344 Bacteria 4499
16 Ga0070692_10001488 3300005345 Bacteria 8550
17 Ga0070668_100162654 3300005347 Bacteria 1812
18 Ga0070675_100013299 3300005354 Bacteria 6467
19 Ga0070671_100103133 3300005355 Bacteria 2393
20 Ga0070673_100008420 3300005364 Bacteria 6858
21 Ga0070659_100005968 3300005366 Bacteria 8782
22 Ga0070667_100128205 3300005367 Bacteria 2213
23 Ga0070709_10185763 3300005434 Bacteria 1463
24 Ga0070714_100007089 3300005435 Bacteria 8692
25 Ga0070713_100004044 3300005436 Bacteria 9769
26 Ga0070713_100125388 3300005436 Bacteria 2258
27 Ga0070701_10095939 3300005438 Bacteria 1634
28 Ga0070711_100029896 3300005439 Bacteria 3601
29 Ga0070663_100012554 3300005455 Bacteria 5364
30 Ga0070662_100339384 3300005457 Bacteria 1229
31 Ga0070681_10437439 3300005458 Bacteria 1220
32 Ga0070706_100000400 3300005467 Bacteria 52368
33 Ga0070706_100122025 3300005467 Bacteria 2429
34 Ga0070706_100292530 3300005467 Bacteria 1520
35 Ga0070707_100024348 3300005468 Bacteria 5733
36 Ga0070698_100103518 3300005471 Bacteria 2817
37 Ga0070699_100267580 3300005518 Bacteria 1529
38 Ga0070679_100010266 3300005530 Bacteria 8877
39 Ga0070679_100016122 3300005530 Bacteria 7199
40 Ga0070679_100091820 3300005530 Bacteria 3024
41 Ga0068853_100078072 3300005539 Bacteria 2893
42 Ga0068853_100213900 3300005539 Bacteria 1758
43 Ga0070686_100112790 3300005544 Bacteria 1855
44 Ga0070693_100002658 3300005547 Bacteria 8229
45 Ga0070665_100010846 3300005548 Bacteria 9216
46 Ga0070704_100189156 3300005549 Bacteria 1653
47 Ga0068855_100002594 3300005563 Bacteria 22270
48 Ga0068855_100005004 3300005563 Bacteria 16171
49 Ga0068855_100012152 3300005563 Bacteria 10404
50 Ga0068855_100134281 3300005563 Bacteria 2824
51 Ga0068855_100387891 3300005563 Bacteria 1533
52 Ga0068857_100248912 3300005577 Bacteria 1629
53 Ga0068854_100002542 3300005578 Bacteria 11293
54 Ga0068854_100073178 3300005578 Bacteria 2511
55 Ga0068856_100012979 3300005614 Bacteria 8067
56 Ga0068856_100013286 3300005614 Bacteria 7975
57 Ga0068852_100004937 3300005616 Bacteria 9472
58 Ga0068852_100109928 3300005616 Bacteria 2504
59 Ga0068859_100052159 3300005617 Bacteria 4112
60 Ga0068864_100043428 3300005618 Bacteria 3849
61 Ga0068864_100128638 3300005618 Bacteria 2272
62 Ga0068861_100175835 3300005719 Bacteria 1778
63 Ga0068851_10135338 3300005834 Bacteria 1336
64 Ga0068870_10000206 3300005840 Bacteria 21149
65 Ga0068863_100170175 3300005841 Bacteria 2089
66 Ga0068863_100176671 3300005841 Bacteria 2049
67 Ga0068858_100025174 3300005842 Bacteria 5537
68 Ga0068858_100594090 3300005842 Bacteria 1073
69 Ga0081455_10011020 3300005937 Bacteria 9105
70 Ga0081455_10078961 3300005937 Bacteria 2703
71 Ga0081540_1011090 3300005983 Bacteria 6050
72 Ga0070717_10053784 3300006028 Bacteria 3319
73 Ga0097621_100007330 3300006237 Bacteria 7883
74 Ga0068871_100008339 3300006358 Bacteria 7450
75 Ga0075433_10006126 3300006852 Bacteria 9472
76 Ga0075434_100005408 3300006871 Bacteria 11620
77 Ga0075436_100000490 3300006914 Bacteria 25561
78 Ga0097620_100052159 3300006931 Bacteria 4112
79 Ga0075435_100000491 3300007076 Bacteria 24044
80 Ga0105240_10010252 3300009093 Bacteria 13190
81 Ga0105240_10018132 3300009093 Bacteria 9463
82 Ga0105240_10087504 3300009093 Bacteria 3815
83 Ga0105240_10091504 3300009093 Bacteria 3716
84 Ga0111539_10006134 3300009094 Bacteria 15519
85 Ga0105245_10010100 3300009098 Bacteria 8224
86 Ga0105247_10015340 3300009101 Bacteria 4590
87 Ga0105241_10003469 3300009174 Bacteria 11734
88 Ga0105241_10006616 3300009174 Bacteria 8539
89 Ga0105248_10119344 3300009177 Bacteria 2975
90 Ga0105237_10026178 3300009545 Bacteria 5962
91 Ga0105237_10042340 3300009545 Bacteria 4593
92 Ga0105238_10002739 3300009551 Bacteria 17556
93 Ga0105238_10031540 3300009551 Bacteria 5396
94 Ga0105249_10782320 3300009553 Bacteria 1018
95 Ga0105239_10040701 3300010375 Bacteria 5092
96 Ga0105246_10001215 3300011119 Bacteria 15095
97 Ga0157371_10062700 3300013102 Bacteria 2635
98 Ga0157370_10006967 3300013104 Bacteria 12345
99 Ga0157370_10014083 3300013104 Bacteria 8204
100 Ga0157370_10394172 3300013104 Bacteria 1275
101 Ga0157369_10010186 3300013105 Bacteria 10726
102 Ga0157369_10018418 3300013105 Bacteria 7830
103 Ga0157369_10286606 3300013105 Bacteria 1715
104 Ga0157374_10009748 3300013296 Bacteria 8246
105 Ga0157372_10011766 3300013307 Bacteria 9319
106 Ga0157372_10060447 3300013307 Bacteria 4240
107 Ga0157372_10160972 3300013307 Bacteria 2594
108 Ga0157372_10161785 3300013307 Bacteria 2587
109 Ga0157375_10576387 3300013308 Bacteria 1286
110 Ga0163163_10160768 3300014325 Bacteria 2291
111 Ga0157377_10005230 3300014745 Bacteria 6076
112 Ga0157377_10054214 3300014745 Bacteria 2269
113 Ga0157379_10049331 3300014968 Bacteria 3758
114 Ga0157376_10049939 3300014969 Bacteria 3468
115 Ga0157376_10316732 3300014969 Bacteria 1482
116 Ga0206356_11870205 3300020070 Bacteria 2489
117 Ga0206354_10109562 3300020081 Bacteria 3494
118 Ga0206353_10123281 3300020082 Bacteria 5671
119 Ga0213875_10001053 3300021388 Bacteria 19406
120 Ga0209051_1003334 3300025303 Bacteria 10614
121 Ga0207656_10006016 3300025321 Bacteria 4338
122 Ga0207710_10007632 3300025900 Bacteria 4576
123 Ga0207688_10002927 3300025901 Bacteria 9280
