F426593

General Info

Members Datasets Scaffolds Average Seq Length
374 186 748 155

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10003561|Ga0070676_100035611
Length 174
Sequence MHNGQELLNWPAFSVIHYLRMPKLSAGILVYRVKNKEIEVFLCHPGGPFYKNKDNGVWTIPKGEFDENEEAFAAAKREFKEETGQEIRGDFIPMRPIRYKDGKKIVYAWAVNGNIDATNIKSNTFPLEWPPKSGKFMEVPEVDRGGWFNIEVAKQKILPSLSLLLEDLVENVSR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
181 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 1.07
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 16.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10003561 3300005328 Bacteria 8146
2 Ga0065715_10385838 3300005293 Unclassified 901
3 Ga0065707_10112682 3300005295 Bacteria 2352
4 Ga0070676_10007326 3300005328 Bacteria 5919
5 Ga0070683_100000327 3300005329 Bacteria 32861
6 Ga0070683_100047705 3300005329 Bacteria 3958
7 Ga0070683_100065898 3300005329 Bacteria 3373
8 Ga0070683_100506244 3300005329 Bacteria 1154
9 Ga0070683_101048606 3300005329 Bacteria 783
10 Ga0070683_101099796 3300005329 Bacteria 763
11 Ga0070690_100256042 3300005330 Unclassified 1240
12 Ga0070670_100031189 3300005331 Bacteria 4590
13 Ga0070670_100170772 3300005331 Bacteria 1886
14 Ga0068869_100004762 3300005334 Bacteria 8468
15 Ga0068869_100079023 3300005334 Bacteria 2451
16 Ga0068869_100082645 3300005334 Bacteria 2401
17 Ga0068869_100089639 3300005334 Bacteria 2310
18 Ga0070666_10060519 3300005335 Unclassified 2563
19 Ga0070666_10239028 3300005335 Bacteria 1284
20 Ga0070666_10553267 3300005335 Bacteria 837
21 Ga0070682_100062927 3300005337 Bacteria 2351
22 Ga0070682_100265603 3300005337 Archaea 1244
23 Ga0068868_100001123 3300005338 Bacteria 18309
24 Ga0068868_100133722 3300005338 Bacteria 2031
25 Ga0070689_100039628 3300005340 Bacteria 3609
26 Ga0070689_100042612 3300005340 Bacteria 3485
27 Ga0070689_100322178 3300005340 Bacteria 1291
28 Ga0070689_100458379 3300005340 Bacteria 1086
29 Ga0070689_101261280 3300005340 Bacteria 665
30 Ga0070687_100004644 3300005343 Bacteria 5489
31 Ga0070661_100001196 3300005344 Bacteria 18334
32 Ga0070661_100006373 3300005344 Bacteria 8139
33 Ga0070661_100253416 3300005344 Bacteria 1359
34 Ga0070668_100044928 3300005347 Bacteria 3389
35 Ga0070669_100877253 3300005353 Unclassified 765
36 Ga0070675_100048368 3300005354 Bacteria 3487
37 Ga0070675_100085838 3300005354 Bacteria 2630
38 Ga0070675_100352563 3300005354 Bacteria 1305
39 Ga0070671_100065215 3300005355 Bacteria 3033
40 Ga0070671_100250193 3300005355 Unclassified 1505
41 Ga0070671_100475885 3300005355 Bacteria 1073
42 Ga0070671_100513676 3300005355 Bacteria 1031
43 Ga0070671_100631503 3300005355 Bacteria 927
44 Ga0070674_101081394 3300005356 Bacteria 707
45 Ga0070673_100041208 3300005364 Bacteria 3549
46 Ga0070673_100123089 3300005364 Bacteria 2167
47 Ga0070673_100264352 3300005364 Bacteria 1504
48 Ga0070688_100030527 3300005365 Bacteria 3236
49 Ga0070688_100035603 3300005365 Bacteria 3025
50 Ga0070688_100075619 3300005365 Bacteria 2165
51 Ga0070688_100512537 3300005365 Bacteria 906
52 Ga0070659_100002952 3300005366 Bacteria 12126
53 Ga0070667_100024615 3300005367 Bacteria 5001
54 Ga0070667_100260148 3300005367 Bacteria 1554
55 Ga0070667_100917018 3300005367 Bacteria 816
56 Ga0070709_10744550 3300005434 Bacteria 765
57 Ga0070701_10276808 3300005438 Bacteria 1023
58 Ga0070701_10342461 3300005438 Bacteria 931
59 Ga0070708_100111088 3300005445 Bacteria 2519
60 Ga0070663_100059505 3300005455 Bacteria 2745
61 Ga0070678_100067398 3300005456 Bacteria 2664
62 Ga0070662_100018489 3300005457 Bacteria 4715
63 Ga0070662_100088366 3300005457 Bacteria 2322
64 Ga0070662_100716941 3300005457 Bacteria 847
