F426764

General Info

Members Datasets Scaffolds Average Seq Length
374 239 361 214

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10018371|Ga0307513_100183714
Length 238
Sequence MPGNADAGPAPTGLMRSLVPLSAQIVLFDGFDPLDVVAPFEVLAAGSDALGGELHVELVSAEGPRAVVSGTLGLSLTATSALDPNRPGYVIVPGASGPVDGDPDEGVVTIPVLLARFADSAAAPLLQRALDNPEITVATVCGGSLTLAMAGLIDGRNAVTHTLGMDVLDATGVNAIRARVVDDGDLITSGGVTSGLDLALYLLDREFGPAIARAVEDLFEYERRGTVWHPGGRIPAAS

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
4 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
7 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
8 2922554459 Rhodococcus sp. 66b Isolate Unclassified
9 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
10 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
11 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
12 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
231 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0
Isolates 3.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.98
Nodule 0.27
Rhizoplane 7.22
Rhizosphere 66.31
Stem 0
Stem Tuber 0
Unclassified 7.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1008609 3300002070 Bacteria 1301
2 JGI24034J26672_10006309 3300002239 Bacteria 1710
3 JGI24742J22300_10000277 3300002244 Bacteria 7702
4 rootH2_10084464 3300003320 Bacteria 1963
5 rootL2_10000629 3300003322 Bacteria 5863
6 Ga0070676_10005818 3300005328 Bacteria 6575
7 Ga0070670_100173449 3300005331 Bacteria 1871
8 Ga0068869_100047434 3300005334 Bacteria 3103
9 Ga0070666_10069257 3300005335 Bacteria 2398
10 Ga0070682_100023647 3300005337 Bacteria 3650
11 Ga0070682_100165291 3300005337 Bacteria 1532
12 Ga0068868_100000852 3300005338 Bacteria 20723
13 Ga0070689_100063173 3300005340 Bacteria 2882
14 Ga0070668_100000348 3300005347 Bacteria 30448
15 Ga0070668_100025323 3300005347 Bacteria 4498
16 Ga0070669_100005145 3300005353 Bacteria 9456
17 Ga0070669_100039240 3300005353 Bacteria 3440
18 Ga0070671_100035062 3300005355 Bacteria 4156
19 Ga0070671_100133731 3300005355 Bacteria 2090
20 Ga0070671_100157372 3300005355 Bacteria 1920
21 Ga0070674_100048344 3300005356 Bacteria 2919
22 Ga0070688_100091955 3300005365 Bacteria 1984
23 Ga0070688_100114835 3300005365 Bacteria 1796
24 Ga0070659_100081022 3300005366 Bacteria 2592
25 Ga0070667_100028798 3300005367 Bacteria 4625
26 Ga0070667_100178347 3300005367 Bacteria 1878
27 Ga0070703_10076007 3300005406 Bacteria 1133
28 Ga0070714_100112936 3300005435 Bacteria 2408
29 Ga0070710_10006687 3300005437 Bacteria 5552
30 Ga0070710_10023716 3300005437 Bacteria 3229
31 Ga0070701_10023990 3300005438 Bacteria 2946
32 Ga0070711_100003584 3300005439 Bacteria 9057
33 Ga0070700_100001216 3300005441 Bacteria 12767
34 Ga0070694_100022061 3300005444 Bacteria 4078
35 Ga0070663_100015597 3300005455 Bacteria 4911
36 Ga0070678_100000588 3300005456 Bacteria 17852
37 Ga0070678_100044799 3300005456 Bacteria 3161
38 Ga0070662_100010912 3300005457 Bacteria 5986
39 Ga0070662_100030850 3300005457 Bacteria 3755
40 Ga0070685_10020544 3300005466 Bacteria 3575
41 Ga0068853_100000449 3300005539 Bacteria 28008
42 Ga0068853_100131807 3300005539 Bacteria 2238
43 Ga0070696_100001384 3300005546 Bacteria 15855
44 Ga0070665_100012266 3300005548 Bacteria 8640
45 Ga0070665_100017678 3300005548 Bacteria 7160
46 Ga0070665_100029560 3300005548 Bacteria 5515
47 Ga0070704_100057220 3300005549 Bacteria 2771
48 Ga0070704_100328119 3300005549 Bacteria 1284
49 Ga0068855_100920648 3300005563 Bacteria 923
50 Ga0068854_100000321 3300005578 Bacteria 31597
51 Ga0068854_100020641 3300005578 Bacteria 4462
52 Ga0070702_100003249 3300005615 Bacteria 7238
53 Ga0070702_100015337 3300005615 Bacteria 3911
54 Ga0068859_100001264 3300005617 Bacteria 25832
55 Ga0068866_10000072 3300005718 Bacteria 40253
56 Ga0068866_10045573 3300005718 Bacteria 2200
57 Ga0068861_100012179 3300005719 Bacteria 5995
58 Ga0068863_100004901 3300005841 Bacteria 13187
59 Ga0068863_100035950 3300005841 Bacteria 4718
60 Ga0068863_100369258 3300005841 Bacteria 1400
61 Ga0068858_100034728 3300005842 Bacteria 4677
62 Ga0068860_100096547 3300005843 Bacteria 2817
63 Ga0068860_100103365 3300005843 Bacteria 2719
64 Ga0068862_100252779 3300005844 Bacteria 1607
65 Ga0081455_10123068 3300005937 Bacteria 2041
66 Ga0075365_10000659 3300006038 Bacteria 13789
67 Ga0075365_10007501 3300006038 Bacteria 6116
68 Ga0075365_10041621 3300006038 Bacteria 3002
69 Ga0075365_10074121 3300006038 Bacteria 2295
70 Ga0075365_10242330 3300006038 Bacteria 1266
71 Ga0075365_10261110 3300006038 Bacteria 1218
72 Ga0075368_10028238 3300006042 Bacteria 2167
73 Ga0075368_10052875 3300006042 Bacteria 1616
74 Ga0075363_100006757 3300006048 Bacteria 5237
75 Ga0075363_100011679 3300006048 Bacteria 4213
76 Ga0075363_100015471 3300006048 Bacteria 3751
77 Ga0075363_100053381 3300006048 Bacteria 2160
78 Ga0075363_100215047 3300006048 Bacteria 1101
79 Ga0075363_100218895 3300006048 Bacteria 1091
80 Ga0075364_10001283 3300006051 Bacteria 13531
81 Ga0075364_10011230 3300006051 Bacteria 5438
