F426693

General Info

Members Datasets Scaffolds Average Seq Length
374 233 748 218

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10256084|Ga0105238_102560842
Length 256
Sequence MSAAAPPHRGAAPSVASGDASPVVFATREERSSPDPKRSEEVSAQRTEGALSAEAFADLAGATPAQVADLERFRQMLVERNAVMNLVGPATLPDFWNRHAWDSAQLIKIAPDALTWADLGAGAGFPGLVLAILGKGRPGFHVDLVESMAKRCRFLSEVVEALDLPASVRHDRAENLDLAVDIVTARACAPLWRLLGYARPYFKRGALGLFLKGQDVASELEEATRYWEYEADIVASLSDPRGRIVRVRRLGRARKV

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
210 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
211 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
215 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
220 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
221 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
224 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
227 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
228 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
229 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
230 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
231 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
232 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
233 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 4.01
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10256084 3300009551 Bacteria 1729
2 Ga0055530_10000313 3300003791 Bacteria 44170
3 Ga0055531_10005382 3300003794 Bacteria 7501
4 Ga0055531_10008950 3300003794 Bacteria 5185
5 Ga0065165_1003306 3300005262 Bacteria 11574
6 Ga0065165_1023846 3300005262 Bacteria 2066
7 Ga0070658_10337567 3300005327 Bacteria 1288
8 Ga0070670_100000004 3300005331 Bacteria 392110
9 Ga0068869_101022944 3300005334 Bacteria 720
10 Ga0070666_10022684 3300005335 Bacteria 4079
11 Ga0070680_100097190 3300005336 Bacteria 2442
12 Ga0070691_10028902 3300005341 Bacteria 2592
13 Ga0070691_10078062 3300005341 Bacteria 1617
14 Ga0070668_100001643 3300005347 Bacteria 16208
15 Ga0070668_100002624 3300005347 Bacteria 13203
16 Ga0070668_100021118 3300005347 Bacteria 4922
17 Ga0070668_100383191 3300005347 Bacteria 1197
18 Ga0070669_100326733 3300005353 Bacteria 1240
19 Ga0070671_100088253 3300005355 Bacteria 2595
20 Ga0070674_100571534 3300005356 Bacteria 951
21 Ga0070667_100000105 3300005367 Bacteria 106633
22 Ga0070667_100029043 3300005367 Bacteria 4606
23 Ga0070667_100080910 3300005367 Bacteria 2779
24 Ga0070678_100135744 3300005456 Bacteria 1961
25 Ga0070678_100202837 3300005456 Bacteria 1638
26 Ga0070681_10001804 3300005458 Bacteria 19261
27 Ga0070681_10558454 3300005458 Unclassified 1059
28 Ga0070684_100706990 3300005535 Bacteria 940
29 Ga0068853_100052073 3300005539 Bacteria 3525
30 Ga0068853_100073631 3300005539 Bacteria 2979
31 Ga0070693_100126496 3300005547 Bacteria 1592
32 Ga0070665_100000198 3300005548 Bacteria 105999
33 Ga0070665_100000721 3300005548 Bacteria 44003
34 Ga0070665_100001194 3300005548 Bacteria 31673
35 Ga0070665_100053905 3300005548 Bacteria 4034
36 Ga0070665_100699013 3300005548 Bacteria 1027
37 Ga0070704_100254485 3300005549 Bacteria 1444
38 Ga0068855_100073731 3300005563 Bacteria 3965
39 Ga0068855_100232516 3300005563 Bacteria 2063
40 Ga0070664_100075655 3300005564 Bacteria 2892
41 Ga0070664_100230851 3300005564 Bacteria 1659
42 Ga0068854_100090723 3300005578 Bacteria 2273
43 Ga0068859_100001699 3300005617 Bacteria 22416
44 Ga0068859_100855931 3300005617 Bacteria 995
45 Ga0068864_100000082 3300005618 Bacteria 101182
46 Ga0068864_100042690 3300005618 Bacteria 3880
47 Ga0068864_100154609 3300005618 Bacteria 2081
48 Ga0068864_100303747 3300005618 Bacteria 1495