65 Ga0068867_100055040 3300005459 Bacteria 2940
66 Ga0070685_10054358 3300005466 Bacteria 2323
67 Ga0070685_10217511 3300005466 Bacteria 1250
68 Ga0070706_100195567 3300005467 Unclassified 1889
69 Ga0070706_100596539 3300005467 Bacteria 1026
70 Ga0070707_100067112 3300005468 Unclassified 3450
71 Ga0070707_100089011 3300005468 Unclassified 2987
72 Ga0070679_100095496 3300005530 Bacteria 2960
73 Ga0070684_100000290 3300005535 Bacteria 34902
74 Ga0070684_100014260 3300005535 Bacteria 6432
75 Ga0070684_100069315 3300005535 Unclassified 3102
76 Ga0070684_102022711 3300005535 Bacteria 544
77 Ga0070697_100044119 3300005536 Bacteria 3611
78 Ga0068853_100000837 3300005539 Bacteria 21517
79 Ga0068853_100139992 3300005539 Unclassified 2172
80 Ga0068853_100165057 3300005539 Bacteria 2001
81 Ga0068853_101065200 3300005539 Bacteria 779
82 Ga0068853_101380764 3300005539 Bacteria 681
83 Ga0070672_100708401 3300005543 Bacteria 882
84 Ga0070686_100042877 3300005544 Bacteria 2836
85 Ga0070686_100166374 3300005544 Bacteria 1556
86 Ga0070686_100345842 3300005544 Bacteria 1116
87 Ga0070693_100758166 3300005547 Bacteria 716
88 Ga0070665_100308500 3300005548 Bacteria 1586
89 Ga0070665_100998826 3300005548 Bacteria 849
90 Ga0070704_100178262 3300005549 Unclassified 1697
91 Ga0068855_100115577 3300005563 Bacteria 3076
92 Ga0070664_100000509 3300005564 Bacteria 29514
93 Ga0070664_100005422 3300005564 Bacteria 10239
94 Ga0070664_100091591 3300005564 Bacteria 2632
95 Ga0070664_100196571 3300005564 Bacteria 1798
96 Ga0070664_100304353 3300005564 Bacteria 1441
97 Ga0070664_100360707 3300005564 Bacteria 1323
98 Ga0070664_100369247 3300005564 Bacteria 1308
99 Ga0070664_100509413 3300005564 Bacteria 1110
100 Ga0068857_100000579 3300005577 Bacteria 26747
101 Ga0068857_100146913 3300005577 Bacteria 2133
102 Ga0068857_100182538 3300005577 Bacteria 1910
103 Ga0068854_100129860 3300005578 Bacteria 1923
104 Ga0070702_100892435 3300005615 Bacteria 695
105 Ga0068852_100069417 3300005616 Bacteria 3089
106 Ga0068852_101610522 3300005616 Bacteria 672
107 Ga0068859_100072558 3300005617 Bacteria 3479
108 Ga0068859_100106689 3300005617 Bacteria 2860
109 Ga0068859_100158012 3300005617 Bacteria 2345
110 Ga0068864_100038625 3300005618 Bacteria 4078
111 Ga0068864_100608992 3300005618 Bacteria 1061
112 Ga0068864_100634530 3300005618 Unclassified 1039
113 Ga0068866_10102031 3300005718 Bacteria 1585
114 Ga0068866_10165857 3300005718 Bacteria 1292
115 Ga0068861_100742765 3300005719 Bacteria 916
116 Ga0068861_101476661 3300005719 Unclassified 666
117 Ga0068851_10048940 3300005834 Bacteria 2143
118 Ga0068851_10080304 3300005834 Bacteria 1702
119 Ga0068870_10211699 3300005840 Bacteria 1181
120 Ga0068870_10892456 3300005840 Bacteria 627
121 Ga0068863_100093742 3300005841 Unclassified 2849
122 Ga0068863_100273900 3300005841 Bacteria 1634
123 Ga0068863_100309637 3300005841 Bacteria 1533
124 Ga0068858_100041342 3300005842 Bacteria 4275
125 Ga0068858_100157878 3300005842 Bacteria 2134
126 Ga0068858_100240604 3300005842 Bacteria 1717
127 Ga0068858_100673120 3300005842 Bacteria 1006
128 Ga0068862_101589032 3300005844 Bacteria 661
129 Ga0081539_10331905 3300005985 Bacteria 644
130 Ga0070717_10053471 3300006028 Unclassified 3329
131 Ga0070717_10314762 3300006028 Unclassified 1394
132 Ga0070717_10567857 3300006028 Unclassified 1028
133 Ga0070716_100923013 3300006173 Unclassified 685
134 Ga0068871_100156174 3300006358 Unclassified 1948
135 Ga0068871_100350147 3300006358 Bacteria 1306
136 Ga0068871_100531484 3300006358 Bacteria 1063
137 Ga0075434_101501839 3300006871 Bacteria 683