82 Ga0075364_10013820 3300006051 Bacteria 4974
83 Ga0075364_10033457 3300006051 Bacteria 3311
84 Ga0075364_10046328 3300006051 Bacteria 2831
85 Ga0070716_100005828 3300006173 Bacteria 5984
86 Ga0070712_100003056 3300006175 Bacteria 10348
87 Ga0075362_10015812 3300006177 Bacteria 3077
88 Ga0075367_10002874 3300006178 Bacteria 8015
89 Ga0075367_10466125 3300006178 Bacteria 801
90 Ga0075369_10003757 3300006186 Bacteria 5552
91 Ga0075369_10029577 3300006186 Bacteria 2302
92 Ga0075369_10036457 3300006186 Bacteria 2093
93 Ga0075369_10066530 3300006186 Bacteria 1581
94 Ga0075369_10083886 3300006186 Bacteria 1416
95 Ga0075369_10089025 3300006186 Bacteria 1376
96 Ga0097621_100055767 3300006237 Bacteria 3228
97 Ga0075370_10020319 3300006353 Bacteria 3628
98 Ga0075370_10023669 3300006353 Bacteria 3385
99 Ga0075370_10094738 3300006353 Bacteria 1724
100 Ga0075370_10171987 3300006353 Bacteria 1273
101 Ga0075370_10272272 3300006353 Bacteria 1005
102 Ga0075428_100460570 3300006844 Bacteria 1362
103 Ga0075428_100921968 3300006844 Bacteria 926
104 Ga0075430_100006784 3300006846 Bacteria 9654
105 Ga0075430_100195743 3300006846 Bacteria 1679
106 Ga0068865_100000092 3300006881 Bacteria 47619
107 Ga0068865_100011103 3300006881 Bacteria 5626
108 Ga0097620_100001264 3300006931 Bacteria 25832
109 Ga0099795_10091013 3300007788 Bacteria 1182
110 Ga0111539_10273555 3300009094 Bacteria 1966
111 Ga0105245_10000740 3300009098 Bacteria 29493
112 Ga0105247_10002879 3300009101 Bacteria 11453
113 Ga0114129_10116184 3300009147 Bacteria 3687
114 Ga0105243_10087631 3300009148 Bacteria 2556
115 Ga0105241_10297636 3300009174 Bacteria 1384
116 Ga0105242_10001029 3300009176 Bacteria 21959
117 Ga0105248_10011025 3300009177 Bacteria 9970
118 Ga0105237_10015215 3300009545 Bacteria 8016
119 Ga0105237_10090935 3300009545 Bacteria 3041
120 Ga0105249_10000326 3300009553 Bacteria 48114
121 Ga0105249_10034588 3300009553 Bacteria 4580
122 Ga0105249_10042371 3300009553 Bacteria 4140
123 Ga0105239_10032412 3300010375 Bacteria 5742
124 Ga0105239_10936663 3300010375 Bacteria 995
125 Ga0157374_10016704 3300013296 Bacteria 6456
126 Ga0157374_10046836 3300013296 Bacteria 4006
127 Ga0157378_10097824 3300013297 Bacteria 2675
128 Ga0157378_10128780 3300013297 Bacteria 2340
129 Ga0157378_10194371 3300013297 Bacteria 1916
130 Ga0163162_10009393 3300013306 Bacteria 9512
131 Ga0157375_10000173 3300013308 Bacteria 59878
132 Ga0157375_10142034 3300013308 Bacteria 2529
133 Ga0163163_10174139 3300014325 Bacteria 2198
134 Ga0157380_10002118 3300014326 Bacteria 13313
135 Ga0157380_10494171 3300014326 Bacteria 1187
136 Ga0157377_10003675 3300014745 Bacteria 6959
137 Ga0157379_10022648 3300014968 Bacteria 5566
138 Ga0157376_10039574 3300014969 Bacteria 3847
139 Ga0163161_10008806 3300017792 Bacteria 6976
140 Ga0163161_10086034 3300017792 Bacteria 2320
141 Ga0207653_10133414 3300025885 Bacteria 903
142 Ga0207692_10009298 3300025898 Bacteria 4098
143 Ga0207642_10001453 3300025899 Bacteria 7336
144 Ga0207710_10002705 3300025900 Bacteria 8119
145 Ga0207688_10001118 3300025901 Bacteria 13776
146 Ga0207680_10012020 3300025903 Bacteria 4398
147 Ga0207685_10005032 3300025905 Bacteria 3440
148 Ga0207645_10019370 3300025907 Bacteria 4462
149 Ga0207654_10010069 3300025911 Bacteria 4808
150 Ga0207671_10042766 3300025914 Bacteria 3353
151 Ga0207693_10002084 3300025915 Bacteria 17484
152 Ga0207693_10003031 3300025915 Bacteria 14519
153 Ga0207663_10004971 3300025916 Bacteria 6661
154 Ga0207663_10005153 3300025916 Bacteria 6573
155 Ga0207662_10203793 3300025918 Bacteria 1282
156 Ga0207659_10100064 3300025926 Bacteria 2184
157 Ga0207687_10005304 3300025927 Bacteria 8538
158 Ga0207687_10048682 3300025927 Bacteria 2945
159 Ga0207644_10002286 3300025931 Bacteria 12435
160 Ga0207644_10097314 3300025931 Bacteria 2204
161 Ga0207706_10011358 3300025933 Bacteria 8116
162 Ga0207706_10028935 3300025933 Bacteria 4946
163 Ga0207686_10000642 3300025934 Bacteria 21566
164 Ga0207709_10005214 3300025935 Bacteria 7395
165 Ga0207709_10193182 3300025935 Bacteria 1448
166 Ga0207670_10014254 3300025936 Bacteria 4713
167 Ga0207669_10000403 3300025937 Bacteria 19046
168 Ga0207704_10000278 3300025938 Bacteria 24597
169 Ga0207704_10025454 3300025938 Bacteria 3229
170 Ga0207665_10008694 3300025939 Bacteria 6683
171 Ga0207665_10023249 3300025939 Bacteria 4082
172 Ga0207665_10147768 3300025939 Bacteria 1681
173 Ga0207711_10133426 3300025941 Bacteria 2228
174 Ga0207689_10061938 3300025942 Bacteria 3077
175 Ga0207712_10005773 3300025961 Bacteria 7797
176 Ga0207668_10004055 3300025972 Bacteria 8613
177 Ga0207640_10207538 3300025981 Bacteria 1490
178 Ga0207658_10046167 3300025986 Bacteria 3180
179 Ga0207658_10203582 3300025986 Bacteria 1654
180 Ga0207677_10002034 3300026023 Bacteria 10669
181 Ga0207703_10026835 3300026035 Bacteria 4536
182 Ga0207703_10308049 3300026035 Bacteria 1447
183 Ga0207703_10805357 3300026035 Bacteria 897
184 Ga0207639_10109177 3300026041 Bacteria 2251