49 Ga0068861_100558137 3300005719 Bacteria 1045
50 Ga0068863_100000560 3300005841 Bacteria 37696
51 Ga0068863_100058955 3300005841 Bacteria 3632
52 Ga0068863_100090236 3300005841 Bacteria 2906
53 Ga0068863_100187577 3300005841 Bacteria 1987
54 Ga0068863_100697724 3300005841 Bacteria 1009
55 Ga0068858_100575691 3300005842 Bacteria 1091
56 Ga0068860_100000077 3300005843 Bacteria 171297
57 Ga0068860_100003451 3300005843 Bacteria 16259
58 Ga0068862_100000183 3300005844 Bacteria 68758
59 Ga0068862_100011020 3300005844 Bacteria 7470
60 Ga0068862_100024894 3300005844 Bacteria 5023
61 Ga0068862_100055197 3300005844 Bacteria 3403
62 Ga0068862_100233383 3300005844 Bacteria 1670
63 Ga0070717_10506191 3300006028 Bacteria 1092
64 Ga0075364_10005041 3300006051 Bacteria 7655
65 Ga0075369_10128095 3300006186 Bacteria 1152
66 Ga0068871_100698866 3300006358 Bacteria 929
67 Ga0075431_100506441 3300006847 Bacteria 1198
68 Ga0068865_100005249 3300006881 Bacteria 7831
69 Ga0097620_100001698 3300006931 Bacteria 22416
70 Ga0097620_100855906 3300006931 Bacteria 995
71 Ga0105240_10003418 3300009093 Bacteria 24667
72 Ga0105240_10091747 3300009093 Bacteria 3710
73 Ga0105240_10095791 3300009093 Bacteria 3618
74 Ga0105240_10455999 3300009093 Bacteria 1430
75 Ga0105240_10807718 3300009093 Unclassified 1015
76 Ga0105240_10876485 3300009093 Bacteria 967
77 Ga0105240_11201612 3300009093 Bacteria 803
78 Ga0105241_10150492 3300009174 Bacteria 1903
79 Ga0105242_10039370 3300009176 Bacteria 3804
80 Ga0105242_10597341 3300009176 Bacteria 1065
81 Ga0105242_10638966 3300009176 Bacteria 1033
82 Ga0105248_10001644 3300009177 Bacteria 24861
83 Ga0105248_10014093 3300009177 Bacteria 8796
84 Ga0105238_10016414 3300009551 Bacteria 7496
85 Ga0105238_10112053 3300009551 Bacteria 2708
86 Ga0105238_10116190 3300009551 Bacteria 2655
87 Ga0105238_10414078 3300009551 Bacteria 1342
88 Ga0105249_10000838 3300009553 Bacteria 27558
89 Ga0105239_10118522 3300010375 Bacteria 2938
90 Ga0157373_10000879 3300013100 Bacteria 23263
91 Ga0157373_10015482 3300013100 Bacteria 5576
92 Ga0157370_10009953 3300013104 Bacteria 10063
93 Ga0157369_10455825 3300013105 Bacteria 1324
94 Ga0163162_10059972 3300013306 Bacteria 3838
95 Ga0163162_10116458 3300013306 Bacteria 2773
96 Ga0163162_11450565 3300013306 Bacteria 781
97 Ga0157375_10231940 3300013308 Bacteria 2005
98 Ga0163163_10012064 3300014325 Bacteria 7861
99 Ga0163163_10087223 3300014325 Bacteria 3131
100 Ga0163163_10248343 3300014325 Bacteria 1830
101 Ga0163163_10366028 3300014325 Bacteria 1499
102 Ga0163163_10477673 3300014325 Bacteria 1307
103 Ga0157380_10146663 3300014326 Bacteria 2034
104 Ga0157379_10018883 3300014968 Bacteria 6083
105 Ga0157376_10493932 3300014969 Bacteria 1201
106 Ga0213876_10008313 3300021384 Bacteria 5616
107 Ga0213876_10137202 3300021384 Bacteria 1301
108 Ga0213875_10000053 3300021388 Bacteria 141791
109 Ga0209676_1000140 3300025292 Bacteria 176735
110 Ga0209676_1002399 3300025292 Bacteria 13401
111 Ga0209758_1001380 3300025297 Bacteria 28958
112 Ga0209050_1000053 3300025298 Bacteria 349521
113 Ga0209050_1024805 3300025298 Bacteria 2061
114 Ga0209257_1000292 3300025304 Bacteria 110440
115 Ga0209257_1000419 3300025304 Bacteria 81956
116 Ga0209257_1002736 3300025304 Bacteria 16714
117 Ga0209257_1083598 3300025304 Bacteria 813
118 Ga0207680_10005098 3300025903 Bacteria 6260
119 Ga0207645_10152223 3300025907 Bacteria 1510
120 Ga0207705_10001195 3300025909 Bacteria 21043
121 Ga0207654_10210521 3300025911 Bacteria 1285
122 Ga0207707_10032448 3300025912 Bacteria 4571
123 Ga0207695_10000269 3300025913 Bacteria 130183
124 Ga0207695_10015201 3300025913 Bacteria 9077