138 Ga0068865_100089857 3300006881 Bacteria 2226
139 Ga0068865_100343040 3300006881 Unclassified 1208
140 Ga0068865_100671716 3300006881 Bacteria 882
141 Ga0068865_100960987 3300006881 Bacteria 746
142 Ga0075436_100047892 3300006914 Bacteria 2949
143 Ga0075436_100711448 3300006914 Unclassified 744
144 Ga0097620_100072554 3300006931 Bacteria 3479
145 Ga0097620_100106695 3300006931 Bacteria 2860
146 Ga0097620_100158004 3300006931 Bacteria 2345
147 Ga0075435_100291670 3300007076 Bacteria 1394
148 Ga0075435_100885883 3300007076 Unclassified 778
149 Ga0105251_10056345 3300009011 Bacteria 1860
150 Ga0105240_10000011 3300009093 Bacteria 523646
151 Ga0105247_10174303 3300009101 Bacteria 1432
152 Ga0105241_10649052 3300009174 Bacteria 958
153 Ga0105242_10025593 3300009176 Bacteria 4671
154 Ga0105242_10068152 3300009176 Bacteria 2943
155 Ga0105242_10212518 3300009176 Bacteria 1725
156 Ga0105242_10851847 3300009176 Bacteria 907
157 Ga0105248_10451312 3300009177 Bacteria 1449
158 Ga0105248_12447371 3300009177 Bacteria 595
159 Ga0105237_10634780 3300009545 Bacteria 1075
160 Ga0105237_11434094 3300009545 Bacteria 697
161 Ga0105249_10017160 3300009553 Bacteria 6426
162 Ga0105249_10219339 3300009553 Unclassified 1871
163 Ga0105249_10371616 3300009553 Bacteria 1454
164 Ga0105239_10001802 3300010375 Bacteria 28139
165 Ga0105239_10249609 3300010375 Bacteria 1993
166 Ga0157373_10285514 3300013100 Bacteria 1170
167 Ga0157373_10646606 3300013100 Bacteria 772
168 Ga0157373_11552118 3300013100 Bacteria 506
169 Ga0157371_10257474 3300013102 Unclassified 1258
170 Ga0157371_10337058 3300013102 Bacteria 1096
171 Ga0157371_10542135 3300013102 Bacteria 862
172 Ga0157374_10000587 3300013296 Bacteria 32144
173 Ga0157374_10004126 3300013296 Bacteria 12197
174 Ga0157374_10062741 3300013296 Bacteria 3484
175 Ga0157374_10070413 3300013296 Bacteria 3296
176 Ga0157378_10353826 3300013297 Bacteria 1435
177 Ga0157378_11062115 3300013297 Bacteria 846
178 Ga0157378_11288325 3300013297 Bacteria 772
179 Ga0163162_10002830 3300013306 Bacteria 16503
180 Ga0163162_10003298 3300013306 Bacteria 15443
181 Ga0163162_10027155 3300013306 Bacteria 5660
182 Ga0163162_10043940 3300013306 Bacteria 4474
183 Ga0163162_10131290 3300013306 Bacteria 2613
184 Ga0163162_11131298 3300013306 Unclassified 888
185 Ga0163162_11466740 3300013306 Bacteria 777
186 Ga0163162_11747971 3300013306 Bacteria 711
187 Ga0157372_10097611 3300013307 Bacteria 3351
188 Ga0157372_10459151 3300013307 Bacteria 1484
189 Ga0157372_10692648 3300013307 Bacteria 1186
190 Ga0157372_11976203 3300013307 Unclassified 670
191 Ga0157375_10034885 3300013308 Bacteria 4796
192 Ga0157375_10114623 3300013308 Bacteria 2797
193 Ga0157375_10496552 3300013308 Bacteria 1385
194 Ga0157375_10877765 3300013308 Bacteria 1042
195 Ga0157375_11834858 3300013308 Unclassified 719
196 Ga0157375_11981290 3300013308 Bacteria 692
197 Ga0163163_10000867 3300014325 Bacteria 25795
198 Ga0163163_10094907 3300014325 Bacteria 3001
199 Ga0163163_10567556 3300014325 Bacteria 1198
200 Ga0157380_10197014 3300014326 Unclassified 1784
201 Ga0157380_10696399 3300014326 Bacteria 1020
202 Ga0157380_10944007 3300014326 Bacteria 892
203 Ga0157377_10014776 3300014745 Bacteria 3979
204 Ga0157377_10119169 3300014745 Bacteria 1597
205 Ga0157379_10011401 3300014968 Bacteria 7756
206 Ga0157379_10036734 3300014968 Bacteria 4368
207 Ga0157376_10025221 3300014969 Bacteria 4680
208 Ga0157376_10332882 3300014969 Bacteria 1447
209 Ga0157376_10881317 3300014969 Bacteria 912
210 Ga0157376_13042198 3300014969 Bacteria 508
211 Ga0163161_10008580 3300017792 Bacteria 7066
212 Ga0163161_10137801 3300017792 Bacteria 1846