185 Ga0207678_10026113 3300026067 Bacteria 5096
186 Ga0207708_10002489 3300026075 Bacteria 13555
187 Ga0207641_10003083 3300026088 Bacteria 15021
188 Ga0207648_10153299 3300026089 Bacteria 2034
189 Ga0207676_10238836 3300026095 Bacteria 1629
190 Ga0207675_100000056 3300026118 Bacteria 82104
191 Ga0207675_100018156 3300026118 Bacteria 6559
192 Ga0207675_100671664 3300026118 Bacteria 1043
193 Ga0207683_10000442 3300026121 Bacteria 38332
194 Ga0207683_10023766 3300026121 Bacteria 5272
195 Ga0207428_10208364 3300027907 Bacteria 1469
196 Ga0268266_10009992 3300028379 Bacteria 8332
197 Ga0268266_10048078 3300028379 Bacteria 3656
198 Ga0268265_10114558 3300028380 Bacteria 2208
199 Ga0268265_10232225 3300028380 Bacteria 1622
200 Ga0268264_10014022 3300028381 Bacteria 6590
201 Ga0307512_10006515 3300030522 Bacteria 11810
202 Ga0307513_10018371 3300031456 Bacteria 8358
203 Ga0307513_10103179 3300031456 Bacteria 2869
204 Ga0307405_10316587 3300031731 Bacteria 1190
205 Ga0307413_10339828 3300031824 Bacteria 1154
206 Ga0307413_10574111 3300031824 Bacteria 919
207 Ga0307518_10413256 3300031838 Bacteria 745
208 Ga0307409_101120216 3300031995 Bacteria 809
209 Ga0307414_10267558 3300032004 Bacteria 1430
210 Ga0307411_10256290 3300032005 Bacteria 1379
211 Ga0307411_10321992 3300032005 Bacteria 1249
212 Ga0307415_100305229 3300032126 Bacteria 1320
213 Ga0307415_100769763 3300032126 Bacteria 876
214 Ga0373931_0011276 3300035691 Bacteria 4317
215 Ga0373931_0173449 3300035691 Bacteria 1272
216 Ga0373925_0068457 3300037068 Bacteria 2680
217 Ga0439461_0037893 3300041410 Bacteria 1031
218 Ga0439466_0013615 3300041411 Bacteria 2975
219 Ga0439466_0089521 3300041411 Bacteria 966
220 Ga0439465_0002339 3300041413 Bacteria 6218
221 Ga0439465_0007815 3300041413 Bacteria 3389
222 Ga0439465_0008425 3300041413 Bacteria 3255
223 Ga0439465_0016245 3300041413 Bacteria 2322
224 Ga0451791_0192414 3300041451 Bacteria 1760
225 Ga0451837_0110099 3300041494 Bacteria 1323
226 Ga0439431_0006030 3300041997 Bacteria 2675
227 Ga0439431_0021299 3300041997 Bacteria 1555
228 Ga0439434_0034041 3300042435 Bacteria 1555
229 Ga0439435_0071223 3300042436 Bacteria 1029
230 Ga0466969_0044255 3300044656 Bacteria 2216
231 Ga0466972_0002980 3300044658 Bacteria 8379
232 Ga0466972_0028581 3300044658 Bacteria 2749
233 Ga0466972_0071946 3300044658 Bacteria 1649
234 Ga0466972_0227554 3300044658 Bacteria 873
235 Ga0466965_0001783 3300044683 Bacteria 8910
236 Ga0466965_0002399 3300044683 Bacteria 7948
237 Ga0466965_0240985 3300044683 Bacteria 968
238 Ga0466965_0303602 3300044683 Bacteria 866
239 Ga0466961_0339836 3300044693 Bacteria 914
240 Ga0466964_0066134 3300044706 Bacteria 1516
241 Ga0466971_0040253 3300044719 Bacteria 2099
242 Ga0466968_0004630 3300044735 Bacteria 5145
243 Ga0466968_0005896 3300044735 Bacteria 4600
244 Ga0466970_0021051 3300044765 Bacteria 3393
245 Ga0466970_0075004 3300044765 Bacteria 1821
246 Ga0466957_0007706 3300044842 Bacteria 6088
247 Ga0466960_0000211 3300044901 Bacteria 20062
248 Ga0466960_0105518 3300044901 Bacteria 1456
249 Ga0466959_0008948 3300045049 Bacteria 7103
250 Ga0466959_0166903 3300045049 Bacteria 1545
251 Ga0466958_0020630 3300045836 Bacteria 3845
252 Ga0466967_0582397 3300045976 Bacteria 1103
253 Ga0466967_1012078 3300045976 Bacteria 827
254 Ga0495638_0001104 3300046460 Bacteria 26279
255 Ga0495638_0041273 3300046460 Bacteria 2920
256 Ga0495594_0134837 3300046499 Bacteria 1399
257 Ga0495583_0146760 3300046506 Bacteria 979
258 Ga0495648_0009236 3300046524 Bacteria 7668
259 Ga0495635_0032574 3300046663 Bacteria 3616
260 Ga0495671_0234070 3300046692 Bacteria 888
261 Ga0495649_0101384 3300046694 Bacteria 1530
262 Ga0495672_0005446 3300047320 Bacteria 10097
263 Ga0495673_0000941 3300047469 Bacteria 26398
264 Ga0495686_0005515 3300047472 Bacteria 9955
265 Ga0496100_0000836 3300048903 Bacteria 14772
266 Ga0496101_0000056 3300048904 Bacteria 135446
267 Ga0496101_0001249 3300048904 Bacteria 15209
268 Ga0496102_0000177 3300048905 Bacteria 86724
269 Ga0496102_0193190 3300048905 Bacteria 1918
270 Ga0496102_0552061 3300048905 Bacteria 1075
271 Ga0496103_0000003 3300048906 Bacteria 603967
272 Ga0496104_0051355 3300048907 Bacteria 3892
273 Ga0496104_0068042 3300048907 Bacteria 3384
274 Ga0496105_0065136 3300048908 Bacteria 3008
275 Ga0496106_0072745 3300048909 Bacteria 2629
276 Ga0496106_0235534 3300048909 Bacteria 1462
277 Ga0496107_0000941 3300048910 Bacteria 17231
278 Ga0496107_0016107 3300048910 Bacteria 5245
279 Ga0496108_0002139 3300048911 Bacteria 15829
280 Ga0496108_0155589 3300048911 Bacteria 1974
281 Ga0496109_0010917 3300048912 Bacteria 7781
282 Ga0496109_0031523 3300048912 Bacteria 4758
283 Ga0496109_0199255 3300048912 Bacteria 1882
284 Ga0496110_0480551 3300048913 Bacteria 1132
285 Ga0496111_0084885 3300048914 Bacteria 2315
286 Ga0496112_0021081 3300048915 Bacteria 6190
287 Ga0496113_0091595 3300048916 Bacteria 2344
288 Ga0496113_0501509 3300048916 Bacteria 974
289 Ga0496114_0002818 3300048917 Bacteria 13320
