F426474

General Info

Members Datasets Scaffolds Average Seq Length
373 280 746 288

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0265655|Ga0496102_0265655_68_1057
Length 329
Sequence MPALWQGLKETSMELHAWDNPMGSDQGRGCKHKDMNTELDPAGQAAFLQSLAEKSGSGQLRGDYSRADAQYVVQQDWQTYTPDQHALWHRLYQRQARLLPGRAVDVYIESLAKLDAQDAIPRLDQVSQSLSAATGWRLVAVPGLVPDQTFFEHLAARRFPVTVWLRKPEEFDYIVEPDIFHDFFGHVPLLFNPVFADHLQEYGKGGLKALPLGGLPFLARLYWYTIEFGLIETPQGLRAYGAGILSSGGEIEYCLSSPKPRRIAFDVERVMRTLYRIDNYQDTYFVIRSFEQLFADTAPDFTPIYARLAQQEPLPADTLLPGERNWQVD

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
132 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
199 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
232 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
233 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
241 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
255 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
256 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
257 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
258 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
259 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
260 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
261 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
262 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
263 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
264 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
265 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
266 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
267 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
268 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
269 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
270 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
271 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
272 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
273 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
274 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
275 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
276 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
277 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
278 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
279 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
280 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.54
Metatranscriptomes 3.22
Isolates 7.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.84
Nodule 1.34
Rhizoplane 3.49
Rhizosphere 64.61
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0265655 3300048905 Bacteria 1618
2 JGI25155J39150_1000249 3300002704 Bacteria 20726
3 JGI25155J39150_1000328 3300002704 Bacteria 15729
4 JGI25156J39149_1000117 3300002705 Bacteria 57700
5 JGI25156J39149_1007989 3300002705 Bacteria 2712
6 JGI25162J39368_1000148 3300002737 Bacteria 76611
7 JGI25162J39368_1005508 3300002737 Bacteria 2452
8 JGI25154J39366_1000107 3300002738 Bacteria 73482
9 JGI25154J39366_1000440 3300002738 Bacteria 22091
10 JGI25157J39369_1000884 3300002741 Bacteria 14427
11 JGI25152J39213_1000870 3300002773 Bacteria 14891
12 JGI25165J46597_1000030 3300003214 Bacteria 305254
13 JGI25153J46596_10001516 3300003215 Bacteria 13844
14 Ga0055538_1000017 3300003751 Bacteria 305254
15 Ga0055538_1000085 3300003751 Bacteria 81616
16 Ga0055539_1000022 3300003752 Bacteria 305254
17 Ga0055539_1000126 3300003752 Bacteria 81616
18 Ga0055533_1000030 3300003756 Bacteria 305254
19 Ga0055533_1000133 3300003756 Bacteria 81616
20 Ga0055532_1000044 3300003758 Bacteria 191110
21 Ga0055525_1000034 3300003759 Bacteria 305254
22 Ga0055525_1000174 3300003759 Bacteria 81616
23 Ga0055526_1001248 3300003771 Bacteria 18239
24 Ga0055541_1000015 3300003841 Bacteria 305254
25 Ga0055541_1000085 3300003841 Bacteria 81616
26 Ga0058862_11680542 3300004803 Unclassified 1038