124 Ga0207647_10004918 3300025904 Bacteria 9854
125 Ga0207647_10108975 3300025904 Bacteria 1638
126 Ga0207647_10115699 3300025904 Bacteria 1583
127 Ga0207699_10007023 3300025906 Bacteria 5485
128 Ga0207645_10020923 3300025907 Bacteria 4274
129 Ga0207643_10000816 3300025908 Bacteria 18940
130 Ga0207705_10012126 3300025909 Bacteria 6230
131 Ga0207705_10044155 3300025909 Bacteria 3203
132 Ga0207705_10053893 3300025909 Bacteria 2898
133 Ga0207684_10001109 3300025910 Bacteria 30110
134 Ga0207684_10080375 3300025910 Bacteria 2773
135 Ga0207684_10228198 3300025910 Bacteria 1607
136 Ga0207654_10005779 3300025911 Bacteria 6246
137 Ga0207707_10361353 3300025912 Bacteria 1250
138 Ga0207695_10001306 3300025913 Bacteria 42341
139 Ga0207695_10033487 3300025913 Bacteria 5602
140 Ga0207695_10381716 3300025913 Bacteria 1295
141 Ga0207671_10000970 3300025914 Bacteria 35528
142 Ga0207671_10070622 3300025914 Bacteria 2604
143 Ga0207693_10220136 3300025915 Bacteria 1491
144 Ga0207660_10009296 3300025917 Bacteria 6364
145 Ga0207657_10008273 3300025919 Bacteria 10588
146 Ga0207649_10008895 3300025920 Bacteria 5484
147 Ga0207652_10014129 3300025921 Bacteria 6464
148 Ga0207652_10029837 3300025921 Bacteria 4564
149 Ga0207652_10037427 3300025921 Bacteria 4107
150 Ga0207646_10012214 3300025922 Bacteria 8263
151 Ga0207694_10002442 3300025924 Bacteria 15147
152 Ga0207694_10011791 3300025924 Bacteria 6594
153 Ga0207650_10009680 3300025925 Bacteria 6588
154 Ga0207650_10102015 3300025925 Bacteria 2210
155 Ga0207659_10002300 3300025926 Bacteria 11379
156 Ga0207687_10032208 3300025927 Bacteria 3549
157 Ga0207700_10005422 3300025928 Bacteria 7630
158 Ga0207664_10001906 3300025929 Bacteria 13698
159 Ga0207691_10445591 3300025940 Bacteria 1102
160 Ga0207711_10038327 3300025941 Bacteria 4075
161 Ga0207689_10084403 3300025942 Bacteria 2611
162 Ga0207689_10165965 3300025942 Bacteria 1819
163 Ga0207661_10050437 3300025944 Bacteria 3316
164 Ga0207679_10013112 3300025945 Bacteria 5427
165 Ga0207667_10033476 3300025949 Bacteria 5524
166 Ga0207651_10029045 3300025960 Bacteria 3498
167 Ga0207712_10157360 3300025961 Bacteria 1761
168 Ga0207668_10034546 3300025972 Bacteria 3359
169 Ga0207640_10004331 3300025981 Bacteria 7688
170 Ga0207640_10014924 3300025981 Bacteria 4484
171 Ga0207658_10222712 3300025986 Bacteria 1588
172 Ga0207677_10003273 3300026023 Bacteria 8556
173 Ga0207703_10066964 3300026035 Bacteria 2955
174 Ga0207639_10162472 3300026041 Bacteria 1883
175 Ga0207639_10199795 3300026041 Bacteria 1714
176 Ga0207678_10003464 3300026067 Bacteria 14200
177 Ga0207708_10074529 3300026075 Bacteria 2601
178 Ga0207702_10002143 3300026078 Bacteria 18963
179 Ga0207702_10009643 3300026078 Bacteria 8106
180 Ga0207702_10038741 3300026078 Bacteria 3992
181 Ga0207702_10203205 3300026078 Bacteria 1838
182 Ga0207641_10015123 3300026088 Bacteria 6323
183 Ga0207641_10131180 3300026088 Bacteria 2251
184 Ga0207676_10002108 3300026095 Bacteria 14407
185 Ga0207674_10118586 3300026116 Bacteria 2616
186 Ga0207674_10239981 3300026116 Bacteria 1759
187 Ga0207675_100026066 3300026118 Bacteria 5441
188 Ga0207683_10000446 3300026121 Bacteria 38241
189 Ga0207698_10039974 3300026142 Bacteria 3479
190 Ga0207698_10060692 3300026142 Bacteria 2942
191 Ga0207428_10002274 3300027907 Bacteria 19270
192 Ga0307517_10134587 3300028786 Bacteria 1763
193 Ga0265338_10040707 3300028800 Bacteria 4359
194 Ga0265338_10069257 3300028800 Bacteria 3032
195 Ga0265338_10116454 3300028800 Bacteria 2141
196 Ga0307511_10073983 3300030521 Bacteria 2459
197 Ga0265325_10007012 3300031241 Bacteria 6791
198 Ga0265340_10015011 3300031247 Bacteria 4034
199 Ga0265339_10060075 3300031249 Bacteria 2049
200 Ga0265339_10097861 3300031249 Bacteria 1530
201 Ga0265316_10103139 3300031344 Bacteria 2166
202 Ga0307509_10014108 3300031507 Bacteria 9423
203 Ga0307509_10041583 3300031507 Bacteria 4987
204 Ga0307508_10007971 3300031616 Bacteria 9823
205 Ga0307508_10085136 3300031616 Bacteria 2744
206 Ga0265314_10030389 3300031711 Bacteria 3999
207 Ga0265314_10063301 3300031711 Bacteria 2510
208 Ga0265342_10026997 3300031712 Bacteria 3594
209 Ga0307518_10105562 3300031838 Bacteria 2012
210 Ga0373934_0044563 3300035086 Bacteria 1753
211 Ga0373923_0042348 3300035111 Bacteria 1880
212 Ga0373953_0000423 3300035117 Bacteria 11519
213 Ga0373956_0067234 3300035119 Bacteria 1631
214 Ga0373957_0002041 3300035120 Bacteria 5655
215 Ga0373955_0003724 3300035172 Bacteria 6713
216 Ga0373924_0016378 3300035410 Bacteria 2828
217 Ga0373933_0035432 3300035724 Bacteria 2914
218 Ga0373937_0114760 3300036401 Bacteria 2507
219 Ga0395899_0060226 3300037312 Bacteria 2797
220 Ga0395900_0041472 3300037418 Bacteria 4745
221 Ga0436364_0331782 3300037853 Bacteria 57289
222 Ga0436364_1548394 3300037853 Bacteria 98245
223 Ga0395901_0428298 3300038443 Bacteria 1356
224 Ga0439448_0011385 3300042005 Bacteria 2651
225 Ga0439459_0006988 3300042438 Bacteria 1895
226 Ga0466969_0013417 3300044656 Bacteria 4314
227 Ga0466969_0052240 3300044656 Bacteria 2008
228 Ga0466966_0005133 3300044684 Bacteria 8603
229 Ga0466966_0009028 3300044684 Bacteria 6606
230 Ga0466966_0025230 3300044684 Bacteria 3884