290 Ga0496115_0172252 3300048918 Bacteria 1790
291 Ga0496116_0000013 3300048919 Bacteria 603993
292 Ga0496117_0000013 3300048920 Bacteria 603995
293 Ga0496118_0000011 3300048921 Bacteria 603995
294 Ga0496119_0007186 3300048922 Bacteria 10087
295 Ga0496119_0139098 3300048922 Bacteria 1313
296 Ga0496120_0025937 3300048923 Bacteria 3629
297 Ga0496121_0000060 3300048924 Bacteria 276682
298 Ga0496121_0281907 3300048924 Bacteria 1136
299 Ga0496122_0002352 3300048925 Bacteria 27214
300 Ga0496123_0001137 3300048926 Bacteria 39763
301 Ga0496126_0001363 3300048929 Bacteria 38686
302 Ga0496126_0005424 3300048929 Bacteria 14548
303 Ga0501031_0068397 3300049568 Bacteria 2314
304 Ga0501032_0005833 3300049569 Bacteria 9110
305 Ga0501033_0019687 3300049570 Bacteria 5100
306 Ga0501034_0006116 3300049571 Bacteria 12989
307 Ga0501034_0169240 3300049571 Bacteria 2153
308 Ga0501036_0006375 3300049572 Bacteria 9574
309 Ga0501037_0003791 3300049573 Bacteria 10967
310 Ga0501038_0016619 3300049574 Bacteria 6671
311 Ga0501039_0193519 3300049575 Bacteria 1599
312 Ga0501043_0005272 3300049579 Bacteria 10450
313 Ga0501046_0023811 3300049580 Bacteria 5031
314 Ga0501047_0007487 3300049581 Bacteria 10273
315 Ga0501047_0323298 3300049581 Bacteria 1382
316 Ga0501073_0007680 3300049589 Bacteria 8003
317 Ga0501080_0092853 3300049742 Bacteria 2803
318 Ga0501080_0690744 3300049742 Bacteria 901
319 Ga0501035_0006928 3300049822 Bacteria 10586
320 Ga0501044_0010541 3300049823 Bacteria 10025
321 nmdc:mga03683_18768_c2 3300050489 Bacteria 2003
322 nmdc:mga03683_46952_c1 3300050489 Bacteria 1791
323 nmdc:mga03n38_123718_c1 3300050490 Bacteria 1274
324 nmdc:mga03n38_13516_c1 3300050490 Bacteria 3104
325 nmdc:mga03n38_184191_c1 3300050490 Bacteria 1072
326 nmdc:mga03n38_88570_c1 3300050490 Bacteria 1469
327 nmdc:mga00v17_118293_c1 3300050491 Bacteria 1686
328 nmdc:mga00v17_1204_c1 3300050491 Bacteria 13566
329 nmdc:mga00v17_305624_c1 3300050491 Bacteria 1033
330 nmdc:mga00v17_39050_c1 3300050491 Bacteria 2841
331 nmdc:mga00v17_51551_c1 3300050491 Bacteria 2502
332 nmdc:mga00v17_5389_c1 3300050491 Bacteria 6738
333 nmdc:mga0yw44_234316_c1 3300050492 Bacteria 1219
334 nmdc:mga0yw44_33595_c1 3300050492 Bacteria 2998
335 nmdc:mga0yw44_34052_c1 3300050492 Bacteria 2982
336 nmdc:mga0yw44_47112_c1 3300050492 Bacteria 2593
337 nmdc:mga06z11_28670_c1 3300050494 Bacteria 2674
338 nmdc:mga07m45_12927_c1 3300050496 Bacteria 4417
339 nmdc:mga07m45_15951_c1 3300050496 Bacteria 4018
340 nmdc:mga07m45_358809_c1 3300050496 Bacteria 847
341 nmdc:mga07m45_5134_c1 3300050496 Bacteria 6484
342 nmdc:mga05p37_20525_c1 3300050507 Bacteria 7993
343 nmdc:mga0qj67_112891_c1 3300050509 Bacteria 2194
344 nmdc:mga08y16_398125_c1 3300050511 Bacteria 1410
345 nmdc:mga0sz30_1333_c2 3300050516 Bacteria 4976
346 nmdc:mga0sz30_204517_c1 3300050516 Bacteria 877
347 nmdc:mga0sz30_26641_c1 3300050516 Bacteria 2371
348 nmdc:mga0sz30_74514_c1 3300050516 Bacteria 1464
349 nmdc:mga0sz30_97603_c1 3300050516 Bacteria 1282
350 Ga0500635_0000059 3300053080 Bacteria 72321
351 Ga0500643_001717 3300053087 Bacteria 12170
352 Ga0500556_0025439 3300053104 Bacteria 1956
353 Ga0500652_000245 3300053131 Bacteria 20504
354 Ga0500652_073079 3300053131 Bacteria 1423
355 Ga0500559_0055365 3300053136 Bacteria 1759
356 Ga0500579_168066 3300053143 Unclassified 902
357 Ga0500616_0000088 3300053153 Bacteria 191662
358 Ga0500616_0007108 3300053153 Bacteria 7175
359 Ga0500616_0042582 3300053153 Bacteria 2431
360 Ga0500627_0026662 3300053158 Bacteria 2388
361 Ga0500645_000183 3300053730 Bacteria 49065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10174139 Ga0163163_101741393 162
2 3300026035 Ga0207703_10308049 Ga0207703_103080493 167
3 3300025939 Ga0207665_10147768 Ga0207665_101477683 194
4 iso_pu_bacteria 2917736166 2917742606 200
5 3300025918 Ga0207662_10203793 Ga0207662_102037932 202
6 3300025941 Ga0207711_10133426 Ga0207711_101334263 202
7 3300025942 Ga0207689_10061938 Ga0207689_100619383 202
8 3300048929 Ga0496126_0001363 Ga0496126_0001363_2529_3266 202
9 3300050496 nmdc:mga07m45_5134_c1 nmdc:mga07m45_5134_c1_3738_4349 202
10 iso_pu_bacteria 2758568522 2760306038 202
11 3300027907 Ga0207428_10208364 Ga0207428_102083642 203
12 3300048913 Ga0496110_0480551 Ga0496110_0480551_20_634 203
13 iso_pu_bacteria 2738541274 2738705360 204
14 iso_pu_bacteria 2738543028 2739334535 204
15 iso_pu_bacteria 2751185782 2753267871 204
16 iso_pu_bacteria 2842134933 2842137388 204
17 iso_pu_bacteria 2902792274 2902796937 204
18 iso_pu_bacteria 2922554459 2922555132 204
19 iso_pu_bacteria 2929212328 2929212847 204
20 iso_pu_bacteria 2939582691 2939588459 204
21 3300003322 rootL2_10000629 rootL2_100006294 205
22 3300053153 Ga0500616_0000088 Ga0500616_0000088_148037_148795 206
23 iso_pu_bacteria 2932398195 2932398565 206
24 iso_pu_bacteria 8056579771 8056581271 206
25 3300041451 Ga0451791_0192414 Ga0451791_0192414_253_912 207
26 3300041494 Ga0451837_0110099 Ga0451837_0110099_136_795 207
27 iso_pu_bacteria 2929226422 2929228271 207