27 Ga0065165_1006731 3300005262 Bacteria 5895
28 Ga0065707_10014047 3300005295 Bacteria 1762
29 Ga0070677_10025437 3300005333 Bacteria 2210
30 Ga0070666_10242385 3300005335 Bacteria 1275
31 Ga0070682_100013610 3300005337 Bacteria 4685
32 Ga0070660_100001277 3300005339 Bacteria 17163
33 Ga0070687_100024694 3300005343 Bacteria 2874
34 Ga0070674_100000966 3300005356 Bacteria 14966
35 Ga0070674_100049286 3300005356 Bacteria 2895
36 Ga0070659_100001993 3300005366 Bacteria 14596
37 Ga0070700_100080150 3300005441 Bacteria 2106
38 Ga0070694_100430874 3300005444 Bacteria 1038
39 Ga0068867_100000351 3300005459 Bacteria 30618
40 Ga0068867_100172936 3300005459 Bacteria 1712
41 Ga0070679_100052986 3300005530 Bacteria 4039
42 Ga0070684_100130230 3300005535 Bacteria 2269
43 Ga0070672_100004139 3300005543 Bacteria 9469
44 Ga0070695_100100508 3300005545 Bacteria 1947
45 Ga0070693_100093011 3300005547 Bacteria 1822
46 Ga0070704_100314314 3300005549 Bacteria 1310
47 Ga0070704_100523128 3300005549 Bacteria 1033
48 Ga0068855_100212596 3300005563 Bacteria 2172
49 Ga0068857_100074770 3300005577 Bacteria 3020
50 Ga0068854_100004286 3300005578 Bacteria 8988
51 Ga0068852_100070435 3300005616 Bacteria 3068
52 Ga0068852_100151439 3300005616 Bacteria 2157
53 Ga0068866_10177300 3300005718 Bacteria 1256
54 Ga0068851_10109922 3300005834 Bacteria 1470
55 Ga0068862_100002664 3300005844 Bacteria 15712
56 Ga0068862_100034680 3300005844 Bacteria 4271
57 Ga0068862_100094093 3300005844 Bacteria 2613
58 Ga0068862_100123620 3300005844 Bacteria 2283
59 Ga0081538_10001624 3300005981 Bacteria 23039
60 Ga0075368_10004542 3300006042 Bacteria 4716
61 Ga0075363_100013129 3300006048 Bacteria 4006
62 Ga0075367_10056692 3300006178 Bacteria 2328
63 Ga0075366_10004441 3300006195 Bacteria 7526
64 Ga0075366_10257009 3300006195 Bacteria 1066
65 Ga0075370_10028541 3300006353 Bacteria 3102
66 Ga0068871_100025385 3300006358 Bacteria 4610
67 Ga0068871_100136758 3300006358 Bacteria 2081
68 Ga0075431_100377295 3300006847 Bacteria 1422
69 Ga0079104_1005401 3300006946 Bacteria 5117
70 Ga0105251_10020002 3300009011 Bacteria 3523
71 Ga0105240_10015068 3300009093 Bacteria 10523
72 Ga0105240_10235396 3300009093 Bacteria 2125
73 Ga0105240_10483506 3300009093 Bacteria 1380
74 Ga0111539_10000414 3300009094 Bacteria 53486
75 Ga0114129_10170291 3300009147 Bacteria 2970
76 Ga0105243_10011262 3300009148 Bacteria 6765
77 Ga0105238_10000038 3300009551 Bacteria 162920
78 Ga0105238_10129724 3300009551 Bacteria 2499
79 Ga0105249_10105207 3300009553 Bacteria 2660
80 Ga0105239_10003380 3300010375 Bacteria 19579
81 Ga0105239_10121831 3300010375 Bacteria 2897
82 Ga0157374_10028843 3300013296 Bacteria 5018
83 Ga0157380_10009503 3300014326 Bacteria 6971
84 Ga0182008_10012455 3300014497 Bacteria 4490
85 Ga0157377_10000021 3300014745 Bacteria 147105
86 Ga0182006_1001245 3300015261 Bacteria 15773
87 Ga0182007_10009312 3300015262 Bacteria 3969
88 Ga0182005_1000142 3300015265 Bacteria 50650
89 Ga0206356_10709506 3300020070 Bacteria 3102
90 Ga0213872_10000167 3300021361 Bacteria 59191
91 Ga0213872_10005344 3300021361 Bacteria 6628
92 Ga0209435_100004 3300025206 Bacteria 633417
93 Ga0209435_100215 3300025206 Bacteria 16415
94 Ga0209784_100021 3300025224 Bacteria 408534
95 Ga0209784_100034 3300025224 Bacteria 305504
96 Ga0209566_100038 3300025225 Bacteria 305504
97 Ga0209566_100039 3300025225 Bacteria 303368
98 Ga0209674_100036 3300025226 Bacteria 408534
99 Ga0209674_100056 3300025226 Bacteria 305504
100 Ga0209147_100011 3300025229 Bacteria 702140
101 Ga0209563_100040 3300025230 Bacteria 408534
102 Ga0209563_100057 3300025230 Bacteria 305604
103 Ga0207427_102259 3300025231 Bacteria 5392
104 Ga0209437_100071 3300025233 Bacteria 305604
105 Ga0209437_100393 3300025233 Bacteria 42190
106 Ga0209258_100528 3300025242 Bacteria 36442