213 Ga0213876_10001314 3300021384 Bacteria 15620
214 Ga0207666_1051246 3300025271 Bacteria 655
215 Ga0207697_10007958 3300025315 Bacteria 4683
216 Ga0207656_10672946 3300025321 Archaea 529
217 Ga0207642_10097931 3300025899 Bacteria 1465
218 Ga0207642_10116889 3300025899 Bacteria 1368
219 Ga0207710_10380953 3300025900 Bacteria 722
220 Ga0207680_10170480 3300025903 Bacteria 1465
221 Ga0207680_10278395 3300025903 Bacteria 1162
222 Ga0207647_10012261 3300025904 Bacteria 5972
223 Ga0207699_10650094 3300025906 Bacteria 770
224 Ga0207645_10008204 3300025907 Bacteria 7307
225 Ga0207645_10008964 3300025907 Bacteria 6946
226 Ga0207643_10113308 3300025908 Bacteria 1599
227 Ga0207643_10723957 3300025908 Unclassified 643
228 Ga0207684_10021687 3300025910 Bacteria 5484
229 Ga0207684_10583957 3300025910 Unclassified 955
230 Ga0207654_10186899 3300025911 Bacteria 1355
231 Ga0207654_10205078 3300025911 Bacteria 1300
232 Ga0207654_10297204 3300025911 Bacteria 1097
233 Ga0207695_10000010 3300025913 Bacteria 981919
234 Ga0207660_10579762 3300025917 Bacteria 913
235 Ga0207662_10007911 3300025918 Bacteria 5789
236 Ga0207649_10000567 3300025920 Bacteria 25427
237 Ga0207649_10331189 3300025920 Bacteria 1122
238 Ga0207646_10000774 3300025922 Bacteria 41404
239 Ga0207646_10103704 3300025922 Bacteria 2551
240 Ga0207646_10244230 3300025922 Bacteria 1622
241 Ga0207681_10021587 3300025923 Bacteria 4095
242 Ga0207681_10404340 3300025923 Bacteria 1103
243 Ga0207694_10193747 3300025924 Bacteria 1652
244 Ga0207650_10079354 3300025925 Bacteria 2486
245 Ga0207650_10359377 3300025925 Bacteria 1199
246 Ga0207650_11742529 3300025925 Bacteria 528
247 Ga0207659_10316065 3300025926 Bacteria 1287
248 Ga0207659_10443776 3300025926 Bacteria 1092
249 Ga0207659_11169903 3300025926 Bacteria 661
250 Ga0207644_10157071 3300025931 Bacteria 1765
251 Ga0207690_10013908 3300025932 Bacteria 4849
252 Ga0207706_10009149 3300025933 Bacteria 9107
253 Ga0207706_10029711 3300025933 Bacteria 4878
254 Ga0207706_10091896 3300025933 Bacteria 2668
255 Ga0207686_10243897 3300025934 Bacteria 1309
256 Ga0207686_10583442 3300025934 Unclassified 878
257 Ga0207670_10003217 3300025936 Bacteria 8652
258 Ga0207670_10044886 3300025936 Bacteria 2927
259 Ga0207670_10140926 3300025936 Bacteria 1778
260 Ga0207669_10452472 3300025937 Bacteria 1018
261 Ga0207704_10049579 3300025938 Bacteria 2527
262 Ga0207704_10051540 3300025938 Bacteria 2490
263 Ga0207691_10112719 3300025940 Bacteria 2417
264 Ga0207711_11688061 3300025941 Bacteria 577
265 Ga0207689_10000843 3300025942 Bacteria 29516
266 Ga0207689_10007973 3300025942 Bacteria 9252
267 Ga0207689_10009455 3300025942 Bacteria 8416
268 Ga0207689_10131332 3300025942 Bacteria 2061
269 Ga0207689_10246954 3300025942 Bacteria 1476
270 Ga0207661_10000411 3300025944 Bacteria 27626
271 Ga0207661_10120973 3300025944 Bacteria 2229
272 Ga0207661_10155435 3300025944 Bacteria 1981
273 Ga0207661_10177820 3300025944 Bacteria 1856
274 Ga0207661_10446394 3300025944 Bacteria 1178
275 Ga0207679_10000297 3300025945 Bacteria 37427
276 Ga0207679_10000800 3300025945 Bacteria 20460
277 Ga0207679_10109681 3300025945 Bacteria 2175
278 Ga0207679_10237035 3300025945 Bacteria 1544
279 Ga0207679_10931633 3300025945 Bacteria 795
280 Ga0207651_10028687 3300025960 Bacteria 3515
281 Ga0207651_10089465 3300025960 Bacteria 2248
282 Ga0207651_10559144 3300025960 Bacteria 996
283 Ga0207712_10143922 3300025961 Unclassified 1833
284 Ga0207712_10497871 3300025961 Unclassified 1041
285 Ga0207640_10485773 3300025981 Archaea 1025
286 Ga0207658_10037350 3300025986 Unclassified 3489
287 Ga0207658_10183560 3300025986 Bacteria 1733