231 Ga0466961_0003109 3300044693 Bacteria 10334
232 Ga0466961_0144732 3300044693 Bacteria 1487
233 Ga0466961_0181048 3300044693 Bacteria 1308
234 Ga0466963_0043138 3300044694 Bacteria 2964
235 Ga0466963_0046944 3300044694 Bacteria 2849
236 Ga0466971_0000661 3300044719 Bacteria 13719
237 Ga0466957_0034387 3300044842 Bacteria 3041
238 Ga0466957_0282070 3300044842 Bacteria 1112
239 Ga0466959_0001596 3300045049 Bacteria 13982
240 Ga0466959_0003066 3300045049 Bacteria 10818
241 Ga0466958_0023558 3300045836 Bacteria 3615
242 Ga0466958_0026875 3300045836 Bacteria 3402
243 Ga0466958_0029794 3300045836 Bacteria 3239
244 Ga0466958_0074543 3300045836 Bacteria 2080
245 Ga0466967_0000744 3300045976 Bacteria 16732
246 Ga0466967_0000876 3300045976 Bacteria 16017
247 Ga0466967_0006476 3300045976 Bacteria 8294
248 Ga0466967_0051836 3300045976 Bacteria 3599
249 Ga0466967_0060211 3300045976 Bacteria 3364
250 Ga0466967_0192661 3300045976 Bacteria 1927
251 Ga0466967_0412019 3300045976 Bacteria 1316
252 Ga0495592_0014493 3300046454 Bacteria 5983
253 Ga0495592_0099896 3300046454 Bacteria 2069
254 Ga0495603_0011267 3300046455 Bacteria 5418
255 Ga0495629_0030302 3300046459 Bacteria 3837
256 Ga0495629_0111097 3300046459 Bacteria 1911
257 Ga0495651_0001059 3300046462 Bacteria 21248
258 Ga0495651_0004623 3300046462 Bacteria 10524
259 Ga0495651_0019145 3300046462 Bacteria 5304
260 Ga0495651_0139168 3300046462 Bacteria 1762
261 Ga0495653_0006860 3300046463 Bacteria 9355
262 Ga0495653_0014002 3300046463 Bacteria 6540
263 Ga0495653_0014006 3300046463 Bacteria 6539
264 Ga0495580_0032221 3300046472 Bacteria 3784
265 Ga0495662_0011070 3300046476 Bacteria 4409
266 Ga0495664_0005036 3300046477 Bacteria 7236
267 Ga0495664_0031484 3300046477 Bacteria 3110
268 Ga0495585_0017747 3300046492 Bacteria 4109
269 Ga0495607_0084482 3300046501 Bacteria 1736
270 Ga0495606_0073176 3300046507 Bacteria 2151
271 Ga0495608_0001470 3300046511 Bacteria 16742
272 Ga0495608_0009048 3300046511 Bacteria 6967
273 Ga0495618_0015074 3300046514 Bacteria 4715
274 Ga0495618_0075744 3300046514 Bacteria 2143
275 Ga0495628_0003366 3300046516 Bacteria 14295
276 Ga0495628_0017230 3300046516 Bacteria 6015
277 Ga0495628_0116150 3300046516 Bacteria 2055
278 Ga0495630_0053026 3300046517 Bacteria 3036
279 Ga0495630_0104020 3300046517 Bacteria 2148
280 Ga0495666_0044036 3300046526 Bacteria 2155
281 Ga0495652_0001619 3300046529 Bacteria 24580
282 Ga0495652_0008945 3300046529 Bacteria 9113
283 Ga0495652_0019661 3300046529 Bacteria 6012
284 Ga0495665_0046631 3300046531 Bacteria 2300
285 Ga0495640_0016404 3300046533 Bacteria 5541
286 Ga0495640_0037028 3300046533 Bacteria 3444
287 Ga0495587_0012800 3300046536 Bacteria 5277
288 Ga0495645_0000732 3300046543 Bacteria 22436
289 Ga0495645_0012475 3300046543 Bacteria 5988
290 Ga0495645_0053534 3300046543 Bacteria 2933
291 Ga0495667_0010525 3300046559 Bacteria 6258
292 Ga0495667_0081740 3300046559 Bacteria 2099
293 Ga0495634_0024330 3300046642 Bacteria 4249
294 Ga0495634_0130089 3300046642 Bacteria 1605
295 Ga0495625_0120572 3300046660 Bacteria 1785
296 Ga0495635_0001464 3300046663 Bacteria 15788
297 Ga0495635_0001507 3300046663 Bacteria 15611
298 Ga0495657_0009048 3300046675 Bacteria 7572
299 Ga0495657_0012817 3300046675 Bacteria 6214
300 Ga0495657_0063380 3300046675 Bacteria 2439
301 Ga0495599_0009154 3300046678 Bacteria 6040
302 Ga0495599_0055513 3300046678 Bacteria 2480
303 Ga0495623_0108829 3300046679 Bacteria 1681
304 Ga0495646_0010666 3300046680 Bacteria 5837
305 Ga0495646_0029750 3300046680 Bacteria 3412
306 Ga0495613_0047893 3300046689 Bacteria 3157
307 Ga0495670_0091856 3300046691 Bacteria 1554
308 Ga0495589_0017900 3300046794 Bacteria 3634
309 Ga0495600_0008011 3300046809 Bacteria 6476
310 Ga0495600_0017105 3300046809 Bacteria 4610
311 Ga0495600_0034124 3300046809 Bacteria 3303
312 Ga0495600_0111677 3300046809 Bacteria 1779
313 Ga0495581_0020225 3300047315 Bacteria 3864
314 Ga0495604_0001000 3300047317 Bacteria 23520
315 Ga0495604_0034631 3300047317 Bacteria 3994
316 Ga0495604_0061992 3300047317 Bacteria 2859
317 Ga0495674_0016193 3300047319 Bacteria 6955
318 Ga0495674_0158246 3300047319 Bacteria 1896
319 Ga0495680_0125340 3300047322 Bacteria 1892
320 Ga0495683_0041916 3300047323 Bacteria 2309
321 Ga0495675_0071796 3300047444 Bacteria 2184
322 Ga0495684_0010544 3300047471 Bacteria 7143
323 Ga0495684_0130901 3300047471 Bacteria 1884
324 Ga0495686_0024203 3300047472 Bacteria 3993
325 Ga0495602_0076764 3300048088 Bacteria 2829
326 Ga0496100_0006848 3300048903 Bacteria 6244
327 Ga0496102_0000319 3300048905 Bacteria 60314
328 Ga0496102_0015079 3300048905 Bacteria 6728
329 Ga0496103_0038447 3300048906 Bacteria 2936
330 Ga0496104_0007131 3300048907 Bacteria 9853
331 Ga0496105_0002982 3300048908 Bacteria 12442
332 Ga0496105_0035268 3300048908 Bacteria 4117
333 Ga0496106_0013020 3300048909 Bacteria 6137
334 Ga0496108_0004925 3300048911 Bacteria 10785
335 Ga0496108_0013116 3300048911 Bacteria 6756
336 Ga0496108_0039190 3300048911 Bacteria 3950
337 Ga0496109_0010642 3300048912 Bacteria 7867
338 Ga0496109_0016368 3300048912 Bacteria 6482
339 Ga0496109_0092376 3300048912 Bacteria 2799
340 Ga0496110_0003418 3300048913 Bacteria 12144