125 Ga0207695_10076084 3300025913 Bacteria 3413
126 Ga0207660_10033019 3300025917 Bacteria 3576
127 Ga0207660_10116152 3300025917 Bacteria 2021
128 Ga0207657_10000235 3300025919 Bacteria 58394
129 Ga0207657_10238176 3300025919 Bacteria 1453
130 Ga0207652_10001724 3300025921 Bacteria 19078
131 Ga0207681_10229265 3300025923 Bacteria 1441
132 Ga0207694_10017435 3300025924 Bacteria 5428
133 Ga0207694_10105581 3300025924 Bacteria 2236
134 Ga0207694_10211805 3300025924 Bacteria 1579
135 Ga0207650_10000033 3300025925 Bacteria 226809
136 Ga0207644_10139634 3300025931 Bacteria 1864
137 Ga0207690_10000031 3300025932 Bacteria 154724
138 Ga0207690_10018445 3300025932 Bacteria 4280
139 Ga0207706_10047675 3300025933 Bacteria 3790
140 Ga0207686_10003342 3300025934 Bacteria 8616
141 Ga0207669_10614714 3300025937 Bacteria 885
142 Ga0207704_10004551 3300025938 Bacteria 6345
143 Ga0207711_10000331 3300025941 Bacteria 50472
144 Ga0207711_10035362 3300025941 Bacteria 4234
145 Ga0207711_10303855 3300025941 Bacteria 1472
146 Ga0207661_10261813 3300025944 Bacteria 1541
147 Ga0207679_10057794 3300025945 Bacteria 2871
148 Ga0207679_10181305 3300025945 Bacteria 1742
149 Ga0207667_10033523 3300025949 Bacteria 5520
150 Ga0207667_10263509 3300025949 Bacteria 1762
151 Ga0207651_10135321 3300025960 Bacteria 1894
152 Ga0207712_10000651 3300025961 Bacteria 27001
153 Ga0207668_10000004 3300025972 Bacteria 201204
154 Ga0207668_10000426 3300025972 Bacteria 26589
155 Ga0207668_10018347 3300025972 Bacteria 4400
156 Ga0207668_10021380 3300025972 Bacteria 4126
157 Ga0207668_10761865 3300025972 Bacteria 855
158 Ga0207658_10000229 3300025986 Bacteria 58984
159 Ga0207658_10024073 3300025986 Bacteria 4255
160 Ga0207658_10053000 3300025986 Bacteria 2995
161 Ga0207639_10036946 3300026041 Bacteria 3624
162 Ga0207702_10332147 3300026078 Bacteria 1450
163 Ga0207641_10001887 3300026088 Bacteria 20119
164 Ga0207641_10055756 3300026088 Bacteria 3356
165 Ga0207641_10076737 3300026088 Bacteria 2890
166 Ga0207676_10000068 3300026095 Bacteria 104705
167 Ga0207676_10041640 3300026095 Bacteria 3527
168 Ga0207676_10119436 3300026095 Bacteria 2220
169 Ga0207675_100030878 3300026118 Bacteria 4990
170 Ga0207683_10205676 3300026121 Bacteria 1790
171 Ga0207683_10282093 3300026121 Bacteria 1518
172 Ga0268266_10000003 3300028379 Bacteria 1701703
173 Ga0268266_10001373 3300028379 Bacteria 29333
174 Ga0268266_10004139 3300028379 Bacteria 14009
175 Ga0268266_10072903 3300028379 Bacteria 2979
176 Ga0268266_10084536 3300028379 Bacteria 2771
177 Ga0268266_10930695 3300028379 Bacteria 841
178 Ga0268265_10004547 3300028380 Bacteria 9593
179 Ga0268265_10103153 3300028380 Bacteria 2309
180 Ga0268265_10157983 3300028380 Bacteria 1921
181 Ga0268264_10000032 3300028381 Bacteria 408337
182 Ga0268264_10030197 3300028381 Bacteria 4443
183 Ga0265337_1003622 3300028556 Bacteria 6638
184 Ga0307517_10038138 3300028786 Bacteria 5336
185 Ga0265338_10019196 3300028800 Bacteria 7274
186 Ga0265338_10098538 3300028800 Bacteria 2391
187 Ga0307511_10004780 3300030521 Bacteria 13849
188 Ga0265327_10000331 3300031251 Bacteria 89636
189 Ga0265327_10000591 3300031251 Bacteria 60639
190 Ga0265327_10001088 3300031251 Bacteria 37825
191 Ga0307513_10025275 3300031456 Bacteria 6886
192 Ga0307508_10133853 3300031616 Bacteria 2082
193 Ga0265314_10277918 3300031711 Bacteria 949
194 Ga0307410_10121312 3300031852 Bacteria 1907
195 Ga0307406_10000963 3300031901 Bacteria 16112
196 Ga0307414_10018376 3300032004 Bacteria 4303
197 Ga0307414_10080312 3300032004 Bacteria 2384
198 Ga0307414_10101378 3300032004 Bacteria 2167