288 Ga0207658_10575852 3300025986 Bacteria 1009
289 Ga0207677_10002901 3300026023 Bacteria 9057
290 Ga0207677_10008754 3300026023 Bacteria 5668
291 Ga0207677_10033038 3300026023 Bacteria 3332
292 Ga0207677_10070895 3300026023 Unclassified 2458
293 Ga0207703_10188681 3300026035 Bacteria 1824
294 Ga0207703_10416311 3300026035 Bacteria 1249
295 Ga0207639_10001395 3300026041 Bacteria 16309
296 Ga0207639_10209388 3300026041 Bacteria 1677
297 Ga0207641_10264841 3300026088 Bacteria 1611
298 Ga0207641_11094351 3300026088 Unclassified 795
299 Ga0207648_10026203 3300026089 Bacteria 5183
300 Ga0207648_10074982 3300026089 Bacteria 2949
301 Ga0207648_11846848 3300026089 Unclassified 566
302 Ga0207676_10133172 3300026095 Bacteria 2117
303 Ga0207676_10140978 3300026095 Bacteria 2063
304 Ga0207676_10279549 3300026095 Unclassified 1515
305 Ga0207674_10003152 3300026116 Bacteria 20329
306 Ga0207674_10014623 3300026116 Bacteria 8656
307 Ga0207674_10118087 3300026116 Bacteria 2622
308 Ga0207675_100145933 3300026118 Bacteria 2250
309 Ga0207675_101158104 3300026118 Bacteria 793
310 Ga0207675_101324823 3300026118 Unclassified 741
311 Ga0207683_10004211 3300026121 Bacteria 12434
312 Ga0207698_10102643 3300026142 Bacteria 2375
313 Ga0207698_10111380 3300026142 Bacteria 2295
314 Ga0207698_10154933 3300026142 Bacteria 1994
315 Ga0207698_10485448 3300026142 Bacteria 1199
316 Ga0268266_10407136 3300028379 Bacteria 1287
317 Ga0268266_10916950 3300028379 Bacteria 847
318 Ga0268264_10171320 3300028381 Bacteria 1963
319 Ga0373934_0127365 3300035086 Unclassified 1037
320 Ga0373923_0105922 3300035111 Unclassified 1244
321 Ga0373943_0161632 3300035170 Bacteria 1220
322 Ga0373943_0355460 3300035170 Bacteria 840
323 Ga0373955_0201221 3300035172 Bacteria 1186
324 Ga0316574_0173559 3300035398 Bacteria 1388
325 Ga0373933_0008063 3300035724 Bacteria 5748
326 Ga0373937_0006966 3300036401 Bacteria 9758
327 Ga0436365_0473715 3300039437 Bacteria 54513
328 Ga0451839_1229875 3300041496 Bacteria 724
329 Ga0451853_0167776 3300041512 Unclassified 703
330 Ga0451577_0428084 3300042876 Bacteria 1202
331 Ga0495592_0268853 3300046454 Unclassified 1119
332 Ga0495650_0000003 3300046471 Bacteria 900730
333 Ga0495607_0175945 3300046501 Bacteria 1077
334 Ga0495583_0023465 3300046506 Bacteria 3121
335 Ga0495606_0000116 3300046507 Bacteria 134901
336 Ga0495610_0005913 3300046512 Bacteria 8571
337 Ga0495616_0001938 3300046513 Bacteria 13915
338 Ga0495616_0010108 3300046513 Bacteria 5475
339 Ga0495628_0011209 3300046516 Bacteria 7585
340 Ga0495630_0087961 3300046517 Unclassified 2346
341 Ga0495652_0068780 3300046529 Bacteria 2966
342 Ga0495640_0288501 3300046533 Unclassified 1021
343 Ga0495586_0330697 3300046535 Unclassified 874
344 Ga0495587_0163730 3300046536 Unclassified 1265
345 Ga0495609_0122500 3300046538 Bacteria 1117
346 Ga0495633_0005012 3300046558 Bacteria 8257
347 Ga0495667_0645141 3300046559 Unclassified 658
348 Ga0495667_0779356 3300046559 Unclassified 590
349 Ga0495634_0045414 3300046642 Unclassified 2970
350 Ga0495625_0000219 3300046660 Bacteria 90690
351 Ga0495625_0202177 3300046660 Bacteria 1310
352 Ga0495661_0001592 3300046665 Bacteria 18700
353 Ga0495599_0285575 3300046678 Unclassified 998
354 Ga0495613_0466080 3300046689 Unclassified 854
355 Ga0495671_0172201 3300046692 Bacteria 1052
356 Ga0495649_0000037 3300046694 Bacteria 133848
357 Ga0495600_0106597 3300046809 Unclassified 1826
358 Ga0495674_0172722 3300047319 Unclassified 1803
359 Ga0495687_002471 3300047443 Bacteria 14756
360 Ga0495684_0094128 3300047471 Unclassified 2269
361 Ga0496105_1224369 3300048908 Bacteria 552