28 3300002070 JGI24750J21931_1008609 JGI24750J21931_10086092 208
29 3300002239 JGI24034J26672_10006309 JGI24034J26672_100063091 208
30 3300002244 JGI24742J22300_10000277 JGI24742J22300_100002772 208
31 3300003320 rootH2_10084464 rootH2_100844643 208
32 3300005328 Ga0070676_10005818 Ga0070676_100058185 208
33 3300005331 Ga0070670_100173449 Ga0070670_1001734491 208
34 3300005334 Ga0068869_100047434 Ga0068869_1000474342 208
35 3300005335 Ga0070666_10069257 Ga0070666_100692572 208
36 3300005337 Ga0070682_100023647 Ga0070682_1000236474 208
37 3300005337 Ga0070682_100165291 Ga0070682_1001652911 208
38 3300005338 Ga0068868_100000852 Ga0068868_1000008523 208
39 3300005340 Ga0070689_100063173 Ga0070689_1000631734 208
40 3300005347 Ga0070668_100000348 Ga0070668_10000034823 208
41 3300005347 Ga0070668_100025323 Ga0070668_1000253233 208
42 3300005353 Ga0070669_100005145 Ga0070669_1000051452 208
43 3300005353 Ga0070669_100039240 Ga0070669_1000392403 208
44 3300005355 Ga0070671_100035062 Ga0070671_1000350621 208
45 3300005355 Ga0070671_100133731 Ga0070671_1001337311 208
46 3300005355 Ga0070671_100157372 Ga0070671_1001573722 208
47 3300005356 Ga0070674_100048344 Ga0070674_1000483443 208
48 3300005365 Ga0070688_100091955 Ga0070688_1000919552 208
49 3300005365 Ga0070688_100114835 Ga0070688_1001148352 208
50 3300005366 Ga0070659_100081022 Ga0070659_1000810223 208
51 3300005367 Ga0070667_100028798 Ga0070667_1000287984 208
52 3300005367 Ga0070667_100178347 Ga0070667_1001783472 208
53 3300005406 Ga0070703_10076007 Ga0070703_100760072 208
54 3300005435 Ga0070714_100112936 Ga0070714_1001129364 208
55 3300005437 Ga0070710_10006687 Ga0070710_100066873 208
56 3300005437 Ga0070710_10023716 Ga0070710_100237164 208
57 3300005438 Ga0070701_10023990 Ga0070701_100239904 208
58 3300005439 Ga0070711_100003584 Ga0070711_1000035846 208
59 3300005441 Ga0070700_100001216 Ga0070700_1000012168 208
60 3300005444 Ga0070694_100022061 Ga0070694_1000220613 208
61 3300005455 Ga0070663_100015597 Ga0070663_1000155975 208
62 3300005456 Ga0070678_100000588 Ga0070678_10000058821 208
63 3300005456 Ga0070678_100044799 Ga0070678_1000447992 208
64 3300005457 Ga0070662_100010912 Ga0070662_1000109125 208
65 3300005457 Ga0070662_100030850 Ga0070662_1000308503 208
66 3300005466 Ga0070685_10020544 Ga0070685_100205444 208
67 3300005539 Ga0068853_100000449 Ga0068853_1000004499 208
68 3300005539 Ga0068853_100131807 Ga0068853_1001318073 208
69 3300005546 Ga0070696_100001384 Ga0070696_10000138417 208
70 3300005548 Ga0070665_100012266 Ga0070665_1000122663 208
71 3300005548 Ga0070665_100017678 Ga0070665_1000176782 208
72 3300005548 Ga0070665_100029560 Ga0070665_1000295604 208
73 3300005549 Ga0070704_100057220 Ga0070704_1000572204 208
74 3300005549 Ga0070704_100328119 Ga0070704_1003281191 208
75 3300005563 Ga0068855_100920648 Ga0068855_1009206482 208
76 3300005578 Ga0068854_100000321 Ga0068854_10000032136 208
77 3300005578 Ga0068854_100020641 Ga0068854_1000206413 208
78 3300005615 Ga0070702_100003249 Ga0070702_1000032496 208
79 3300005615 Ga0070702_100015337 Ga0070702_1000153374 208
80 3300005617 Ga0068859_100001264 Ga0068859_10000126427 208
81 3300005718 Ga0068866_10000072 Ga0068866_1000007214 208
82 3300005718 Ga0068866_10045573 Ga0068866_100455732 208
83 3300005719 Ga0068861_100012179 Ga0068861_1000121795 208
84 3300005841 Ga0068863_100004901 Ga0068863_10000490110 208
85 3300005841 Ga0068863_100035950 Ga0068863_1000359504 208
86 3300005841 Ga0068863_100369258 Ga0068863_1003692582 208
87 3300005842 Ga0068858_100034728 Ga0068858_1000347282 208
88 3300005843 Ga0068860_100096547 Ga0068860_1000965473 208
89 3300005843 Ga0068860_100103365 Ga0068860_1001033653 208
90 3300005844 Ga0068862_100252779 Ga0068862_1002527792 208
91 3300005937 Ga0081455_10123068 Ga0081455_101230682 208
92 3300006038 Ga0075365_10000659 Ga0075365_1000065913 208
93 3300006038 Ga0075365_10007501 Ga0075365_100075014 208
94 3300006038 Ga0075365_10041621 Ga0075365_100416215 208
95 3300006038 Ga0075365_10074121 Ga0075365_100741212 208
96 3300006038 Ga0075365_10242330 Ga0075365_102423302 208
97 3300006038 Ga0075365_10261110 Ga0075365_102611102 208
98 3300006042 Ga0075368_10028238 Ga0075368_100282382 208
99 3300006042 Ga0075368_10052875 Ga0075368_100528752 208
100 3300006048 Ga0075363_100006757 Ga0075363_1000067575 208
101 3300006048 Ga0075363_100011679 Ga0075363_1000116793 208
102 3300006048 Ga0075363_100015471 Ga0075363_1000154712 208
103 3300006048 Ga0075363_100053381 Ga0075363_1000533812 208
104 3300006048 Ga0075363_100215047 Ga0075363_1002150471 208
105 3300006048 Ga0075363_100218895 Ga0075363_1002188951 208
106 3300006051 Ga0075364_10001283 Ga0075364_100012832 208
107 3300006051 Ga0075364_10011230 Ga0075364_100112303 208
108 3300006051 Ga0075364_10013820 Ga0075364_100138202 208
109 3300006051 Ga0075364_10033457 Ga0075364_100334572 208
110 3300006051 Ga0075364_10046328 Ga0075364_100463282 208
111 3300006173 Ga0070716_100005828 Ga0070716_1000058282 208
112 3300006175 Ga0070712_100003056 Ga0070712_1000030562 208