199 Ga0307414_10354385 3300032004 Bacteria 1260
200 Ga0307414_10395448 3300032004 Bacteria 1199
201 Ga0307414_10409354 3300032004 Bacteria 1180
202 Ga0307414_10545524 3300032004 Bacteria 1032
203 Ga0307411_10031616 3300032005 Bacteria 3260
204 Ga0373934_0013861 3300035086 Bacteria 3050
205 Ga0373944_0002545 3300035089 Bacteria 4631
206 Ga0373936_0001805 3300035113 Bacteria 7873
207 Ga0373939_0135141 3300035114 Bacteria 884
208 Ga0373957_0112990 3300035120 Bacteria 1095
209 Ga0373943_0139553 3300035170 Bacteria 1304
210 Ga0373943_0193036 3300035170 Bacteria 1124
211 Ga0373946_0141212 3300035171 Bacteria 1116
212 Ga0373955_0046631 3300035172 Bacteria 2343
213 Ga0373924_0022705 3300035410 Bacteria 2454
214 Ga0373927_0000111 3300035695 Bacteria 62031
215 Ga0373933_0000565 3300035724 Bacteria 23136
216 Ga0373933_0247848 3300035724 Bacteria 1147
217 Ga0373947_0039086 3300035725 Bacteria 2822
218 Ga0373947_0095102 3300035725 Bacteria 1864
219 Ga0373937_0006584 3300036401 Bacteria 10030
220 Ga0373937_0168962 3300036401 Bacteria 2052
221 Ga0373937_0464025 3300036401 Bacteria 1203
222 Ga0373925_0000209 3300037068 Bacteria 64086
223 Ga0373925_0021600 3300037068 Bacteria 4692
224 Ga0373925_0135379 3300037068 Bacteria 1925
225 Ga0395899_0002875 3300037312 Bacteria 13838
226 Ga0395899_0242936 3300037312 Bacteria 1238
227 Ga0395900_0000002 3300037418 Bacteria 671103
228 Ga0395900_0042203 3300037418 Bacteria 4699
229 Ga0395898_0004909 3300037466 Bacteria 14517
230 Ga0395898_0062705 3300037466 Bacteria 3610
231 Ga0395898_0134999 3300037466 Bacteria 2362
232 Ga0395898_0241605 3300037466 Bacteria 1722
233 Ga0395905_0076354 3300037471 Bacteria 3140
234 Ga0395905_0747593 3300037471 Bacteria 880
235 Ga0395905_0757329 3300037471 Bacteria 874
236 Ga0436364_0121626 3300037853 Bacteria 20150
237 Ga0395901_0000013 3300038443 Bacteria 375733
238 Ga0395901_0198689 3300038443 Bacteria 2102
239 Ga0395901_0221273 3300038443 Bacteria 1978
240 Ga0436365_0337983 3300039437 Bacteria 1329
241 Ga0436365_0961511 3300039437 Bacteria 5073
242 Ga0436360_1087198 3300039438 Bacteria 4982
243 Ga0466972_0183465 3300044658 Bacteria 981
244 Ga0466961_0131153 3300044693 Bacteria 1571
245 Ga0466961_0228974 3300044693 Bacteria 1144
246 Ga0466968_0031679 3300044735 Bacteria 2195
247 Ga0466967_0635463 3300045976 Bacteria 1055
248 Ga0495592_0025358 3300046454 Bacteria 4501
249 Ga0495629_0001993 3300046459 Bacteria 15861
250 Ga0495629_0083946 3300046459 Bacteria 2223
251 Ga0495638_0164743 3300046460 Bacteria 1276
252 Ga0495651_0000136 3300046462 Bacteria 54665
253 Ga0495653_0001743 3300046463 Bacteria 17165
254 Ga0495664_0173716 3300046477 Bacteria 1307
255 Ga0495583_0031132 3300046506 Bacteria 2590
256 Ga0495620_0026678 3300046515 Bacteria 2714
257 Ga0495628_0045069 3300046516 Bacteria 3508
258 Ga0495628_0059706 3300046516 Bacteria 2993
259 Ga0495631_0174729 3300046518 Bacteria 921
260 Ga0495643_0003478 3300046522 Bacteria 11494
261 Ga0495643_0294329 3300046522 Bacteria 742
262 Ga0495643_0323181 3300046522 Bacteria 697
263 Ga0495642_0055273 3300046528 Bacteria 1638
264 Ga0495652_0005586 3300046529 Bacteria 11817
265 Ga0495654_0040912 3300046530 Bacteria 2307
266 Ga0495665_0162625 3300046531 Bacteria 1163
267 Ga0495640_0001369 3300046533 Bacteria 19192
268 Ga0495587_0001140 3300046536 Bacteria 17405
269 Ga0495609_0018329 3300046538 Bacteria 3243
270 Ga0495597_0005187 3300046542 Bacteria 6937
271 Ga0495597_0005527 3300046542 Bacteria 6684
272 Ga0495645_0042832 3300046543 Bacteria 3301
273 Ga0495622_0006592 3300046557 Bacteria 5384
274 Ga0495633_0001899 3300046558 Bacteria 15216
275 Ga0495667_0000392 3300046559 Bacteria 27924