107 Ga0207425_1000543 3300025245 Bacteria 22472
108 Ga0209646_1000149 3300025246 Bacteria 100004
109 Ga0209646_1000191 3300025246 Bacteria 75546
110 Ga0209646_1000233 3300025246 Bacteria 57776
111 Ga0209026_1000066 3300025250 Bacteria 207691
112 Ga0209026_1002247 3300025250 Bacteria 7411
113 Ga0209026_1003369 3300025250 Bacteria 5293
114 Ga0209677_100023 3300025253 Bacteria 408534
115 Ga0209677_100035 3300025253 Bacteria 305504
116 Ga0209759_1000072 3300025256 Bacteria 178206
117 Ga0209759_1000182 3300025256 Bacteria 102836
118 Ga0209129_1000062 3300025258 Bacteria 240655
119 Ga0209233_1000094 3300025261 Bacteria 305604
120 Ga0209455_1006410 3300025272 Bacteria 3477
121 Ga0209673_1007579 3300025273 Bacteria 4968
122 Ga0209564_1000176 3300025295 Bacteria 152363
123 Ga0209758_1000517 3300025297 Bacteria 61999
124 Ga0209050_1000659 3300025298 Bacteria 53383
125 Ga0209050_1004561 3300025298 Bacteria 9295
126 Ga0209257_1000311 3300025304 Bacteria 103263
127 Ga0207656_10008147 3300025321 Bacteria 3848
128 Ga0207682_10045328 3300025893 Bacteria 1804
129 Ga0207642_10118691 3300025899 Bacteria 1360
130 Ga0207685_10001781 3300025905 Bacteria 4688
131 Ga0207695_10000979 3300025913 Bacteria 50790
132 Ga0207695_10002079 3300025913 Bacteria 30518
133 Ga0207695_10055329 3300025913 Bacteria 4135
134 Ga0207671_10001710 3300025914 Bacteria 24779
135 Ga0207662_10057535 3300025918 Bacteria 2324
136 Ga0207657_10003330 3300025919 Bacteria 17184
137 Ga0207649_10011536 3300025920 Bacteria 4874
138 Ga0207652_10142218 3300025921 Bacteria 2146
139 Ga0207681_10027764 3300025923 Bacteria 3663
140 Ga0207694_10000069 3300025924 Bacteria 124500
141 Ga0207709_10002256 3300025935 Bacteria 12257
142 Ga0207691_10065732 3300025940 Bacteria 3281
143 Ga0207679_10007060 3300025945 Bacteria 7122
144 Ga0207667_10000043 3300025949 Bacteria 261426
145 Ga0207667_10034970 3300025949 Bacteria 5393
146 Ga0207640_10015689 3300025981 Bacteria 4389
147 Ga0207639_10235722 3300026041 Bacteria 1589
148 Ga0207708_10110252 3300026075 Bacteria 2136
149 Ga0207702_10235789 3300026078 Bacteria 1712
150 Ga0207648_10002131 3300026089 Bacteria 21529
151 Ga0207648_10212202 3300026089 Bacteria 1719
152 Ga0207674_10092665 3300026116 Bacteria 3011
153 Ga0207698_10052028 3300026142 Bacteria 3135
154 Ga0207698_10108065 3300026142 Bacteria 2324
155 Ga0209281_1010163 3300027111 Bacteria 2168
156 Ga0209998_10001582 3300027717 Bacteria 5472
157 Ga0207428_10000016 3300027907 Bacteria 327690
158 Ga0268266_10141458 3300028379 Bacteria 2160
159 Ga0268265_10033984 3300028380 Bacteria 3713
160 Ga0268265_10127912 3300028380 Bacteria 2106
161 Ga0307408_100022483 3300031548 Bacteria 4285
162 Ga0307408_100263694 3300031548 Bacteria 1427
163 Ga0316576_10001954 3300031727 Bacteria 11510
164 Ga0316576_10042400 3300031727 Bacteria 3279
165 Ga0316578_10060831 3300031728 Bacteria 2223
166 Ga0307405_10004556 3300031731 Bacteria 6568
167 Ga0316577_10000054 3300031733 Bacteria 26858
168 Ga0316577_10004674 3300031733 Bacteria 7105
169 Ga0307410_10009831 3300031852 Bacteria 5388
170 Ga0307410_10269483 3300031852 Bacteria 1331
171 Ga0307406_10007631 3300031901 Bacteria 6006
172 Ga0307407_10022893 3300031903 Bacteria 3250
173 Ga0307409_100126347 3300031995 Bacteria 2176
174 Ga0307409_100144079 3300031995 Bacteria 2057
175 Ga0307416_100025717 3300032002 Bacteria 4322
176 Ga0307411_10013977 3300032005 Bacteria 4452
177 Ga0307415_100044179 3300032126 Bacteria 2977
178 Ga0307415_100316336 3300032126 Bacteria 1300
179 Ga0316585_10013416 3300032137 Bacteria 2438
180 Ga0316585_10053068 3300032137 Bacteria 1303
181 Ga0316580_10001431 3300032139 Bacteria 6230
182 Ga0373953_0069253 3300035117 Bacteria 1453
183 Ga0373955_0158353 3300035172 Bacteria 1335
184 Ga0316574_0213017 3300035398 Bacteria 1239
185 Ga0373931_0170729 3300035691 Bacteria 1281
186 Ga0373935_0317233 3300035692 Bacteria 1105