113 3300006177 Ga0075362_10015812 Ga0075362_100158122 208
114 3300006178 Ga0075367_10002874 Ga0075367_100028743 208
115 3300006178 Ga0075367_10466125 Ga0075367_104661251 208
116 3300006186 Ga0075369_10003757 Ga0075369_100037577 208
117 3300006186 Ga0075369_10029577 Ga0075369_100295773 208
118 3300006186 Ga0075369_10036457 Ga0075369_100364573 208
119 3300006186 Ga0075369_10066530 Ga0075369_100665303 208
120 3300006186 Ga0075369_10083886 Ga0075369_100838862 208
121 3300006186 Ga0075369_10089025 Ga0075369_100890252 208
122 3300006237 Ga0097621_100055767 Ga0097621_1000557674 208
123 3300006353 Ga0075370_10020319 Ga0075370_100203193 208
124 3300006353 Ga0075370_10023669 Ga0075370_100236693 208
125 3300006353 Ga0075370_10094738 Ga0075370_100947382 208
126 3300006353 Ga0075370_10171987 Ga0075370_101719872 208
127 3300006353 Ga0075370_10272272 Ga0075370_102722722 208
128 3300006844 Ga0075428_100460570 Ga0075428_1004605702 208
129 3300006844 Ga0075428_100921968 Ga0075428_1009219682 208
130 3300006846 Ga0075430_100006784 Ga0075430_1000067844 208
131 3300006846 Ga0075430_100195743 Ga0075430_1001957432 208
132 3300006881 Ga0068865_100000092 Ga0068865_1000000922 208
133 3300006881 Ga0068865_100011103 Ga0068865_1000111032 208
134 3300006931 Ga0097620_100001264 Ga0097620_10000126427 208
135 3300007788 Ga0099795_10091013 Ga0099795_100910131 208
136 3300009094 Ga0111539_10273555 Ga0111539_102735552 208
137 3300009098 Ga0105245_10000740 Ga0105245_100007404 208
138 3300009101 Ga0105247_10002879 Ga0105247_100028796 208
139 3300009147 Ga0114129_10116184 Ga0114129_101161843 208
140 3300009148 Ga0105243_10087631 Ga0105243_100876312 208
141 3300009174 Ga0105241_10297636 Ga0105241_102976362 208
142 3300009176 Ga0105242_10001029 Ga0105242_100010295 208
143 3300009177 Ga0105248_10011025 Ga0105248_100110259 208
144 3300009545 Ga0105237_10015215 Ga0105237_100152154 208
145 3300009545 Ga0105237_10090935 Ga0105237_100909353 208
146 3300009553 Ga0105249_10000326 Ga0105249_1000032617 208
147 3300009553 Ga0105249_10034588 Ga0105249_100345882 208
148 3300009553 Ga0105249_10042371 Ga0105249_100423713 208
149 3300010375 Ga0105239_10032412 Ga0105239_100324123 208
150 3300010375 Ga0105239_10936663 Ga0105239_109366631 208
151 3300013296 Ga0157374_10016704 Ga0157374_100167042 208
152 3300013296 Ga0157374_10046836 Ga0157374_100468365 208
153 3300013297 Ga0157378_10097824 Ga0157378_100978242 208
154 3300013297 Ga0157378_10128780 Ga0157378_101287802 208
155 3300013297 Ga0157378_10194371 Ga0157378_101943711 208
156 3300013306 Ga0163162_10009393 Ga0163162_1000939311 208
157 3300013308 Ga0157375_10000173 Ga0157375_1000017335 208
158 3300013308 Ga0157375_10142034 Ga0157375_101420342 208
159 3300014326 Ga0157380_10002118 Ga0157380_1000211812 208
160 3300014326 Ga0157380_10494171 Ga0157380_104941712 208
161 3300014745 Ga0157377_10003675 Ga0157377_100036755 208
162 3300014968 Ga0157379_10022648 Ga0157379_100226484 208
163 3300014969 Ga0157376_10039574 Ga0157376_100395743 208
164 3300017792 Ga0163161_10008806 Ga0163161_100088063 208
165 3300017792 Ga0163161_10086034 Ga0163161_100860343 208
166 3300025885 Ga0207653_10133414 Ga0207653_101334142 208
167 3300025898 Ga0207692_10009298 Ga0207692_100092984 208
168 3300025899 Ga0207642_10001453 Ga0207642_100014532 208
169 3300025900 Ga0207710_10002705 Ga0207710_100027052 208
170 3300025901 Ga0207688_10001118 Ga0207688_1000111814 208
171 3300025903 Ga0207680_10012020 Ga0207680_100120203 208
172 3300025905 Ga0207685_10005032 Ga0207685_100050322 208
173 3300025907 Ga0207645_10019370 Ga0207645_100193704 208
174 3300025911 Ga0207654_10010069 Ga0207654_100100695 208
175 3300025914 Ga0207671_10042766 Ga0207671_100427663 208
176 3300025915 Ga0207693_10002084 Ga0207693_100020844 208
177 3300025915 Ga0207693_10003031 Ga0207693_100030316 208
178 3300025916 Ga0207663_10004971 Ga0207663_100049713 208
179 3300025916 Ga0207663_10005153 Ga0207663_100051536 208
180 3300025926 Ga0207659_10100064 Ga0207659_101000642 208
181 3300025927 Ga0207687_10005304 Ga0207687_100053046 208
182 3300025927 Ga0207687_10048682 Ga0207687_100486823 208
183 3300025931 Ga0207644_10002286 Ga0207644_100022863 208
184 3300025931 Ga0207644_10097314 Ga0207644_100973142 208
185 3300025933 Ga0207706_10011358 Ga0207706_100113585 208
186 3300025933 Ga0207706_10028935 Ga0207706_100289353 208
187 3300025934 Ga0207686_10000642 Ga0207686_100006427 208
188 3300025935 Ga0207709_10005214 Ga0207709_100052146 208
189 3300025935 Ga0207709_10193182 Ga0207709_101931822 208
190 3300025936 Ga0207670_10014254 Ga0207670_100142544 208
191 3300025937 Ga0207669_10000403 Ga0207669_1000040317 208
192 3300025938 Ga0207704_10000278 Ga0207704_100002785 208
193 3300025938 Ga0207704_10025454 Ga0207704_100254543 208
194 3300025939 Ga0207665_10008694 Ga0207665_100086945 208
195 3300025939 Ga0207665_10023249 Ga0207665_100232494 208
196 3300025961 Ga0207712_10005773 Ga0207712_100057732 208
197 3300025972 Ga0207668_10004055 Ga0207668_100040556 208