276 Ga0495668_0009231 3300046616 Bacteria 6069
277 Ga0495668_0045000 3300046616 Bacteria 2453
278 Ga0495668_0069443 3300046616 Bacteria 1937
279 Ga0495668_0205058 3300046616 Bacteria 1079
280 Ga0495634_0044299 3300046642 Bacteria 3012
281 Ga0495611_0010467 3300046648 Bacteria 3924
282 Ga0495611_0051424 3300046648 Bacteria 1857
283 Ga0495625_0087963 3300046660 Bacteria 2153
284 Ga0495635_0001645 3300046663 Bacteria 15067
285 Ga0495657_0002613 3300046675 Bacteria 15065
286 Ga0495599_0060536 3300046678 Bacteria 2367
287 Ga0495623_0001489 3300046679 Bacteria 15874
288 Ga0495646_0008281 3300046680 Bacteria 6610
289 Ga0495669_0044447 3300046684 Bacteria 1979
290 Ga0495624_0130445 3300046690 Bacteria 1541
291 Ga0495649_0000048 3300046694 Bacteria 118180
292 Ga0495600_0034397 3300046809 Bacteria 3289
293 Ga0495674_0000573 3300047319 Bacteria 34362
294 Ga0495674_0664516 3300047319 Bacteria 821
295 Ga0495672_0258491 3300047320 Bacteria 842
296 Ga0495680_0000285 3300047322 Bacteria 56843
297 Ga0495687_077061 3300047443 Bacteria 1318
298 Ga0495675_0008016 3300047444 Bacteria 6534
299 Ga0495677_0021352 3300047445 Bacteria 2347
300 Ga0495686_0011750 3300047472 Bacteria 6164
301 Ga0495602_0002627 3300048088 Bacteria 18358
302 Ga0495602_0184807 3300048088 Bacteria 1604
303 Ga0496100_0171874 3300048903 Bacteria 1561
304 Ga0496101_0319438 3300048904 Bacteria 1218
305 Ga0496102_0049042 3300048905 Bacteria 3841
306 Ga0496102_0344027 3300048905 Bacteria 1404
307 Ga0496103_0192531 3300048906 Bacteria 1311
308 Ga0496106_0131962 3300048909 Bacteria 1960
309 Ga0496109_0004453 3300048912 Bacteria 11699
310 Ga0496112_0012413 3300048915 Bacteria 7832
311 Ga0496112_0057392 3300048915 Bacteria 3833
312 Ga0496112_0081507 3300048915 Bacteria 3200
313 Ga0496115_0001609 3300048918 Bacteria 16223
314 Ga0496115_0003176 3300048918 Bacteria 11807
315 Ga0496115_0023013 3300048918 Bacteria 4833
316 Ga0496115_0035491 3300048918 Bacteria 3945
317 Ga0496115_0154124 3300048918 Bacteria 1898
318 Ga0496116_0076875 3300048919 Bacteria 2089
319 Ga0496122_0002925 3300048925 Bacteria 23284
320 Ga0496123_0005419 3300048926 Bacteria 12853
321 Ga0496125_0004796 3300048928 Bacteria 15397
322 Ga0495682_0051463 3300049460 Bacteria 1498
323 Ga0501034_0005426 3300049571 Bacteria 13941
324 Ga0501034_0355036 3300049571 Bacteria 1394
325 Ga0501036_0143828 3300049572 Bacteria 2012
326 Ga0501037_0043920 3300049573 Bacteria 3284
327 Ga0501037_0230604 3300049573 Bacteria 1300
328 Ga0501047_0007096 3300049581 Bacteria 10520
329 Ga0501047_0058652 3300049581 Bacteria 3718
330 Ga0501047_0208033 3300049581 Bacteria 1816
331 Ga0501047_0278951 3300049581 Bacteria 1516
332 Ga0501044_0003338 3300049823 Bacteria 18099
333 Ga0501044_0019605 3300049823 Bacteria 7231
334 Ga0501044_0212173 3300049823 Bacteria 1890
335 nmdc:mga00v17_1658_c1 3300050491 Bacteria 11600
336 nmdc:mga06z11_20990_c1 3300050494 Bacteria 3028
337 nmdc:mga05p37_632927_c1 3300050507 Bacteria 1201
338 nmdc:mga06r32_257055_c1 3300050510 Bacteria 1734
339 nmdc:mga0sz30_49639_c1 3300050516 Bacteria 1778
340 Ga0495601_0348829 3300053077 Bacteria 962
341 Ga0495612_0029595 3300053078 Bacteria 2206
342 Ga0495595_0000996 3300053084 Bacteria 10935
343 Ga0495619_0000309 3300053085 Bacteria 34322
344 Ga0500578_0162040 3300053086 Bacteria 1387
345 Ga0500644_0048681 3300053088 Bacteria 1443
346 Ga0500583_0036900 3300053092 Bacteria 2192
347 Ga0500651_0008681 3300053093 Bacteria 5998
348 Ga0500651_0105076 3300053093 Bacteria 1728
349 Ga0500566_0026071 3300053094 Bacteria 3423
350 Ga0500650_0166730 3300053098 Bacteria 1014
351 Ga0500569_012335 3300053109 Bacteria 2064