187 Ga0373937_0032190 3300036401 Bacteria 4756
188 Ga0373937_0281014 3300036401 Bacteria 1572
189 Ga0316582_0002216 3300036647 Bacteria 9025
190 Ga0316582_0032067 3300036647 Bacteria 3216
191 Ga0316582_0207674 3300036647 Bacteria 1337
192 Ga0316584_0000692 3300036712 Bacteria 18615
193 Ga0316584_0010560 3300036712 Bacteria 6459
194 Ga0316584_0360073 3300036712 Bacteria 1043
195 Ga0373925_0225177 3300037068 Bacteria 1498
196 Ga0395899_0007787 3300037312 Bacteria 8261
197 Ga0395899_0010535 3300037312 Bacteria 7081
198 Ga0395899_0040279 3300037312 Bacteria 3494
199 Ga0395900_0013363 3300037418 Bacteria 8391
200 Ga0395898_0117634 3300037466 Bacteria 2546
201 Ga0395905_0000833 3300037471 Bacteria 40272
202 Ga0395905_0003488 3300037471 Bacteria 16795
203 Ga0395905_0021876 3300037471 Bacteria 6048
204 Ga0395905_0049542 3300037471 Bacteria 3936
205 Ga0395905_0109830 3300037471 Bacteria 2589
206 Ga0395905_0198756 3300037471 Bacteria 1880
207 Ga0395901_0001622 3300038443 Bacteria 23269
208 Ga0395901_0510014 3300038443 Bacteria 1223
209 Ga0436361_0043634 3300039447 Bacteria 18783
210 Ga0436361_0432344 3300039447 Bacteria 27994
211 Ga0436361_0568676 3300039447 Bacteria 1921
212 Ga0451793_1234661 3300041452 Bacteria 1972
213 Ga0451795_0462472 3300041456 Bacteria 2768
214 Ga0451853_1856781 3300041512 Bacteria 1996
215 Ga0451577_0002993 3300042876 Bacteria 19258
216 Ga0451577_0011124 3300042876 Bacteria 8538
217 Ga0451577_0015253 3300042876 Bacteria 7150
218 Ga0466972_0000072 3300044658 Bacteria 98587
219 Ga0466965_0002518 3300044683 Bacteria 7810
220 Ga0466966_0011579 3300044684 Bacteria 5848
221 Ga0466964_0028272 3300044706 Bacteria 2208
222 Ga0453684_0065945 3300044712 Bacteria 4613
223 Ga0453684_0328757 3300044712 Bacteria 1729
224 Ga0466968_0055482 3300044735 Bacteria 1700
225 Ga0466959_0169457 3300045049 Bacteria 1532
226 Ga0451576_0003062 3300045051 Bacteria 23512
227 Ga0451576_0079541 3300045051 Bacteria 3411
228 Ga0495592_0036104 3300046454 Bacteria 3723
229 Ga0495592_0059111 3300046454 Bacteria 2825
230 Ga0495651_0131704 3300046462 Bacteria 1824
231 Ga0495653_0181741 3300046463 Bacteria 1443
232 Ga0495608_0015491 3300046511 Bacteria 5287
233 Ga0495628_0001234 3300046516 Bacteria 23412
234 Ga0495628_0003718 3300046516 Bacteria 13583
235 Ga0495632_0005528 3300046519 Bacteria 8334
236 Ga0495643_0038962 3300046522 Bacteria 2600
237 Ga0495642_0014411 3300046528 Bacteria 3063
238 Ga0495652_0119503 3300046529 Bacteria 2104
239 Ga0495598_0005514 3300046537 Bacteria 2809
240 Ga0495598_0031788 3300046537 Bacteria 1487
241 Ga0495621_0006178 3300046539 Bacteria 3482
242 Ga0495621_0014182 3300046539 Bacteria 2517
243 Ga0495597_0007383 3300046542 Bacteria 5587
244 Ga0495645_0130989 3300046543 Bacteria 1757
245 Ga0495668_0030967 3300046616 Bacteria 3016
246 Ga0495625_0002966 3300046660 Bacteria 17641
247 Ga0495661_0001459 3300046665 Bacteria 19793
248 Ga0495588_0204904 3300046674 Bacteria 1042
249 Ga0495599_0020918 3300046678 Bacteria 4078
250 Ga0495646_0004580 3300046680 Bacteria 8715
251 Ga0495646_0174383 3300046680 Bacteria 1183
252 Ga0495658_0175941 3300046683 Bacteria 1326
253 Ga0495624_0055172 3300046690 Bacteria 2504
254 Ga0495670_0233251 3300046691 Bacteria 979
255 Ga0495600_0014820 3300046809 Bacteria 4917
256 Ga0495604_0056378 3300047317 Bacteria 3025
257 Ga0495672_0077445 3300047320 Bacteria 1864
258 Ga0495687_020212 3300047443 Bacteria 3249
259 Ga0495602_0146789 3300048088 Bacteria 1859
260 Ga0496100_0194369 3300048903 Bacteria 1475
261 Ga0496102_0008616 3300048905 Bacteria 8752
262 Ga0496102_0095218 3300048905 Bacteria 2759
263 Ga0496104_0015271 3300048907 Bacteria 6954
264 Ga0496108_0054164 3300048911 Bacteria 3367
265 Ga0496110_0041946 3300048913 Bacteria 3994
266 Ga0496110_0133826 3300048913 Bacteria 2240
267 Ga0496110_0134330 3300048913 Bacteria 2235