341 Ga0496111_0000654 3300048914 Bacteria 18257
342 Ga0496112_0111419 3300048915 Bacteria 2706
343 Ga0496112_0153944 3300048915 Bacteria 2266
344 Ga0496112_0304659 3300048915 Bacteria 1538
345 Ga0496113_0002535 3300048916 Bacteria 10647
346 Ga0496113_0004740 3300048916 Bacteria 8395
347 Ga0496113_0085305 3300048916 Bacteria 2426
348 Ga0496119_0050878 3300048922 Bacteria 2550
349 Ga0501042_0048789 3300049578 Bacteria 3019
350 Ga0501069_0006545 3300049585 Bacteria 6093
351 Ga0501070_0003626 3300049586 Bacteria 13335
352 Ga0501073_0315223 3300049589 Bacteria 1079
353 Ga0501080_0046707 3300049742 Bacteria 4031
354 Ga0501044_0068861 3300049823 Bacteria 3604
355 nmdc:mga08y16_65083_c1 3300050511 Bacteria 3806
356 nmdc:mga0n895_12207_c1 3300050512 Bacteria 7697
357 nmdc:mga0rr50_1297_c1 3300050513 Bacteria 13631
358 nmdc:mga08x19_3218_c1 3300050514 Bacteria 9792
359 nmdc:mga0a205_15078_c1 3300050515 Bacteria 7217
360 Ga0495601_0001254 3300053077 Bacteria 13909
361 Ga0495601_0010450 3300053077 Bacteria 5524
362 Ga0495601_0034254 3300053077 Bacteria 3167
363 Ga0495612_0001755 3300053078 Bacteria 8884
364 Ga0495612_0003851 3300053078 Bacteria 6228
365 Ga0495595_0064554 3300053084 Bacteria 1721
366 Ga0495619_0165333 3300053085 Bacteria 1529
367 Ga0500559_0025346 3300053136 Bacteria 2523
368 Ga0466962_0001104 3300061719 Bacteria 12420
369 Ga0466962_0039043 3300061719 Bacteria 2274
370 Ga0466962_0065500 3300061719 Bacteria 1735
371 Ga0466962_0106427 3300061719 Bacteria 1349
372 Ga0466962_0156854 3300061719 Bacteria 1106

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0014002 Ga0495653_0014002_3288_4262 245
2 3300013307 Ga0157372_10161785 Ga0157372_101617852 246
3 3300046459 Ga0495629_0111097 Ga0495629_0111097_331_1194 247
4 3300053136 Ga0500559_0025346 Ga0500559_0025346_722_1666 251
5 3300005327 Ga0070658_10037938 Ga0070658_100379382 253
6 3300005563 Ga0068855_100002594 Ga0068855_10000259411 253
7 3300025909 Ga0207705_10044155 Ga0207705_100441553 253
8 3300025949 Ga0207667_10033476 Ga0207667_100334765 253
9 3300028800 Ga0265338_10040707 Ga0265338_100407073 256
10 3300031241 Ga0265325_10007012 Ga0265325_100070126 256
11 3300031249 Ga0265339_10097861 Ga0265339_100978612 256
12 3300031711 Ga0265314_10030389 Ga0265314_100303892 256
13 3300031712 Ga0265342_10026997 Ga0265342_100269973 256
14 3300049589 Ga0501073_0315223 Ga0501073_0315223_228_1067 258
15 3300026078 Ga0207702_10038741 Ga0207702_100387414 260
16 3300046462 Ga0495651_0004623 Ga0495651_0004623_1316_2176 260
17 3300046463 Ga0495653_0014006 Ga0495653_0014006_4544_5404 260
18 3300046472 Ga0495580_0032221 Ga0495580_0032221_1526_2386 260
19 3300046476 Ga0495662_0011070 Ga0495662_0011070_489_1349 260
20 3300046477 Ga0495664_0005036 Ga0495664_0005036_3273_4133 260
21 3300046511 Ga0495608_0001470 Ga0495608_0001470_3031_3891 260
22 3300046516 Ga0495628_0017230 Ga0495628_0017230_4227_5087 260
23 3300046517 Ga0495630_0104020 Ga0495630_0104020_658_1518 260
24 3300046526 Ga0495666_0044036 Ga0495666_0044036_922_1782 260
25 3300046529 Ga0495652_0019661 Ga0495652_0019661_489_1349 260
26 3300046531 Ga0495665_0046631 Ga0495665_0046631_623_1483 260
27 3300046533 Ga0495640_0016404 Ga0495640_0016404_1136_1996 260
28 3300046543 Ga0495645_0000732 Ga0495645_0000732_7912_8772 260
29 3300046559 Ga0495667_0010525 Ga0495667_0010525_2323_3183 260
30 3300046642 Ga0495634_0130089 Ga0495634_0130089_88_948 260
31 3300046675 Ga0495657_0012817 Ga0495657_0012817_2323_3183 260
32 3300046678 Ga0495599_0009154 Ga0495599_0009154_2105_2965 260
33 3300046679 Ga0495623_0108829 Ga0495623_0108829_786_1646 260
34 3300046680 Ga0495646_0029750 Ga0495646_0029750_2465_3325 260
35 3300046809 Ga0495600_0111677 Ga0495600_0111677_88_948 260
36 3300047315 Ga0495581_0020225 Ga0495581_0020225_1877_2737 260
37 3300047317 Ga0495604_0001000 Ga0495604_0001000_19803_20663 260
38 3300047319 Ga0495674_0016193 Ga0495674_0016193_3031_3891 260
39 3300047471 Ga0495684_0130901 Ga0495684_0130901_658_1518 260
40 3300053077 Ga0495601_0010450 Ga0495601_0010450_1973_2833 260
41 3300005435 Ga0070714_100007089 Ga0070714_1000070893 263
42 3300006028 Ga0070717_10053784 Ga0070717_100537842 263
43 3300025904 Ga0207647_10115699 Ga0207647_101156991 263
44 3300025929 Ga0207664_10001906 Ga0207664_100019063 263
45 3300005563 Ga0068855_100134281 Ga0068855_1001342813 264
46 3300009093 Ga0105240_10091504 Ga0105240_100915043 264
47 3300025942 Ga0207689_10165965 Ga0207689_101659652 264
48 3300044684 Ga0466966_0025230 Ga0466966_0025230_1913_2830 265
49 3300045049 Ga0466959_0003066 Ga0466959_0003066_4883_5800 265
50 3300045836 Ga0466958_0029794 Ga0466958_0029794_659_1576 265
51 3300053078 Ga0495612_0001755 Ga0495612_0001755_6925_7911 266
52 3300005467 Ga0070706_100000400 Ga0070706_10000040041 269
53 3300005471 Ga0070698_100103518 Ga0070698_1001035182 269
54 3300025910 Ga0207684_10001109 Ga0207684_1000110910 269
55 3300037853 Ga0436364_0331782 Ga0436364_0331782_47287_48219 269
56 3300049742 Ga0501080_0046707 Ga0501080_0046707_46_918 269
57 3300049823 Ga0501044_0068861 Ga0501044_0068861_392_1225 269
58 3300031838 Ga0307518_10105562 Ga0307518_101055622 270
59 3300045976 Ga0466967_0006476 Ga0466967_0006476_1155_2003 272