352 Ga0500594_0061492 3300053118 Bacteria 1084
353 Ga0500595_018532 3300053119 Bacteria 2543
354 Ga0500595_069959 3300053119 Bacteria 1043
355 Ga0500607_148439 3300053121 Bacteria 1091
356 Ga0500608_039611 3300053122 Bacteria 2256
357 Ga0500652_202915 3300053131 Bacteria 804
358 Ga0500655_009628 3300053133 Bacteria 1744
359 Ga0500559_0003202 3300053136 Bacteria 8138
360 Ga0500590_004837 3300053148 Bacteria 6422
361 Ga0500619_021130 3300053154 Bacteria 1870
362 Ga0500620_089906 3300053155 Bacteria 1069
363 Ga0500637_0050315 3300053178 Bacteria 2373
364 Ga0500576_058127 3300053725 Bacteria 1698
365 Ga0500625_015593 3300053729 Bacteria 3529
366 Ga0500645_000539 3300053730 Bacteria 25211
367 Ga0500552_025931 3300053733 Bacteria 871
368 Ga0500596_003607 3300053735 Bacteria 2916
369 2644087633 2643221614 Bacteria 4260023
370 2644344323 2643221661 Bacteria 4267604
371 2644366992 2643221666 Bacteria 4265935
372 2928532172 2928531327 Bacteria 5101314
373 2928974608 2928972540 Bacteria 3058286
374 2977243531 2977240413 Bacteria 3191065
375 Ga0105238_10256084
376 Ga0055530_10000313
377 Ga0055531_10005382
378 Ga0055531_10008950
379 Ga0065165_1003306
380 Ga0065165_1023846
381 Ga0070658_10337567
382 Ga0070670_100000004
383 Ga0068869_101022944
384 Ga0070666_10022684
385 Ga0070680_100097190
386 Ga0070691_10028902
387 Ga0070691_10078062
388 Ga0070668_100001643
389 Ga0070668_100002624
390 Ga0070668_100021118
391 Ga0070668_100383191
392 Ga0070669_100326733
393 Ga0070671_100088253
394 Ga0070674_100571534
395 Ga0070667_100000105
396 Ga0070667_100029043
397 Ga0070667_100080910
398 Ga0070678_100135744
399 Ga0070678_100202837
400 Ga0070681_10001804
401 Ga0070681_10558454
402 Ga0070684_100706990
403 Ga0068853_100052073
404 Ga0068853_100073631
405 Ga0070693_100126496
406 Ga0070665_100000198
407 Ga0070665_100000721
408 Ga0070665_100001194
409 Ga0070665_100053905
410 Ga0070665_100699013
411 Ga0070704_100254485
412 Ga0068855_100073731
413 Ga0068855_100232516
414 Ga0070664_100075655
415 Ga0070664_100230851
416 Ga0068854_100090723
417 Ga0068859_100001699
418 Ga0068859_100855931
419 Ga0068864_100000082
420 Ga0068864_100042690
421 Ga0068864_100154609
422 Ga0068864_100303747
423 Ga0068861_100558137
424 Ga0068863_100000560
425 Ga0068863_100058955
426 Ga0068863_100090236
427 Ga0068863_100187577
428 Ga0068863_100697724
429 Ga0068858_100575691
430 Ga0068860_100000077
431 Ga0068860_100003451
432 Ga0068862_100000183
433 Ga0068862_100011020
434 Ga0068862_100024894
435 Ga0068862_100055197
436 Ga0068862_100233383
437 Ga0070717_10506191
438 Ga0075364_10005041
439 Ga0075369_10128095
440 Ga0068871_100698866
441 Ga0075431_100506441
442 Ga0068865_100005249
443 Ga0097620_100001698
444 Ga0097620_100855906
445 Ga0105240_10003418
446 Ga0105240_10091747
447 Ga0105240_10095791
448 Ga0105240_10455999
449 Ga0105240_10807718
450 Ga0105240_10876485
451 Ga0105240_11201612
452 Ga0105241_10150492
453 Ga0105242_10039370
454 Ga0105242_10597341
455 Ga0105242_10638966
456 Ga0105248_10001644
457 Ga0105248_10014093
458 Ga0105238_10016414
459 Ga0105238_10112053
460 Ga0105238_10116190
461 Ga0105238_10414078
462 Ga0105249_10000838
463 Ga0105239_10118522
464 Ga0157373_10000879
465 Ga0157373_10015482
466 Ga0157370_10009953
467 Ga0157369_10455825
468 Ga0163162_10059972
469 Ga0163162_10116458
470 Ga0163162_11450565
471 Ga0157375_10231940
472 Ga0163163_10012064
473 Ga0163163_10087223
474 Ga0163163_10248343
475 Ga0163163_10366028
476 Ga0163163_10477673
477 Ga0157380_10146663
478 Ga0157379_10018883
479 Ga0157376_10493932
480 Ga0213876_10008313
481 Ga0213876_10137202
482 Ga0213875_10000053
483 Ga0209676_1000140