268 Ga0496111_0051900 3300048914 Bacteria 2961
269 Ga0496111_0273018 3300048914 Bacteria 1254
270 Ga0496116_0067297 3300048919 Bacteria 2288
271 Ga0496118_0092377 3300048921 Bacteria 2077
272 Ga0496122_0003149 3300048925 Bacteria 22078
273 Ga0496123_0000916 3300048926 Bacteria 46316
274 Ga0496124_0000079 3300048927 Bacteria 212057
275 Ga0496125_0004292 3300048928 Bacteria 16553
276 Ga0496125_0058328 3300048928 Bacteria 3119
277 Ga0496125_0063017 3300048928 Bacteria 2960
278 Ga0501292_003072 3300049515 Bacteria 2203
279 Ga0501303_003364 3300049526 Bacteria 1280
280 Ga0501031_0030917 3300049568 Bacteria 3493
281 Ga0501032_0203183 3300049569 Bacteria 1293
282 Ga0501033_0154557 3300049570 Bacteria 1654
283 Ga0501034_0109466 3300049571 Bacteria 2754
284 Ga0501036_0101862 3300049572 Bacteria 2429
285 Ga0501037_0011050 3300049573 Bacteria 6641
286 Ga0501037_0385930 3300049573 Bacteria 962
287 Ga0501039_0036052 3300049575 Bacteria 3816
288 Ga0501042_0078371 3300049578 Bacteria 2366
289 Ga0501048_0033962 3300049582 Bacteria 3683
290 Ga0501071_0062862 3300049587 Bacteria 2690
291 Ga0501072_0001025 3300049588 Bacteria 20707
292 Ga0501072_0145902 3300049588 Bacteria 1887
293 Ga0501072_0322878 3300049588 Bacteria 1227
294 Ga0501075_0278531 3300049591 Bacteria 1274
295 Ga0501076_0019040 3300049592 Bacteria 5238
296 Ga0501206_001282 3300049653 Bacteria 3143
297 Ga0501080_0032893 3300049742 Bacteria 4839
298 Ga0501080_0100258 3300049742 Bacteria 2687
299 Ga0501265_004961 3300049762 Bacteria 1527
300 Ga0501035_0122013 3300049822 Bacteria 2277
301 Ga0501044_0255031 3300049823 Bacteria 1694
302 Ga0501045_0036918 3300049824 Bacteria 3550
303 nmdc:mga03683_9626_c1 3300050489 Bacteria 3445
304 nmdc:mga03n38_21969_c1 3300050490 Bacteria 2575
305 nmdc:mga00v17_42811_c1 3300050491 Bacteria 2725
306 nmdc:mga0k408_118411_c1 3300050493 Bacteria 1568
307 nmdc:mga0k408_1717_c1 3300050493 Bacteria 11760
308 nmdc:mga0k408_87229_c1 3300050493 Bacteria 1833
309 nmdc:mga06z11_130285_c1 3300050494 Bacteria 1412
310 nmdc:mga04h51_24257_c1 3300050495 Bacteria 1856
311 nmdc:mga07m45_10343_c2 3300050496 Bacteria 3522
312 nmdc:mga07m45_11661_c1 3300050496 Bacteria 4623
313 nmdc:mga05p37_198110_c1 3300050507 Bacteria 2434
314 nmdc:mga0qj67_31974_c1 3300050509 Bacteria 4102
315 nmdc:mga06r32_287344_c1 3300050510 Bacteria 1631
316 nmdc:mga06r32_402950_c1 3300050510 Bacteria 1350
317 nmdc:mga08y16_32_c1 3300050511 Bacteria 179220
318 nmdc:mga08y16_397607_c1 3300050511 Bacteria 1411
319 nmdc:mga0sz30_16196_c1 3300050516 Bacteria 2956
320 Ga0500644_0014110 3300053088 Bacteria 2248
321 Ga0500646_0000352 3300053090 Bacteria 13806
322 Ga0500646_0002024 3300053090 Bacteria 5293
323 Ga0500583_0139004 3300053092 Bacteria 1206
324 Ga0500595_001757 3300053119 Bacteria 11289
325 Ga0500618_001461 3300053125 Bacteria 10499
326 Ga0500618_002540 3300053125 Bacteria 6792
327 Ga0500642_0043930 3300053130 Bacteria 1943
328 Ga0500655_006189 3300053133 Bacteria 2157
329 Ga0500655_011729 3300053133 Bacteria 1590
330 Ga0500604_0000610 3300053151 Bacteria 9805
331 Ga0500616_0075622 3300053153 Bacteria 1704
332 Ga0500619_000378 3300053154 Bacteria 8293
333 Ga0500622_0000313 3300053156 Bacteria 49365
334 Ga0501084_0010649 3300054114 Bacteria 7611
335 Ga0587084_001227 3300059477 Bacteria 2382
336 Ga0587066_008663 3300059490 Bacteria 1419
337 Ga0587077_007493 3300059493 Bacteria 1592
338 Ga0587083_0007286 3300059505 Bacteria 1687
339 Ga0587091_002064 3300059511 Bacteria 2313
340 Ga0587072_008713 3300059643 Bacteria 1612
341 Ga0587079_002142 3300059647 Bacteria 2368
342 Ga0587079_007184 3300059647 Bacteria 1656
343 Ga0587102_002555 3300059649 Bacteria 1417
344 Ga0587071_002570 3300060344 Bacteria 2482
345 Ga0501082_0047974 3300060353 Bacteria 3681
346 Ga0530510_0002516 3300061734 Bacteria 12592