60 3300048909 Ga0496106_0013020 Ga0496106_0013020_11_868 272
61 3300048915 Ga0496112_0111419 Ga0496112_0111419_1839_2696 272
62 3300025925 Ga0207650_10102015 Ga0207650_101020151 273
63 3300049585 Ga0501069_0006545 Ga0501069_0006545_1093_2037 274
64 3300049586 Ga0501070_0003626 Ga0501070_0003626_9445_10389 274
65 3300021388 Ga0213875_10001053 Ga0213875_100010538 275
66 3300028786 Ga0307517_10134587 Ga0307517_101345872 275
67 3300031507 Ga0307509_10014108 Ga0307509_100141088 277
68 3300044693 Ga0466961_0144732 Ga0466961_0144732_480_1418 277
69 3300044694 Ga0466963_0043138 Ga0466963_0043138_862_1794 278
70 3300044842 Ga0466957_0034387 Ga0466957_0034387_1102_2034 278
71 3300045836 Ga0466958_0026875 Ga0466958_0026875_1473_2405 278
72 3300061719 Ga0466962_0039043 Ga0466962_0039043_165_1097 278
73 3300005458 Ga0070681_10437439 Ga0070681_104374391 279
74 3300005467 Ga0070706_100122025 Ga0070706_1001220253 279
75 3300005468 Ga0070707_100024348 Ga0070707_1000243484 279
76 3300005618 Ga0068864_100043428 Ga0068864_1000434283 279
77 3300005841 Ga0068863_100176671 Ga0068863_1001766712 279
78 3300005842 Ga0068858_100594090 Ga0068858_1005940902 279
79 3300009177 Ga0105248_10119344 Ga0105248_101193443 279
80 3300014325 Ga0163163_10160768 Ga0163163_101607682 279
81 3300025912 Ga0207707_10361353 Ga0207707_103613532 279
82 3300025922 Ga0207646_10012214 Ga0207646_100122145 279
83 3300025941 Ga0207711_10038327 Ga0207711_100383272 279
84 3300025944 Ga0207661_10050437 Ga0207661_100504372 279
85 3300026078 Ga0207702_10203205 Ga0207702_102032052 279
86 3300048907 Ga0496104_0007131 Ga0496104_0007131_7406_8320 279
87 3300048908 Ga0496105_0035268 Ga0496105_0035268_631_1545 279
88 3300048911 Ga0496108_0013116 Ga0496108_0013116_4838_5752 279
89 3300048912 Ga0496109_0092376 Ga0496109_0092376_58_972 279
90 3300048915 Ga0496112_0304659 Ga0496112_0304659_566_1480 279
91 3300048916 Ga0496113_0004740 Ga0496113_0004740_7012_7926 279
92 3300048905 Ga0496102_0000319 Ga0496102_0000319_55539_56477 280
93 3300048906 Ga0496103_0038447 Ga0496103_0038447_1493_2431 280
94 3300030521 Ga0307511_10073983 Ga0307511_100739832 281
95 3300031507 Ga0307509_10041583 Ga0307509_100415835 281
96 3300031616 Ga0307508_10007971 Ga0307508_100079716 281
97 3300044656 Ga0466969_0013417 Ga0466969_0013417_428_1348 281
98 3300044684 Ga0466966_0005133 Ga0466966_0005133_6645_7565 281
99 3300044693 Ga0466961_0003109 Ga0466961_0003109_6638_7558 281
100 3300044719 Ga0466971_0000661 Ga0466971_0000661_3737_4657 281
101 3300045049 Ga0466959_0001596 Ga0466959_0001596_7615_8535 281
102 3300045836 Ga0466958_0023558 Ga0466958_0023558_1858_2778 281
103 3300046454 Ga0495592_0014493 Ga0495592_0014493_257_1174 281
104 3300046462 Ga0495651_0019145 Ga0495651_0019145_762_1679 281
105 3300046477 Ga0495664_0031484 Ga0495664_0031484_234_1151 281
106 3300046514 Ga0495618_0015074 Ga0495618_0015074_879_1886 281
107 3300046529 Ga0495652_0008945 Ga0495652_0008945_3407_4324 281
108 3300046543 Ga0495645_0053534 Ga0495645_0053534_931_1848 281
109 3300046663 Ga0495635_0001507 Ga0495635_0001507_4361_5281 281
110 3300046680 Ga0495646_0010666 Ga0495646_0010666_2291_3208 281
111 3300046809 Ga0495600_0034124 Ga0495600_0034124_1763_2683 281
112 3300053077 Ga0495601_0001254 Ga0495601_0001254_742_1659 281
113 3300053078 Ga0495612_0003851 Ga0495612_0003851_3058_3978 281
114 3300061719 Ga0466962_0001104 Ga0466962_0001104_1820_2740 281
115 3300003320 rootH2_10024901 rootH2_100249012 282
116 3300005327 Ga0070658_10002248 Ga0070658_100022486 282
117 3300013308 Ga0157375_10576387 Ga0157375_105763872 282
118 3300025909 Ga0207705_10053893 Ga0207705_100538932 282
119 3300025940 Ga0207691_10445591 Ga0207691_104455911 282
120 3300009093 Ga0105240_10010252 Ga0105240_100102526 283
121 3300044656 Ga0466969_0052240 Ga0466969_0052240_300_1226 283
122 3300044684 Ga0466966_0009028 Ga0466966_0009028_2250_3191 283
123 3300053077 Ga0495601_0034254 Ga0495601_0034254_2175_3089 283
124 3300001979 JGI24740J21852_10013421 JGI24740J21852_100134212 284
125 3300001989 JGI24739J22299_10000936 JGI24739J22299_1000093611 284
126 3300005347 Ga0070668_100162654 Ga0070668_1001626542 284
127 3300005367 Ga0070667_100128205 Ga0070667_1001282052 284
128 3300005434 Ga0070709_10185763 Ga0070709_101857632 284
129 3300005467 Ga0070706_100292530 Ga0070706_1002925302 284
130 3300005518 Ga0070699_100267580 Ga0070699_1002675802 284
131 3300005577 Ga0068857_100248912 Ga0068857_1002489122 284
132 3300013105 Ga0157369_10286606 Ga0157369_102866062 284
133 3300013307 Ga0157372_10060447 Ga0157372_100604472 284
134 3300025910 Ga0207684_10080375 Ga0207684_100803752 284
135 3300025910 Ga0207684_10228198 Ga0207684_102281982 284
136 3300025972 Ga0207668_10034546 Ga0207668_100345463 284
137 3300025986 Ga0207658_10222712 Ga0207658_102227122 284
138 3300026116 Ga0207674_10239981 Ga0207674_102399812 284
139 3300044694 Ga0466963_0046944 Ga0466963_0046944_852_1775 284
140 3300045976 Ga0466967_0412019 Ga0466967_0412019_101_1021 284
141 3300049578 Ga0501042_0048789 Ga0501042_0048789_1019_2008 284
142 3300061719 Ga0466962_0106427 Ga0466962_0106427_38_961 284
143 iso_pu_bacteria 2902792274 2902797587 284
144 3300005614 Ga0068856_100013286 Ga0068856_1000132868 285