198 3300025981 Ga0207640_10207538 Ga0207640_102075383 208
199 3300025986 Ga0207658_10046167 Ga0207658_100461673 208
200 3300025986 Ga0207658_10203582 Ga0207658_102035823 208
201 3300026023 Ga0207677_10002034 Ga0207677_1000203411 208
202 3300026035 Ga0207703_10026835 Ga0207703_100268352 208
203 3300026035 Ga0207703_10805357 Ga0207703_108053572 208
204 3300026041 Ga0207639_10109177 Ga0207639_101091772 208
205 3300026067 Ga0207678_10026113 Ga0207678_100261132 208
206 3300026075 Ga0207708_10002489 Ga0207708_100024898 208
207 3300026088 Ga0207641_10003083 Ga0207641_1000308312 208
208 3300026089 Ga0207648_10153299 Ga0207648_101532992 208
209 3300026095 Ga0207676_10238836 Ga0207676_102388362 208
210 3300026118 Ga0207675_100000056 Ga0207675_10000005634 208
211 3300026118 Ga0207675_100018156 Ga0207675_1000181563 208
212 3300026118 Ga0207675_100671664 Ga0207675_1006716642 208
213 3300026121 Ga0207683_10000442 Ga0207683_1000044234 208
214 3300026121 Ga0207683_10023766 Ga0207683_100237662 208
215 3300028379 Ga0268266_10009992 Ga0268266_100099923 208
216 3300028379 Ga0268266_10048078 Ga0268266_100480782 208
217 3300028380 Ga0268265_10114558 Ga0268265_101145582 208
218 3300028380 Ga0268265_10232225 Ga0268265_102322252 208
219 3300028381 Ga0268264_10014022 Ga0268264_100140225 208
220 3300030522 Ga0307512_10006515 Ga0307512_1000651512 208
221 3300031456 Ga0307513_10018371 Ga0307513_100183714 208
222 3300031456 Ga0307513_10103179 Ga0307513_101031791 208
223 3300031731 Ga0307405_10316587 Ga0307405_103165872 208
224 3300031824 Ga0307413_10339828 Ga0307413_103398282 208
225 3300031824 Ga0307413_10574111 Ga0307413_105741111 208
226 3300031838 Ga0307518_10413256 Ga0307518_104132561 208
227 3300031995 Ga0307409_101120216 Ga0307409_1011202161 208
228 3300032004 Ga0307414_10267558 Ga0307414_102675582 208
229 3300032005 Ga0307411_10256290 Ga0307411_102562902 208
230 3300032005 Ga0307411_10321992 Ga0307411_103219922 208
231 3300032126 Ga0307415_100305229 Ga0307415_1003052292 208
232 3300032126 Ga0307415_100769763 Ga0307415_1007697632 208
233 3300035691 Ga0373931_0011276 Ga0373931_0011276_335_961 208
234 3300035691 Ga0373931_0173449 Ga0373931_0173449_418_1095 208
235 3300037068 Ga0373925_0068457 Ga0373925_0068457_1145_1804 208
236 3300041410 Ga0439461_0037893 Ga0439461_0037893_312_965 208
237 3300041411 Ga0439466_0013615 Ga0439466_0013615_1058_1711 208
238 3300041411 Ga0439466_0089521 Ga0439466_0089521_288_926 208
239 3300041413 Ga0439465_0002339 Ga0439465_0002339_1258_1911 208
240 3300041413 Ga0439465_0007815 Ga0439465_0007815_1381_2007 208
241 3300041413 Ga0439465_0008425 Ga0439465_0008425_2494_3123 208
242 3300041413 Ga0439465_0016245 Ga0439465_0016245_896_1525 208
243 3300041997 Ga0439431_0006030 Ga0439431_0006030_1376_2029 208
244 3300041997 Ga0439431_0021299 Ga0439431_0021299_872_1498 208
245 3300042435 Ga0439434_0034041 Ga0439434_0034041_257_910 208
246 3300042436 Ga0439435_0071223 Ga0439435_0071223_302_928 208
247 3300044656 Ga0466969_0044255 Ga0466969_0044255_86_739 208
248 3300044658 Ga0466972_0002980 Ga0466972_0002980_7261_7917 208
249 3300044658 Ga0466972_0028581 Ga0466972_0028581_679_1332 208
250 3300044658 Ga0466972_0071946 Ga0466972_0071946_37_666 208
251 3300044658 Ga0466972_0227554 Ga0466972_0227554_158_784 208
252 3300044683 Ga0466965_0001783 Ga0466965_0001783_7452_8105 208
253 3300044683 Ga0466965_0002399 Ga0466965_0002399_5362_6018 208
254 3300044683 Ga0466965_0240985 Ga0466965_0240985_179_835 208
255 3300044683 Ga0466965_0303602 Ga0466965_0303602_141_794 208
256 3300044693 Ga0466961_0339836 Ga0466961_0339836_121_774 208
257 3300044706 Ga0466964_0066134 Ga0466964_0066134_601_1254 208
258 3300044719 Ga0466971_0040253 Ga0466971_0040253_144_797 208
259 3300044735 Ga0466968_0004630 Ga0466968_0004630_836_1489 208
260 3300044735 Ga0466968_0005896 Ga0466968_0005896_1164_1820 208
261 3300044765 Ga0466970_0021051 Ga0466970_0021051_1907_2560 208
262 3300044765 Ga0466970_0075004 Ga0466970_0075004_10_663 208
263 3300044842 Ga0466957_0007706 Ga0466957_0007706_1779_2432 208
264 3300044901 Ga0466960_0000211 Ga0466960_0000211_2918_3574 208
265 3300044901 Ga0466960_0105518 Ga0466960_0105518_611_1264 208
266 3300045049 Ga0466959_0008948 Ga0466959_0008948_508_1161 208
267 3300045049 Ga0466959_0166903 Ga0466959_0166903_296_949 208
268 3300045836 Ga0466958_0020630 Ga0466958_0020630_3052_3705 208
269 3300045976 Ga0466967_0582397 Ga0466967_0582397_196_861 208
270 3300045976 Ga0466967_1012078 Ga0466967_1012078_109_738 208
271 3300046460 Ga0495638_0001104 Ga0495638_0001104_2042_2719 208
272 3300046460 Ga0495638_0041273 Ga0495638_0041273_614_1270 208
273 3300046499 Ga0495594_0134837 Ga0495594_0134837_369_1004 208
274 3300046506 Ga0495583_0146760 Ga0495583_0146760_183_860 208
275 3300046524 Ga0495648_0009236 Ga0495648_0009236_2981_3658 208
276 3300046663 Ga0495635_0032574 Ga0495635_0032574_1953_2579 208
277 3300046692 Ga0495671_0234070 Ga0495671_0234070_171_848 208
278 3300046694 Ga0495649_0101384 Ga0495649_0101384_664_1341 208