362 Ga0496108_1132470 3300048911 Unclassified 664
363 Ga0496110_0278434 3300048913 Bacteria 1523
364 Ga0496110_1030924 3300048913 Unclassified 730
365 Ga0495678_050327 3300049459 Bacteria 1615
366 Ga0501292_027912 3300049515 Bacteria 938
367 Ga0501208_060747 3300049655 Bacteria 740
368 nmdc:mga09592_539349_c1 3300050508 Bacteria 1002
369 nmdc:mga0n895_1269332_c1 3300050512 Bacteria 708
370 nmdc:mga08x19_22733_c1 3300050514 Unclassified 3884
371 nmdc:mga08x19_687859_c1 3300050514 Unclassified 726
372 Ga0495619_0546967 3300053085 Unclassified 794
373 Ga0495619_0775462 3300053085 Bacteria 649
374 Ga0500618_006621 3300053125 Bacteria 3383
375 Ga0070676_10003561
376 Ga0065715_10385838
377 Ga0065707_10112682
378 Ga0070676_10007326
379 Ga0070683_100000327
380 Ga0070683_100047705
381 Ga0070683_100065898
382 Ga0070683_100506244
383 Ga0070683_101048606
384 Ga0070683_101099796
385 Ga0070690_100256042
386 Ga0070670_100031189
387 Ga0070670_100170772
388 Ga0068869_100004762
389 Ga0068869_100079023
390 Ga0068869_100082645
391 Ga0068869_100089639
392 Ga0070666_10060519
393 Ga0070666_10239028
394 Ga0070666_10553267
395 Ga0070682_100062927
396 Ga0070682_100265603
397 Ga0068868_100001123
398 Ga0068868_100133722
399 Ga0070689_100039628
400 Ga0070689_100042612
401 Ga0070689_100322178
402 Ga0070689_100458379
403 Ga0070689_101261280
404 Ga0070687_100004644
405 Ga0070661_100001196
406 Ga0070661_100006373
407 Ga0070661_100253416
408 Ga0070668_100044928
409 Ga0070669_100877253
410 Ga0070675_100048368
411 Ga0070675_100085838
412 Ga0070675_100352563
413 Ga0070671_100065215
414 Ga0070671_100250193
415 Ga0070671_100475885
416 Ga0070671_100513676
417 Ga0070671_100631503
418 Ga0070674_101081394
419 Ga0070673_100041208
420 Ga0070673_100123089
421 Ga0070673_100264352
422 Ga0070688_100030527
423 Ga0070688_100035603
424 Ga0070688_100075619
425 Ga0070688_100512537
426 Ga0070659_100002952
427 Ga0070667_100024615
428 Ga0070667_100260148
429 Ga0070667_100917018
430 Ga0070709_10744550
431 Ga0070701_10276808
432 Ga0070701_10342461
433 Ga0070708_100111088
434 Ga0070663_100059505
435 Ga0070678_100067398
436 Ga0070662_100018489
437 Ga0070662_100088366
438 Ga0070662_100716941
439 Ga0068867_100055040
440 Ga0070685_10054358
441 Ga0070685_10217511
442 Ga0070706_100195567
443 Ga0070706_100596539
444 Ga0070707_100067112
445 Ga0070707_100089011
446 Ga0070679_100095496
447 Ga0070684_100000290
448 Ga0070684_100014260
449 Ga0070684_100069315
450 Ga0070684_102022711
451 Ga0070697_100044119
452 Ga0068853_100000837
453 Ga0068853_100139992
454 Ga0068853_100165057
455 Ga0068853_101065200
456 Ga0068853_101380764
457 Ga0070672_100708401
458 Ga0070686_100042877
459 Ga0070686_100166374
460 Ga0070686_100345842
461 Ga0070693_100758166
462 Ga0070665_100308500
463 Ga0070665_100998826
464 Ga0070704_100178262
465 Ga0068855_100115577
466 Ga0070664_100000509
467 Ga0070664_100005422
468 Ga0070664_100091591
469 Ga0070664_100196571
470 Ga0070664_100304353
471 Ga0070664_100360707
472 Ga0070664_100369247
473 Ga0070664_100509413
474 Ga0068857_100000579
475 Ga0068857_100146913
476 Ga0068857_100182538
477 Ga0068854_100129860
478 Ga0070702_100892435
479 Ga0068852_100069417
480 Ga0068852_101610522
481 Ga0068859_100072558
482 Ga0068859_100106689
483 Ga0068859_100158012
484 Ga0068864_100038625
485 Ga0068864_100608992
486 Ga0068864_100634530
487 Ga0068866_10102031
488 Ga0068866_10165857
489 Ga0068861_100742765
490 Ga0068861_101476661
491 Ga0068851_10048940
492 Ga0068851_10080304
493 Ga0068870_10211699
494 Ga0068870_10892456
495 Ga0068863_100093742
496 Ga0068863_100273900
497 Ga0068863_100309637
498 Ga0068858_100041342
499 Ga0068858_100157878
500 Ga0068858_100240604