145 3300026078 Ga0207702_10009643 Ga0207702_100096432 285
146 3300026088 Ga0207641_10131180 Ga0207641_101311802 285
147 3300044842 Ga0466957_0282070 Ga0466957_0282070_39_965 285
148 3300045976 Ga0466967_0000744 Ga0466967_0000744_12568_13494 285
149 3300046492 Ga0495585_0017747 Ga0495585_0017747_2138_3070 285
150 3300005549 Ga0070704_100189156 Ga0070704_1001891562 286
151 3300005617 Ga0068859_100052159 Ga0068859_1000521592 286
152 3300005937 Ga0081455_10011020 Ga0081455_100110208 286
153 3300006931 Ga0097620_100052159 Ga0097620_1000521592 286
154 3300014745 Ga0157377_10054214 Ga0157377_100542142 286
155 3300014969 Ga0157376_10049939 Ga0157376_100499392 286
156 3300014969 Ga0157376_10316732 Ga0157376_103167322 286
157 3300031247 Ga0265340_10015011 Ga0265340_100150113 286
158 3300035086 Ga0373934_0044563 Ga0373934_0044563_289_1221 286
159 3300035111 Ga0373923_0042348 Ga0373923_0042348_499_1431 286
160 3300035117 Ga0373953_0000423 Ga0373953_0000423_895_1827 286
161 3300035119 Ga0373956_0067234 Ga0373956_0067234_341_1273 286
162 3300035120 Ga0373957_0002041 Ga0373957_0002041_663_1595 286
163 3300035172 Ga0373955_0003724 Ga0373955_0003724_5180_6112 286
164 3300035410 Ga0373924_0016378 Ga0373924_0016378_1050_1982 286
165 3300035724 Ga0373933_0035432 Ga0373933_0035432_1117_2049 286
166 3300036401 Ga0373937_0114760 Ga0373937_0114760_1045_1977 286
167 3300037853 Ga0436364_1548394 Ga0436364_1548394_39923_40909 286
168 3300038443 Ga0395901_0428298 Ga0395901_0428298_61_996 286
169 3300046462 Ga0495651_0139168 Ga0495651_0139168_643_1575 286
170 3300046463 Ga0495653_0006860 Ga0495653_0006860_3354_4286 286
171 3300046511 Ga0495608_0009048 Ga0495608_0009048_2613_3545 286
172 3300046514 Ga0495618_0075744 Ga0495618_0075744_696_1628 286
173 3300046516 Ga0495628_0116150 Ga0495628_0116150_528_1460 286
174 3300046517 Ga0495630_0053026 Ga0495630_0053026_1655_2587 286
175 3300046533 Ga0495640_0037028 Ga0495640_0037028_1072_2004 286
176 3300046536 Ga0495587_0012800 Ga0495587_0012800_4005_4937 286
177 3300046559 Ga0495667_0081740 Ga0495667_0081740_456_1388 286
178 3300046642 Ga0495634_0024330 Ga0495634_0024330_881_1813 286
179 3300046663 Ga0495635_0001464 Ga0495635_0001464_5718_6650 286
180 3300046675 Ga0495657_0009048 Ga0495657_0009048_1258_2190 286
181 3300046678 Ga0495599_0055513 Ga0495599_0055513_1021_1953 286
182 3300046689 Ga0495613_0047893 Ga0495613_0047893_1116_2048 286
183 3300046809 Ga0495600_0008011 Ga0495600_0008011_1404_2336 286
184 3300047317 Ga0495604_0034631 Ga0495604_0034631_911_1843 286
185 3300047319 Ga0495674_0158246 Ga0495674_0158246_546_1478 286
186 3300047322 Ga0495680_0125340 Ga0495680_0125340_567_1499 286
187 3300047444 Ga0495675_0071796 Ga0495675_0071796_118_1050 286
188 3300047471 Ga0495684_0010544 Ga0495684_0010544_1186_2118 286
189 3300047472 Ga0495686_0024203 Ga0495686_0024203_1599_2537 286
190 3300048088 Ga0495602_0076764 Ga0495602_0076764_987_1919 286
191 3300053084 Ga0495595_0064554 Ga0495595_0064554_225_1157 286
192 3300053085 Ga0495619_0165333 Ga0495619_0165333_157_1089 286
193 3300061719 Ga0466962_0065500 Ga0466962_0065500_776_1717 286
194 3300005530 Ga0070679_100016122 Ga0070679_1000161224 287
195 3300005530 Ga0070679_100091820 Ga0070679_1000918202 287
196 3300005563 Ga0068855_100012152 Ga0068855_1000121522 287
197 3300005616 Ga0068852_100109928 Ga0068852_1001099282 287
198 3300005937 Ga0081455_10078961 Ga0081455_100789612 287
199 3300009093 Ga0105240_10018132 Ga0105240_100181324 287
200 3300013104 Ga0157370_10006967 Ga0157370_100069674 287
201 3300013105 Ga0157369_10010186 Ga0157369_100101866 287
202 3300013307 Ga0157372_10160972 Ga0157372_101609723 287
203 3300025913 Ga0207695_10033487 Ga0207695_100334872 287
204 3300025921 Ga0207652_10029837 Ga0207652_100298373 287
205 3300025921 Ga0207652_10037427 Ga0207652_100374273 287
206 3300026142 Ga0207698_10060692 Ga0207698_100606922 287
207 3300028800 Ga0265338_10069257 Ga0265338_100692573 287
208 3300028800 Ga0265338_10116454 Ga0265338_101164542 287
209 3300031249 Ga0265339_10060075 Ga0265339_100600752 287
210 3300031344 Ga0265316_10103139 Ga0265316_101031392 287
211 3300031711 Ga0265314_10063301 Ga0265314_100633012 287
212 3300037312 Ga0395899_0060226 Ga0395899_0060226_566_1510 287
213 3300037418 Ga0395900_0041472 Ga0395900_0041472_1558_2502 287
214 3300045836 Ga0466958_0074543 Ga0466958_0074543_126_1067 287
215 3300045976 Ga0466967_0000876 Ga0466967_0000876_10101_11039 287
216 3300045976 Ga0466967_0060211 Ga0466967_0060211_73_1029 287
217 3300045976 Ga0466967_0192661 Ga0466967_0192661_212_1150 287
218 3300046455 Ga0495603_0011267 Ga0495603_0011267_4306_5229 287
219 3300046501 Ga0495607_0084482 Ga0495607_0084482_538_1461 287
220 3300046660 Ga0495625_0120572 Ga0495625_0120572_642_1565 287
221 3300046691 Ga0495670_0091856 Ga0495670_0091856_551_1474 287
222 3300046794 Ga0495589_0017900 Ga0495589_0017900_1127_2050 287
223 3300047323 Ga0495683_0041916 Ga0495683_0041916_690_1613 287
224 3300048911 Ga0496108_0039190 Ga0496108_0039190_400_1338 287
225 3300048912 Ga0496109_0016368 Ga0496109_0016368_3270_4208 287
226 3300048916 Ga0496113_0085305 Ga0496113_0085305_26_964 287
227 3300061719 Ga0466962_0156854 Ga0466962_0156854_35_976 287