347 2511249577 2511231003 Bacteria 5606035
348 2511384032 2511231026 Bacteria 5225445
349 2521560221 2521172590 Bacteria 5047645
350 2550695359 2548876994 Bacteria 4904866
351 2553005023 2551306416 Bacteria 6152985
352 2644027073 2643221603 Bacteria 6147767
353 2765571388 2765235838 Bacteria 5445269
354 2808982444 2808606386 Bacteria 4471946
355 2809129729 2808606415 Bacteria 4576710
356 2809149216 2808606419 Bacteria 4576925
357 2819592946 2818991445 Bacteria 4955017
358 2819616578 2818991449 Bacteria 5518009
359 2839099229 2839094727 Bacteria 5534556
360 2852619357 2852618963 Bacteria 4577824
361 2884812072 2884811622 Bacteria 5552861
362 2884838542 2884836552 Bacteria 5219991
363 2884854833 2884852848 Bacteria 5221161
364 2896156498 2896154374 Bacteria 5221518
365 2904440738 2904439833 Bacteria 5931679
366 2904535337 2904530477 Bacteria 5876334
367 2904589184 2904584206 Bacteria 6028872
368 2904594598 2904589729 Bacteria 6113573
369 2904605825 2904601388 Bacteria 5884906
370 2919048903 2919046199 Bacteria 5567169
371 2919084092 2919079590 Bacteria 5946433
372 2923513974 2923510766 Bacteria 5926163
373 2928134752 2928130867 Bacteria 5467269
374 Ga0496102_0265655
375 JGI25155J39150_1000249
376 JGI25155J39150_1000328
377 JGI25156J39149_1000117
378 JGI25156J39149_1007989
379 JGI25162J39368_1000148
380 JGI25162J39368_1005508
381 JGI25154J39366_1000107
382 JGI25154J39366_1000440
383 JGI25157J39369_1000884
384 JGI25152J39213_1000870
385 JGI25165J46597_1000030
386 JGI25153J46596_10001516
387 Ga0055538_1000017
388 Ga0055538_1000085
389 Ga0055539_1000022
390 Ga0055539_1000126
391 Ga0055533_1000030
392 Ga0055533_1000133
393 Ga0055532_1000044
394 Ga0055525_1000034
395 Ga0055525_1000174
396 Ga0055526_1001248
397 Ga0055541_1000015
398 Ga0055541_1000085
399 Ga0058862_11680542
400 Ga0065165_1006731
401 Ga0065707_10014047
402 Ga0070677_10025437
403 Ga0070666_10242385
404 Ga0070682_100013610
405 Ga0070660_100001277
406 Ga0070687_100024694
407 Ga0070674_100000966
408 Ga0070674_100049286
409 Ga0070659_100001993
410 Ga0070700_100080150
411 Ga0070694_100430874
412 Ga0068867_100000351
413 Ga0068867_100172936
414 Ga0070679_100052986
415 Ga0070684_100130230
416 Ga0070672_100004139
417 Ga0070695_100100508
418 Ga0070693_100093011
419 Ga0070704_100314314
420 Ga0070704_100523128
421 Ga0068855_100212596
422 Ga0068857_100074770
423 Ga0068854_100004286
424 Ga0068852_100070435
425 Ga0068852_100151439
426 Ga0068866_10177300
427 Ga0068851_10109922
428 Ga0068862_100002664
429 Ga0068862_100034680
430 Ga0068862_100094093
431 Ga0068862_100123620
432 Ga0081538_10001624
433 Ga0075368_10004542
434 Ga0075363_100013129
435 Ga0075367_10056692
436 Ga0075366_10004441
437 Ga0075366_10257009
438 Ga0075370_10028541
439 Ga0068871_100025385
440 Ga0068871_100136758
441 Ga0075431_100377295
442 Ga0079104_1005401
443 Ga0105251_10020002
444 Ga0105240_10015068
445 Ga0105240_10235396
446 Ga0105240_10483506
447 Ga0111539_10000414
448 Ga0114129_10170291
449 Ga0105243_10011262
450 Ga0105238_10000038
451 Ga0105238_10129724
452 Ga0105249_10105207
453 Ga0105239_10003380
454 Ga0105239_10121831
455 Ga0157374_10028843
456 Ga0157380_10009503
457 Ga0182008_10012455
458 Ga0157377_10000021
459 Ga0182006_1001245
460 Ga0182007_10009312
461 Ga0182005_1000142
462 Ga0206356_10709506
463 Ga0213872_10000167
464 Ga0213872_10005344
465 Ga0209435_100004
466 Ga0209435_100215
467 Ga0209784_100021
468 Ga0209784_100034
469 Ga0209566_100038
470 Ga0209566_100039
471 Ga0209674_100036
472 Ga0209674_100056
473 Ga0209147_100011
474 Ga0209563_100040
475 Ga0209563_100057
476 Ga0207427_102259
477 Ga0209437_100071
478 Ga0209437_100393
479 Ga0209258_100528
480 Ga0207425_1000543
481 Ga0209646_1000149
482 Ga0209646_1000191
483 Ga0209646_1000233
484 Ga0209026_1000066
485 Ga0209026_1002247
486 Ga0209026_1003369
487 Ga0209677_100023
488 Ga0209677_100035
489 Ga0209759_1000072