501 Ga0068858_100673120
502 Ga0068862_101589032
503 Ga0081539_10331905
504 Ga0070717_10053471
505 Ga0070717_10314762
506 Ga0070717_10567857
507 Ga0070716_100923013
508 Ga0068871_100156174
509 Ga0068871_100350147
510 Ga0068871_100531484
511 Ga0075434_101501839
512 Ga0068865_100089857
513 Ga0068865_100343040
514 Ga0068865_100671716
515 Ga0068865_100960987
516 Ga0075436_100047892
517 Ga0075436_100711448
518 Ga0097620_100072554
519 Ga0097620_100106695
520 Ga0097620_100158004
521 Ga0075435_100291670
522 Ga0075435_100885883
523 Ga0105251_10056345
524 Ga0105240_10000011
525 Ga0105247_10174303
526 Ga0105241_10649052
527 Ga0105242_10025593
528 Ga0105242_10068152
529 Ga0105242_10212518
530 Ga0105242_10851847
531 Ga0105248_10451312
532 Ga0105248_12447371
533 Ga0105237_10634780
534 Ga0105237_11434094
535 Ga0105249_10017160
536 Ga0105249_10219339
537 Ga0105249_10371616
538 Ga0105239_10001802
539 Ga0105239_10249609
540 Ga0157373_10285514
541 Ga0157373_10646606
542 Ga0157373_11552118
543 Ga0157371_10257474
544 Ga0157371_10337058
545 Ga0157371_10542135
546 Ga0157374_10000587
547 Ga0157374_10004126
548 Ga0157374_10062741
549 Ga0157374_10070413
550 Ga0157378_10353826
551 Ga0157378_11062115
552 Ga0157378_11288325
553 Ga0163162_10002830
554 Ga0163162_10003298
555 Ga0163162_10027155
556 Ga0163162_10043940
557 Ga0163162_10131290
558 Ga0163162_11131298
559 Ga0163162_11466740
560 Ga0163162_11747971
561 Ga0157372_10097611
562 Ga0157372_10459151
563 Ga0157372_10692648
564 Ga0157372_11976203
565 Ga0157375_10034885
566 Ga0157375_10114623
567 Ga0157375_10496552
568 Ga0157375_10877765
569 Ga0157375_11834858
570 Ga0157375_11981290
571 Ga0163163_10000867
572 Ga0163163_10094907
573 Ga0163163_10567556
574 Ga0157380_10197014
575 Ga0157380_10696399
576 Ga0157380_10944007
577 Ga0157377_10014776
578 Ga0157377_10119169
579 Ga0157379_10011401
580 Ga0157379_10036734
581 Ga0157376_10025221
582 Ga0157376_10332882
583 Ga0157376_10881317
584 Ga0157376_13042198
585 Ga0163161_10008580
586 Ga0163161_10137801
587 Ga0213876_10001314
588 Ga0207666_1051246
589 Ga0207697_10007958
590 Ga0207656_10672946
591 Ga0207642_10097931
592 Ga0207642_10116889
593 Ga0207710_10380953
594 Ga0207680_10170480
595 Ga0207680_10278395
596 Ga0207647_10012261
597 Ga0207699_10650094
598 Ga0207645_10008204
599 Ga0207645_10008964
600 Ga0207643_10113308
601 Ga0207643_10723957
602 Ga0207684_10021687
603 Ga0207684_10583957
604 Ga0207654_10186899
605 Ga0207654_10205078
606 Ga0207654_10297204
607 Ga0207695_10000010
608 Ga0207660_10579762
609 Ga0207662_10007911
610 Ga0207649_10000567
611 Ga0207649_10331189
612 Ga0207646_10000774
613 Ga0207646_10103704
614 Ga0207646_10244230
615 Ga0207681_10021587
616 Ga0207681_10404340
617 Ga0207694_10193747
618 Ga0207650_10079354
619 Ga0207650_10359377
620 Ga0207650_11742529
621 Ga0207659_10316065
622 Ga0207659_10443776
623 Ga0207659_11169903
624 Ga0207644_10157071
625 Ga0207690_10013908
626 Ga0207706_10009149
627 Ga0207706_10029711
628 Ga0207706_10091896
629 Ga0207686_10243897
630 Ga0207686_10583442
631 Ga0207670_10003217
632 Ga0207670_10044886
633 Ga0207670_10140926
634 Ga0207669_10452472
635 Ga0207704_10049579
636 Ga0207704_10051540
637 Ga0207691_10112719
638 Ga0207711_11688061
639 Ga0207689_10000843
640 Ga0207689_10007973
641 Ga0207689_10009455
642 Ga0207689_10131332
643 Ga0207689_10246954
644 Ga0207661_10000411
645 Ga0207661_10120973
646 Ga0207661_10155435
647 Ga0207661_10177820
648 Ga0207661_10446394
649 Ga0207679_10000297
650 Ga0207679_10000800
651 Ga0207679_10109681
652 Ga0207679_10237035
653 Ga0207679_10931633
654 Ga0207651_10028687
655 Ga0207651_10089465
656 Ga0207651_10559144