228 3300001976 JGI24752J21851_1002148 JGI24752J21851_10021482 288
229 3300002459 JGI24751J29686_10001163 JGI24751J29686_100011632 288
230 3300003792 Ga0055540_1001492 Ga0055540_10014929 288
231 3300005327 Ga0070658_10042503 Ga0070658_100425032 288
232 3300005334 Ga0068869_100080091 Ga0068869_1000800912 288
233 3300005336 Ga0070680_100003841 Ga0070680_1000038414 288
234 3300005338 Ga0068868_100009852 Ga0068868_1000098525 288
235 3300005339 Ga0070660_100006399 Ga0070660_1000063994 288
236 3300005341 Ga0070691_10002949 Ga0070691_100029493 288
237 3300005344 Ga0070661_100022644 Ga0070661_1000226443 288
238 3300005345 Ga0070692_10001488 Ga0070692_100014884 288
239 3300005354 Ga0070675_100013299 Ga0070675_1000132992 288
240 3300005355 Ga0070671_100103133 Ga0070671_1001031332 288
241 3300005364 Ga0070673_100008420 Ga0070673_1000084204 288
242 3300005366 Ga0070659_100005968 Ga0070659_1000059684 288
243 3300005436 Ga0070713_100004044 Ga0070713_1000040447 288
244 3300005436 Ga0070713_100125388 Ga0070713_1001253882 288
245 3300005438 Ga0070701_10095939 Ga0070701_100959392 288
246 3300005439 Ga0070711_100029896 Ga0070711_1000298962 288
247 3300005455 Ga0070663_100012554 Ga0070663_1000125541 288
248 3300005457 Ga0070662_100339384 Ga0070662_1003393841 288
249 3300005530 Ga0070679_100010266 Ga0070679_1000102664 288
250 3300005539 Ga0068853_100078072 Ga0068853_1000780722 288
251 3300005539 Ga0068853_100213900 Ga0068853_1002139002 288
252 3300005544 Ga0070686_100112790 Ga0070686_1001127902 288
253 3300005547 Ga0070693_100002658 Ga0070693_1000026584 288
254 3300005548 Ga0070665_100010846 Ga0070665_1000108469 288
255 3300005563 Ga0068855_100005004 Ga0068855_1000050046 288
256 3300005563 Ga0068855_100387891 Ga0068855_1003878912 288
257 3300005578 Ga0068854_100002542 Ga0068854_1000025423 288
258 3300005578 Ga0068854_100073178 Ga0068854_1000731782 288
259 3300005614 Ga0068856_100012979 Ga0068856_1000129794 288
260 3300005616 Ga0068852_100004937 Ga0068852_1000049378 288
261 3300005618 Ga0068864_100128638 Ga0068864_1001286382 288
262 3300005719 Ga0068861_100175835 Ga0068861_1001758352 288
263 3300005834 Ga0068851_10135338 Ga0068851_101353382 288
264 3300005840 Ga0068870_10000206 Ga0068870_1000020611 288
265 3300005841 Ga0068863_100170175 Ga0068863_1001701752 288
266 3300005842 Ga0068858_100025174 Ga0068858_1000251744 288
267 3300005983 Ga0081540_1011090 Ga0081540_10110902 288
268 3300006237 Ga0097621_100007330 Ga0097621_1000073305 288
269 3300006358 Ga0068871_100008339 Ga0068871_1000083395 288
270 3300006852 Ga0075433_10006126 Ga0075433_100061265 288
271 3300006871 Ga0075434_100005408 Ga0075434_10000540810 288
272 3300006914 Ga0075436_100000490 Ga0075436_10000049015 288
273 3300007076 Ga0075435_100000491 Ga0075435_10000049115 288
274 3300009093 Ga0105240_10087504 Ga0105240_100875042 288
275 3300009094 Ga0111539_10006134 Ga0111539_100061343 288
276 3300009098 Ga0105245_10010100 Ga0105245_100101004 288
277 3300009101 Ga0105247_10015340 Ga0105247_100153404 288
278 3300009174 Ga0105241_10003469 Ga0105241_100034697 288
279 3300009174 Ga0105241_10006616 Ga0105241_100066164 288
280 3300009545 Ga0105237_10026178 Ga0105237_100261782 288
281 3300009545 Ga0105237_10042340 Ga0105237_100423403 288
282 3300009551 Ga0105238_10002739 Ga0105238_100027397 288
283 3300009551 Ga0105238_10031540 Ga0105238_100315402 288
284 3300009553 Ga0105249_10782320 Ga0105249_107823201 288
285 3300010375 Ga0105239_10040701 Ga0105239_100407012 288
286 3300011119 Ga0105246_10001215 Ga0105246_100012158 288
287 3300013102 Ga0157371_10062700 Ga0157371_100627002 288
288 3300013104 Ga0157370_10014083 Ga0157370_100140834 288
289 3300013104 Ga0157370_10394172 Ga0157370_103941721 288
290 3300013105 Ga0157369_10018418 Ga0157369_100184185 288
291 3300013296 Ga0157374_10009748 Ga0157374_100097484 288
292 3300013307 Ga0157372_10011766 Ga0157372_100117665 288
293 3300014745 Ga0157377_10005230 Ga0157377_100052304 288
294 3300014968 Ga0157379_10049331 Ga0157379_100493312 288
295 3300020070 Ga0206356_11870205 Ga0206356_118702052 288
296 3300020081 Ga0206354_10109562 Ga0206354_101095623 288
297 3300020082 Ga0206353_10123281 Ga0206353_101232812 288
298 3300025303 Ga0209051_1003334 Ga0209051_10033348 288
299 3300025321 Ga0207656_10006016 Ga0207656_100060164 288
300 3300025900 Ga0207710_10007632 Ga0207710_100076322 288
301 3300025901 Ga0207688_10002927 Ga0207688_100029272 288
302 3300025904 Ga0207647_10004918 Ga0207647_100049183 288
303 3300025904 Ga0207647_10108975 Ga0207647_101089752 288
304 3300025906 Ga0207699_10007023 Ga0207699_100070234 288
305 3300025907 Ga0207645_10020923 Ga0207645_100209232 288
306 3300025908 Ga0207643_10000816 Ga0207643_1000081615 288
307 3300025909 Ga0207705_10012126 Ga0207705_100121264 288
308 3300025911 Ga0207654_10005779 Ga0207654_100057792 288
309 3300025913 Ga0207695_10001306 Ga0207695_1000130629 288
310 3300025913 Ga0207695_10381716 Ga0207695_103817162 288
311 3300025914 Ga0207671_10000970 Ga0207671_1000097023 288
312 3300025914 Ga0207671_10070622 Ga0207671_100706222 288
313 3300025915 Ga0207693_10220136 Ga0207693_102201362 288
314 3300025917 Ga0207660_10009296 Ga0207660_100092965 288