484 Ga0209676_1002399
485 Ga0209758_1001380
486 Ga0209050_1000053
487 Ga0209050_1024805
488 Ga0209257_1000292
489 Ga0209257_1000419
490 Ga0209257_1002736
491 Ga0209257_1083598
492 Ga0207680_10005098
493 Ga0207645_10152223
494 Ga0207705_10001195
495 Ga0207654_10210521
496 Ga0207707_10032448
497 Ga0207695_10000269
498 Ga0207695_10015201
499 Ga0207695_10076084
500 Ga0207660_10033019
501 Ga0207660_10116152
502 Ga0207657_10000235
503 Ga0207657_10238176
504 Ga0207652_10001724
505 Ga0207681_10229265
506 Ga0207694_10017435
507 Ga0207694_10105581
508 Ga0207694_10211805
509 Ga0207650_10000033
510 Ga0207644_10139634
511 Ga0207690_10000031
512 Ga0207690_10018445
513 Ga0207706_10047675
514 Ga0207686_10003342
515 Ga0207669_10614714
516 Ga0207704_10004551
517 Ga0207711_10000331
518 Ga0207711_10035362
519 Ga0207711_10303855
520 Ga0207661_10261813
521 Ga0207679_10057794
522 Ga0207679_10181305
523 Ga0207667_10033523
524 Ga0207667_10263509
525 Ga0207651_10135321
526 Ga0207712_10000651
527 Ga0207668_10000004
528 Ga0207668_10000426
529 Ga0207668_10018347
530 Ga0207668_10021380
531 Ga0207668_10761865
532 Ga0207658_10000229
533 Ga0207658_10024073
534 Ga0207658_10053000
535 Ga0207639_10036946
536 Ga0207702_10332147
537 Ga0207641_10001887
538 Ga0207641_10055756
539 Ga0207641_10076737
540 Ga0207676_10000068
541 Ga0207676_10041640
542 Ga0207676_10119436
543 Ga0207675_100030878
544 Ga0207683_10205676
545 Ga0207683_10282093
546 Ga0268266_10000003
547 Ga0268266_10001373
548 Ga0268266_10004139
549 Ga0268266_10072903
550 Ga0268266_10084536
551 Ga0268266_10930695
552 Ga0268265_10004547
553 Ga0268265_10103153
554 Ga0268265_10157983
555 Ga0268264_10000032
556 Ga0268264_10030197
557 Ga0265337_1003622
558 Ga0307517_10038138
559 Ga0265338_10019196
560 Ga0265338_10098538
561 Ga0307511_10004780
562 Ga0265327_10000331
563 Ga0265327_10000591
564 Ga0265327_10001088
565 Ga0307513_10025275
566 Ga0307508_10133853
567 Ga0265314_10277918
568 Ga0307410_10121312
569 Ga0307406_10000963
570 Ga0307414_10018376
571 Ga0307414_10080312
572 Ga0307414_10101378
573 Ga0307414_10354385
574 Ga0307414_10395448
575 Ga0307414_10409354
576 Ga0307414_10545524
577 Ga0307411_10031616
578 Ga0373934_0013861
579 Ga0373944_0002545
580 Ga0373936_0001805
581 Ga0373939_0135141
582 Ga0373957_0112990
583 Ga0373943_0139553
584 Ga0373943_0193036
585 Ga0373946_0141212
586 Ga0373955_0046631
587 Ga0373924_0022705
588 Ga0373927_0000111
589 Ga0373933_0000565
590 Ga0373933_0247848
591 Ga0373947_0039086
592 Ga0373947_0095102
593 Ga0373937_0006584
594 Ga0373937_0168962
595 Ga0373937_0464025
596 Ga0373925_0000209
597 Ga0373925_0021600
598 Ga0373925_0135379
599 Ga0395899_0002875
600 Ga0395899_0242936
601 Ga0395900_0000002
602 Ga0395900_0042203
603 Ga0395898_0004909
604 Ga0395898_0062705
605 Ga0395898_0134999
606 Ga0395898_0241605
607 Ga0395905_0076354
608 Ga0395905_0747593
609 Ga0395905_0757329
610 Ga0436364_0121626
611 Ga0395901_0000013
612 Ga0395901_0198689
613 Ga0395901_0221273
614 Ga0436365_0337983
615 Ga0436365_0961511
616 Ga0436360_1087198
617 Ga0466972_0183465
618 Ga0466961_0131153
619 Ga0466961_0228974
620 Ga0466968_0031679
621 Ga0466967_0635463
622 Ga0495592_0025358
623 Ga0495629_0001993
624 Ga0495629_0083946
625 Ga0495638_0164743
626 Ga0495651_0000136
627 Ga0495653_0001743
628 Ga0495664_0173716
629 Ga0495583_0031132
630 Ga0495620_0026678
631 Ga0495628_0045069
632 Ga0495628_0059706
633 Ga0495631_0174729
634 Ga0495643_0003478
635 Ga0495643_0294329
636 Ga0495643_0323181
637 Ga0495642_0055273
638 Ga0495652_0005586
639 Ga0495654_0040912
640 Ga0495665_0162625
641 Ga0495640_0001369
642 Ga0495587_0001140
643 Ga0495609_0018329