657 Ga0207712_10143922
658 Ga0207712_10497871
659 Ga0207640_10485773
660 Ga0207658_10037350
661 Ga0207658_10183560
662 Ga0207658_10575852
663 Ga0207677_10002901
664 Ga0207677_10008754
665 Ga0207677_10033038
666 Ga0207677_10070895
667 Ga0207703_10188681
668 Ga0207703_10416311
669 Ga0207639_10001395
670 Ga0207639_10209388
671 Ga0207641_10264841
672 Ga0207641_11094351
673 Ga0207648_10026203
674 Ga0207648_10074982
675 Ga0207648_11846848
676 Ga0207676_10133172
677 Ga0207676_10140978
678 Ga0207676_10279549
679 Ga0207674_10003152
680 Ga0207674_10014623
681 Ga0207674_10118087
682 Ga0207675_100145933
683 Ga0207675_101158104
684 Ga0207675_101324823
685 Ga0207683_10004211
686 Ga0207698_10102643
687 Ga0207698_10111380
688 Ga0207698_10154933
689 Ga0207698_10485448
690 Ga0268266_10407136
691 Ga0268266_10916950
692 Ga0268264_10171320
693 Ga0373934_0127365
694 Ga0373923_0105922
695 Ga0373943_0161632
696 Ga0373943_0355460
697 Ga0373955_0201221
698 Ga0316574_0173559
699 Ga0373933_0008063
700 Ga0373937_0006966
701 Ga0436365_0473715
702 Ga0451839_1229875
703 Ga0451853_0167776
704 Ga0451577_0428084
705 Ga0495592_0268853
706 Ga0495650_0000003
707 Ga0495607_0175945
708 Ga0495583_0023465
709 Ga0495606_0000116
710 Ga0495610_0005913
711 Ga0495616_0001938
712 Ga0495616_0010108
713 Ga0495628_0011209
714 Ga0495630_0087961
715 Ga0495652_0068780
716 Ga0495640_0288501
717 Ga0495586_0330697
718 Ga0495587_0163730
719 Ga0495609_0122500
720 Ga0495633_0005012
721 Ga0495667_0645141
722 Ga0495667_0779356
723 Ga0495634_0045414
724 Ga0495625_0000219
725 Ga0495625_0202177
726 Ga0495661_0001592
727 Ga0495599_0285575
728 Ga0495613_0466080
729 Ga0495671_0172201
730 Ga0495649_0000037
731 Ga0495600_0106597
732 Ga0495674_0172722
733 Ga0495687_002471
734 Ga0495684_0094128
735 Ga0496105_1224369
736 Ga0496108_1132470
737 Ga0496110_0278434
738 Ga0496110_1030924
739 Ga0495678_050327
740 Ga0501292_027912
741 Ga0501208_060747
742 nmdc:mga09592_539349_c1
743 nmdc:mga0n895_1269332_c1
744 nmdc:mga08x19_22733_c1
745 nmdc:mga08x19_687859_c1
746 Ga0495619_0546967
747 Ga0495619_0775462
748 Ga0500618_006621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

21

164

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.784 2 143
5xd4-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with atp (ii) 0.7525 2 139
6m6y-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp 0.7497 2 139
3gz8-assembly2.cif.gz_D cocrystal structure of nudix domain of shewanella oneidensis nrtr complexed with adp ribose 0.7486 2 144
1ktg-assembly1.cif.gz_A crystal structure of a c. elegans ap4a hydrolase binary complex 0.7396 2 143
ID Description Score Start End Superfamily
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9574 2 139 3.90.79.10
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9123 2 139 3.90.79.10
af_Q54XI6_2_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.75 2 54 3.90.79.10
af_Q4V6M1_1_140_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7453 2 143 3.90.79.10
1ktgA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7396 2 143 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A2V6MFH1-F1-model_v4 Nudix hydrolase domain-containing protein 0.9943 1 143 GO:0004081
GO:0006167
GO:0006754
AF-A0A2V6CBL5-F1-model_v4 NUDIX hydrolase 0.9882 1 143 GO:0004081
GO:0006167
GO:0006754
AF-A0A2V5Q5D4-F1-model_v4 Nudix hydrolase domain-containing protein 0.9809 1 143 GO:0004081
GO:0006167
GO:0006754
AF-A0A2V6MFH1-F1-model_v4 Nudix hydrolase domain-containing protein 0.9807 1 143 GO:0004081
GO:0006167
GO:0006754
AF-A0A520IGE4-F1-model_v4 NUDIX domain-containing protein 0.9762 2 144 GO:0004081
GO:0006167
GO:0006754

Map