315 3300025919 Ga0207657_10008273 Ga0207657_100082735 288
316 3300025920 Ga0207649_10008895 Ga0207649_100088955 288
317 3300025921 Ga0207652_10014129 Ga0207652_100141292 288
318 3300025924 Ga0207694_10002442 Ga0207694_100024426 288
319 3300025924 Ga0207694_10011791 Ga0207694_100117913 288
320 3300025925 Ga0207650_10009680 Ga0207650_100096802 288
321 3300025926 Ga0207659_10002300 Ga0207659_100023007 288
322 3300025927 Ga0207687_10032208 Ga0207687_100322083 288
323 3300025928 Ga0207700_10005422 Ga0207700_100054222 288
324 3300025942 Ga0207689_10084403 Ga0207689_100844032 288
325 3300025945 Ga0207679_10013112 Ga0207679_100131124 288
326 3300025960 Ga0207651_10029045 Ga0207651_100290453 288
327 3300025961 Ga0207712_10157360 Ga0207712_101573602 288
328 3300025981 Ga0207640_10004331 Ga0207640_100043315 288
329 3300025981 Ga0207640_10014924 Ga0207640_100149242 288
330 3300026023 Ga0207677_10003273 Ga0207677_100032732 288
331 3300026035 Ga0207703_10066964 Ga0207703_100669643 288
332 3300026041 Ga0207639_10162472 Ga0207639_101624722 288
333 3300026041 Ga0207639_10199795 Ga0207639_101997952 288
334 3300026067 Ga0207678_10003464 Ga0207678_100034644 288
335 3300026075 Ga0207708_10074529 Ga0207708_100745292 288
336 3300026078 Ga0207702_10002143 Ga0207702_1000214310 288
337 3300026088 Ga0207641_10015123 Ga0207641_100151235 288
338 3300026095 Ga0207676_10002108 Ga0207676_100021088 288
339 3300026116 Ga0207674_10118586 Ga0207674_101185862 288
340 3300026118 Ga0207675_100026066 Ga0207675_1000260662 288
341 3300026121 Ga0207683_10000446 Ga0207683_1000044623 288
342 3300026142 Ga0207698_10039974 Ga0207698_100399742 288
343 3300027907 Ga0207428_10002274 Ga0207428_1000227410 288
344 3300031616 Ga0307508_10085136 Ga0307508_100851362 288
345 3300042005 Ga0439448_0011385 Ga0439448_0011385_711_1667 288
346 3300042438 Ga0439459_0006988 Ga0439459_0006988_590_1534 288
347 3300044693 Ga0466961_0181048 Ga0466961_0181048_167_1153 288
348 3300045976 Ga0466967_0051836 Ga0466967_0051836_2249_3181 288
349 3300046454 Ga0495592_0099896 Ga0495592_0099896_683_1678 288
350 3300046459 Ga0495629_0030302 Ga0495629_0030302_2136_3032 288
351 3300046462 Ga0495651_0001059 Ga0495651_0001059_17895_18890 288
352 3300046507 Ga0495606_0073176 Ga0495606_0073176_595_1539 288
353 3300046516 Ga0495628_0003366 Ga0495628_0003366_5685_6680 288
354 3300046529 Ga0495652_0001619 Ga0495652_0001619_9028_10023 288
355 3300046543 Ga0495645_0012475 Ga0495645_0012475_2062_3057 288
356 3300046675 Ga0495657_0063380 Ga0495657_0063380_1023_2018 288
357 3300046809 Ga0495600_0017105 Ga0495600_0017105_1989_2984 288
358 3300047317 Ga0495604_0061992 Ga0495604_0061992_760_1755 288
359 3300048903 Ga0496100_0006848 Ga0496100_0006848_1079_2035 288
360 3300048905 Ga0496102_0015079 Ga0496102_0015079_4506_5462 288
361 3300048908 Ga0496105_0002982 Ga0496105_0002982_5842_6798 288
362 3300048911 Ga0496108_0004925 Ga0496108_0004925_1377_2333 288
363 3300048912 Ga0496109_0010642 Ga0496109_0010642_1967_2923 288
364 3300048913 Ga0496110_0003418 Ga0496110_0003418_4868_5824 288
365 3300048914 Ga0496111_0000654 Ga0496111_0000654_8679_9635 288
366 3300048915 Ga0496112_0153944 Ga0496112_0153944_954_1910 288
367 3300048916 Ga0496113_0002535 Ga0496113_0002535_7783_8739 288
368 3300048922 Ga0496119_0050878 Ga0496119_0050878_500_1444 288
369 3300050511 nmdc:mga08y16_65083_c1 nmdc:mga08y16_65083_c1_1000_1956 288
370 3300050512 nmdc:mga0n895_12207_c1 nmdc:mga0n895_12207_c1_4648_5604 288
371 3300050513 nmdc:mga0rr50_1297_c1 nmdc:mga0rr50_1297_c1_4541_5497 288
372 3300050514 nmdc:mga08x19_3218_c1 nmdc:mga08x19_3218_c1_8083_9039 288
373 3300050515 nmdc:mga0a205_15078_c1 nmdc:mga0a205_15078_c1_4769_5725 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

91

276

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7766 71 274
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7706 68 274
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7351 68 274
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7322 71 274
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7061 71 260
ID Description Score Start End Superfamily
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9474 67 276 1.10.3720.10
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.943 67 276 1.10.3720.10
af_P77463_85_288_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9429 69 273 1.10.3720.10
af_L0TEV4_50_262_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9424 66 280 1.10.3720.10
af_L0TEV4_50_262_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9382 66 280 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5E4J4E8-F1-model_v4 Binding-protein-dependent transport system inner membrane component 0.9767 13 275 GO:0005886
GO:0055085
AF-A0A6B2CAS1-F1-model_v4 ABC transporter permease subunit 0.9755 10 280 GO:0005886
GO:0055085
AF-A0A7C5TZL0-F1-model_v4 ABC transporter permease 0.9753 10 280 GO:0005886
GO:0055085
AF-F7YW59-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.975 13 280 GO:0005886
GO:0071916
AF-A0A0D8HHW1-F1-model_v4 Dipeptide transport system permease protein DppC 0.9742 2 280 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
82.45 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map