644 Ga0495597_0005187
645 Ga0495597_0005527
646 Ga0495645_0042832
647 Ga0495622_0006592
648 Ga0495633_0001899
649 Ga0495667_0000392
650 Ga0495668_0009231
651 Ga0495668_0045000
652 Ga0495668_0069443
653 Ga0495668_0205058
654 Ga0495634_0044299
655 Ga0495611_0010467
656 Ga0495611_0051424
657 Ga0495625_0087963
658 Ga0495635_0001645
659 Ga0495657_0002613
660 Ga0495599_0060536
661 Ga0495623_0001489
662 Ga0495646_0008281
663 Ga0495669_0044447
664 Ga0495624_0130445
665 Ga0495649_0000048
666 Ga0495600_0034397
667 Ga0495674_0000573
668 Ga0495674_0664516
669 Ga0495672_0258491
670 Ga0495680_0000285
671 Ga0495687_077061
672 Ga0495675_0008016
673 Ga0495677_0021352
674 Ga0495686_0011750
675 Ga0495602_0002627
676 Ga0495602_0184807
677 Ga0496100_0171874
678 Ga0496101_0319438
679 Ga0496102_0049042
680 Ga0496102_0344027
681 Ga0496103_0192531
682 Ga0496106_0131962
683 Ga0496109_0004453
684 Ga0496112_0012413
685 Ga0496112_0057392
686 Ga0496112_0081507
687 Ga0496115_0001609
688 Ga0496115_0003176
689 Ga0496115_0023013
690 Ga0496115_0035491
691 Ga0496115_0154124
692 Ga0496116_0076875
693 Ga0496122_0002925
694 Ga0496123_0005419
695 Ga0496125_0004796
696 Ga0495682_0051463
697 Ga0501034_0005426
698 Ga0501034_0355036
699 Ga0501036_0143828
700 Ga0501037_0043920
701 Ga0501037_0230604
702 Ga0501047_0007096
703 Ga0501047_0058652
704 Ga0501047_0208033
705 Ga0501047_0278951
706 Ga0501044_0003338
707 Ga0501044_0019605
708 Ga0501044_0212173
709 nmdc:mga00v17_1658_c1
710 nmdc:mga06z11_20990_c1
711 nmdc:mga05p37_632927_c1
712 nmdc:mga06r32_257055_c1
713 nmdc:mga0sz30_49639_c1
714 Ga0495601_0348829
715 Ga0495612_0029595
716 Ga0495595_0000996
717 Ga0495619_0000309
718 Ga0500578_0162040
719 Ga0500644_0048681
720 Ga0500583_0036900
721 Ga0500651_0008681
722 Ga0500651_0105076
723 Ga0500566_0026071
724 Ga0500650_0166730
725 Ga0500569_012335
726 Ga0500594_0061492
727 Ga0500595_018532
728 Ga0500595_069959
729 Ga0500607_148439
730 Ga0500608_039611
731 Ga0500652_202915
732 Ga0500655_009628
733 Ga0500559_0003202
734 Ga0500590_004837
735 Ga0500619_021130
736 Ga0500620_089906
737 Ga0500637_0050315
738 Ga0500576_058127
739 Ga0500625_015593
740 Ga0500645_000539
741 Ga0500552_025931
742 Ga0500596_003607
743 2644087633
744 2644344323
745 2644366992
746 2928532172
747 2928974608
748 2977243531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

66

243

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.7989 1 208
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.7922 1 208
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.7823 8 209
7cfe-assembly1.cif.gz_A crystal structure of rsmg methyltransferase of m. tuberculosis 0.7821 1 209
7cfe-assembly1.cif.gz_A crystal structure of rsmg methyltransferase of m. tuberculosis 0.7787 1 209
ID Description Score Start End Superfamily
af_P9WGW9_11_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8446 17 202 3.40.50.150
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8202 16 209 3.40.50.150
af_Q2FUQ4_1_237_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8123 6 209 3.40.50.150
af_Q54UI9_3_272_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8006 56 139 3.40.50.150
af_A0A1D6H089_1_96_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7967 94 152 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A841M2T0-F1-model_v4 deleted 0.9845 4 207
AF-B4RCZ9-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9819 1 207 GO:0005829
GO:0070043
AF-A0A4P7BSU1-F1-model_v4 deleted 0.9818 6 207
AF-A0A1R4FRJ2-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.981 6 207 GO:0005829
GO:0070043
AF-A0A1G2WLR0-F1-model_v4 deleted 0.9762 1 208

Map