490 Ga0209759_1000182
491 Ga0209129_1000062
492 Ga0209233_1000094
493 Ga0209455_1006410
494 Ga0209673_1007579
495 Ga0209564_1000176
496 Ga0209758_1000517
497 Ga0209050_1000659
498 Ga0209050_1004561
499 Ga0209257_1000311
500 Ga0207656_10008147
501 Ga0207682_10045328
502 Ga0207642_10118691
503 Ga0207685_10001781
504 Ga0207695_10000979
505 Ga0207695_10002079
506 Ga0207695_10055329
507 Ga0207671_10001710
508 Ga0207662_10057535
509 Ga0207657_10003330
510 Ga0207649_10011536
511 Ga0207652_10142218
512 Ga0207681_10027764
513 Ga0207694_10000069
514 Ga0207709_10002256
515 Ga0207691_10065732
516 Ga0207679_10007060
517 Ga0207667_10000043
518 Ga0207667_10034970
519 Ga0207640_10015689
520 Ga0207639_10235722
521 Ga0207708_10110252
522 Ga0207702_10235789
523 Ga0207648_10002131
524 Ga0207648_10212202
525 Ga0207674_10092665
526 Ga0207698_10052028
527 Ga0207698_10108065
528 Ga0209281_1010163
529 Ga0209998_10001582
530 Ga0207428_10000016
531 Ga0268266_10141458
532 Ga0268265_10033984
533 Ga0268265_10127912
534 Ga0307408_100022483
535 Ga0307408_100263694
536 Ga0316576_10001954
537 Ga0316576_10042400
538 Ga0316578_10060831
539 Ga0307405_10004556
540 Ga0316577_10000054
541 Ga0316577_10004674
542 Ga0307410_10009831
543 Ga0307410_10269483
544 Ga0307406_10007631
545 Ga0307407_10022893
546 Ga0307409_100126347
547 Ga0307409_100144079
548 Ga0307416_100025717
549 Ga0307411_10013977
550 Ga0307415_100044179
551 Ga0307415_100316336
552 Ga0316585_10013416
553 Ga0316585_10053068
554 Ga0316580_10001431
555 Ga0373953_0069253
556 Ga0373955_0158353
557 Ga0316574_0213017
558 Ga0373931_0170729
559 Ga0373935_0317233
560 Ga0373937_0032190
561 Ga0373937_0281014
562 Ga0316582_0002216
563 Ga0316582_0032067
564 Ga0316582_0207674
565 Ga0316584_0000692
566 Ga0316584_0010560
567 Ga0316584_0360073
568 Ga0373925_0225177
569 Ga0395899_0007787
570 Ga0395899_0010535
571 Ga0395899_0040279
572 Ga0395900_0013363
573 Ga0395898_0117634
574 Ga0395905_0000833
575 Ga0395905_0003488
576 Ga0395905_0021876
577 Ga0395905_0049542
578 Ga0395905_0109830
579 Ga0395905_0198756
580 Ga0395901_0001622
581 Ga0395901_0510014
582 Ga0436361_0043634
583 Ga0436361_0432344
584 Ga0436361_0568676
585 Ga0451793_1234661
586 Ga0451795_0462472
587 Ga0451853_1856781
588 Ga0451577_0002993
589 Ga0451577_0011124
590 Ga0451577_0015253
591 Ga0466972_0000072
592 Ga0466965_0002518
593 Ga0466966_0011579
594 Ga0466964_0028272
595 Ga0453684_0065945
596 Ga0453684_0328757
597 Ga0466968_0055482
598 Ga0466959_0169457
599 Ga0451576_0003062
600 Ga0451576_0079541
601 Ga0495592_0036104
602 Ga0495592_0059111
603 Ga0495651_0131704
604 Ga0495653_0181741
605 Ga0495608_0015491
606 Ga0495628_0001234
607 Ga0495628_0003718
608 Ga0495632_0005528
609 Ga0495643_0038962
610 Ga0495642_0014411
611 Ga0495652_0119503
612 Ga0495598_0005514
613 Ga0495598_0031788
614 Ga0495621_0006178
615 Ga0495621_0014182
616 Ga0495597_0007383
617 Ga0495645_0130989
618 Ga0495668_0030967
619 Ga0495625_0002966
620 Ga0495661_0001459
621 Ga0495588_0204904
622 Ga0495599_0020918
623 Ga0495646_0004580
624 Ga0495646_0174383
625 Ga0495658_0175941
626 Ga0495624_0055172
627 Ga0495670_0233251
628 Ga0495600_0014820
629 Ga0495604_0056378
630 Ga0495672_0077445
631 Ga0495687_020212
632 Ga0495602_0146789
633 Ga0496100_0194369
634 Ga0496102_0008616
635 Ga0496102_0095218
636 Ga0496104_0015271
637 Ga0496108_0054164
638 Ga0496110_0041946
639 Ga0496110_0133826
640 Ga0496110_0134330
641 Ga0496111_0051900
642 Ga0496111_0273018
643 Ga0496116_0067297
644 Ga0496118_0092377
645 Ga0496122_0003149
646 Ga0496123_0000916
647 Ga0496124_0000079
648 Ga0496125_0004292
649 Ga0496125_0058328
650 Ga0496125_0063017
651 Ga0501292_003072
652 Ga0501303_003364
653 Ga0501031_0030917
654 Ga0501032_0203183
655 Ga0501033_0154557
656 Ga0501034_0109466
657 Ga0501036_0101862
658 Ga0501037_0011050
659 Ga0501037_0385930
660 Ga0501039_0036052
661 Ga0501042_0078371
662 Ga0501048_0033962
663 Ga0501071_0062862
664 Ga0501072_0001025
665 Ga0501072_0145902
666 Ga0501072_0322878
667 Ga0501075_0278531
668 Ga0501076_0019040
669 Ga0501206_001282
670 Ga0501080_0032893
671 Ga0501080_0100258
672 Ga0501265_004961
673 Ga0501035_0122013
674 Ga0501044_0255031
675 Ga0501045_0036918
676 nmdc:mga03683_9626_c1
677 nmdc:mga03n38_21969_c1
678 nmdc:mga00v17_42811_c1
679 nmdc:mga0k408_118411_c1
680 nmdc:mga0k408_1717_c1
681 nmdc:mga0k408_87229_c1
682 nmdc:mga06z11_130285_c1
683 nmdc:mga04h51_24257_c1
684 nmdc:mga07m45_10343_c2
685 nmdc:mga07m45_11661_c1
686 nmdc:mga05p37_198110_c1
687 nmdc:mga0qj67_31974_c1
688 nmdc:mga06r32_287344_c1
689 nmdc:mga06r32_402950_c1
690 nmdc:mga08y16_32_c1
691 nmdc:mga08y16_397607_c1
692 nmdc:mga0sz30_16196_c1
693 Ga0500644_0014110
694 Ga0500646_0000352
695 Ga0500646_0002024
696 Ga0500583_0139004
697 Ga0500595_001757
698 Ga0500618_001461
699 Ga0500618_002540
700 Ga0500642_0043930
701 Ga0500655_006189
702 Ga0500655_011729
703 Ga0500604_0000610
704 Ga0500616_0075622
705 Ga0500619_000378
706 Ga0500622_0000313
707 Ga0501084_0010649
708 Ga0587084_001227
709 Ga0587066_008663
710 Ga0587077_007493
711 Ga0587083_0007286
712 Ga0587091_002064
713 Ga0587072_008713
714 Ga0587079_002142
715 Ga0587079_007184
716 Ga0587102_002555
717 Ga0587071_002570
718 Ga0501082_0047974
719 Ga0530510_0002516
720 2511249577
721 2511384032
722 2521560221
723 2550695359
724 2553005023
725 2644027073
726 2765571388
727 2808982444
728 2809129729
729 2809149216
730 2819592946
731 2819616578
732 2839099229
733 2852619357
734 2884812072
735 2884838542
736 2884854833
737 2896156498
738 2904440738
739 2904535337
740 2904589184
741 2904594598
742 2904605825
743 2919048903
744 2919084092
745 2923513974
746 2928134752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00351

Biopterin_H

Biopterin-dependent aromatic amino acid hydroxylase

63

302

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bpt-assembly4.cif.gz_D structural and thermodynamic insight into phenylalanine hydroxylase from the human pathogen legionella pneumophila 0.9384 43 282
4bpt-assembly3.cif.gz_C structural and thermodynamic insight into phenylalanine hydroxylase from the human pathogen legionella pneumophila 0.9373 51 282
4jpx-assembly1.cif.gz_A crystal structure of phenylalanine hydroxylase s203p mutant from chromobacterium violaceum 0.9349 14 293
3tk4-assembly1.cif.gz_A crystal structure of phenylalanine hydroxylase from chromobacterium violaceum bound to cobalt 0.9334 14 293
4etl-assembly1.cif.gz_A crystallographic structure of phenylalanine hydroxylase from chromobacterium violaceum f258a mutation 0.9319 14 293
ID Description Score Start End Superfamily
4bptC00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.9373 51 282 1.10.800.10
1ltzA00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.9301 14 293 1.10.800.10
4bptC00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.9216 51 282 1.10.800.10
1ltzA00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.9103 14 293 1.10.800.10
2v28B00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.9082 35 281 1.10.800.10
ID Description Score Start End GO Terms
AF-A0A537D9C1-F1-model_v4 Phenylalanine-4-hydroxylase (EC 1.14.16.1) (Phe-4-monooxygenase) 0.9932 23 277 GO:0004505
GO:0005506
GO:0006559
AF-A0A2S9H2J2-F1-model_v4 phenylalanine 4-monooxygenase (EC 1.14.16.1) (Phe-4-monooxygenase) 0.9923 6 292 GO:0004505
GO:0005506
GO:0006559
AF-A0A840RUU3-F1-model_v4 Phenylalanine-4-hydroxylase (EC 1.14.16.1) (Phe-4-monooxygenase) 0.9912 6 294 GO:0004505
GO:0005506
GO:0006559
AF-A0A2V7VRJ2-F1-model_v4 Phenylalanine 4-monooxygenase 0.9888 23 128 GO:0005506
GO:0009072
GO:0016714
AF-A0A239CG80-F1-model_v4 Phenylalanine-4-hydroxylase (EC 1.14.16.1) (Phe-4-monooxygenase) 0.9871 1 296 GO:0004505
GO:0005506
GO:0006559

Map