279 3300047320 Ga0495672_0005446 Ga0495672_0005446_4567_5244 208
280 3300047469 Ga0495673_0000941 Ga0495673_0000941_23589_24266 208
281 3300047472 Ga0495686_0005515 Ga0495686_0005515_2927_3583 208
282 3300048903 Ga0496100_0000836 Ga0496100_0000836_3268_3894 208
283 3300048904 Ga0496101_0000056 Ga0496101_0000056_38745_39371 208
284 3300048904 Ga0496101_0001249 Ga0496101_0001249_13624_14250 208
285 3300048905 Ga0496102_0000177 Ga0496102_0000177_38969_39595 208
286 3300048905 Ga0496102_0193190 Ga0496102_0193190_587_1267 208
287 3300048905 Ga0496102_0552061 Ga0496102_0552061_352_978 208
288 3300048906 Ga0496103_0000003 Ga0496103_0000003_47130_47756 208
289 3300048907 Ga0496104_0051355 Ga0496104_0051355_324_956 208
290 3300048907 Ga0496104_0068042 Ga0496104_0068042_425_1105 208
291 3300048908 Ga0496105_0065136 Ga0496105_0065136_1282_1908 208
292 3300048909 Ga0496106_0072745 Ga0496106_0072745_914_1540 208
293 3300048909 Ga0496106_0235534 Ga0496106_0235534_88_765 208
294 3300048910 Ga0496107_0000941 Ga0496107_0000941_6779_7405 208
295 3300048910 Ga0496107_0016107 Ga0496107_0016107_2916_3542 208
296 3300048911 Ga0496108_0002139 Ga0496108_0002139_12865_13545 208
297 3300048911 Ga0496108_0155589 Ga0496108_0155589_961_1587 208
298 3300048912 Ga0496109_0010917 Ga0496109_0010917_6174_6854 208
299 3300048912 Ga0496109_0031523 Ga0496109_0031523_1980_2606 208
300 3300048912 Ga0496109_0199255 Ga0496109_0199255_887_1519 208
301 3300048914 Ga0496111_0084885 Ga0496111_0084885_1665_2297 208
302 3300048915 Ga0496112_0021081 Ga0496112_0021081_4410_5042 208
303 3300048916 Ga0496113_0091595 Ga0496113_0091595_91_771 208
304 3300048916 Ga0496113_0501509 Ga0496113_0501509_141_773 208
305 3300048917 Ga0496114_0002818 Ga0496114_0002818_4532_5158 208
306 3300048918 Ga0496115_0172252 Ga0496115_0172252_38_715 208
307 3300048919 Ga0496116_0000013 Ga0496116_0000013_556238_556864 208
308 3300048920 Ga0496117_0000013 Ga0496117_0000013_47130_47756 208
309 3300048921 Ga0496118_0000011 Ga0496118_0000011_556240_556866 208
310 3300048922 Ga0496119_0007186 Ga0496119_0007186_8997_9623 208
311 3300048922 Ga0496119_0139098 Ga0496119_0139098_494_1120 208
312 3300048923 Ga0496120_0025937 Ga0496120_0025937_1518_2144 208
313 3300048924 Ga0496121_0000060 Ga0496121_0000060_179847_180473 208
314 3300048924 Ga0496121_0281907 Ga0496121_0281907_329_982 208
315 3300048925 Ga0496122_0002352 Ga0496122_0002352_14069_14722 208
316 3300048926 Ga0496123_0001137 Ga0496123_0001137_36481_37134 208
317 3300048929 Ga0496126_0005424 Ga0496126_0005424_3174_3800 208
318 3300049568 Ga0501031_0068397 Ga0501031_0068397_1185_1844 208
319 3300049569 Ga0501032_0005833 Ga0501032_0005833_1816_2475 208
320 3300049570 Ga0501033_0019687 Ga0501033_0019687_1722_2381 208
321 3300049571 Ga0501034_0006116 Ga0501034_0006116_8495_9154 208
322 3300049571 Ga0501034_0169240 Ga0501034_0169240_1514_2140 208
323 3300049572 Ga0501036_0006375 Ga0501036_0006375_6182_6841 208
324 3300049573 Ga0501037_0003791 Ga0501037_0003791_3673_4332 208
325 3300049574 Ga0501038_0016619 Ga0501038_0016619_5799_6458 208
326 3300049575 Ga0501039_0193519 Ga0501039_0193519_413_1072 208
327 3300049579 Ga0501043_0005272 Ga0501043_0005272_3029_3688 208
328 3300049580 Ga0501046_0023811 Ga0501046_0023811_3721_4380 208
329 3300049581 Ga0501047_0007487 Ga0501047_0007487_6183_6842 208
330 3300049581 Ga0501047_0323298 Ga0501047_0323298_310_939 208
331 3300049589 Ga0501073_0007680 Ga0501073_0007680_4401_5060 208
332 3300049742 Ga0501080_0092853 Ga0501080_0092853_633_1292 208
333 3300049742 Ga0501080_0690744 Ga0501080_0690744_65_694 208
334 3300049822 Ga0501035_0006928 Ga0501035_0006928_3745_4404 208
335 3300049823 Ga0501044_0010541 Ga0501044_0010541_6183_6842 208
336 3300050489 nmdc:mga03683_18768_c2 nmdc:mga03683_18768_c2_593_1222 208
337 3300050489 nmdc:mga03683_46952_c1 nmdc:mga03683_46952_c1_471_1100 208
338 3300050490 nmdc:mga03n38_123718_c1 nmdc:mga03n38_123718_c1_146_775 208
339 3300050490 nmdc:mga03n38_13516_c1 nmdc:mga03n38_13516_c1_1388_2017 208
340 3300050490 nmdc:mga03n38_184191_c1 nmdc:mga03n38_184191_c1_402_1031 208
341 3300050490 nmdc:mga03n38_88570_c1 nmdc:mga03n38_88570_c1_35_664 208
342 3300050491 nmdc:mga00v17_118293_c1 nmdc:mga00v17_118293_c1_24_653 208
343 3300050491 nmdc:mga00v17_1204_c1 nmdc:mga00v17_1204_c1_3768_4394 208
344 3300050491 nmdc:mga00v17_305624_c1 nmdc:mga00v17_305624_c1_29_685 208
345 3300050491 nmdc:mga00v17_39050_c1 nmdc:mga00v17_39050_c1_1215_1844 208
346 3300050491 nmdc:mga00v17_51551_c1 nmdc:mga00v17_51551_c1_611_1312 208
347 3300050491 nmdc:mga00v17_5389_c1 nmdc:mga00v17_5389_c1_2096_2725 208
348 3300050492 nmdc:mga0yw44_234316_c1 nmdc:mga0yw44_234316_c1_520_1146 208
349 3300050492 nmdc:mga0yw44_33595_c1 nmdc:mga0yw44_33595_c1_1556_2212 208
350 3300050492 nmdc:mga0yw44_34052_c1 nmdc:mga0yw44_34052_c1_303_932 208
351 3300050492 nmdc:mga0yw44_47112_c1 nmdc:mga0yw44_47112_c1_1088_1717 208
352 3300050494 nmdc:mga06z11_28670_c1 nmdc:mga06z11_28670_c1_37_666 208
353 3300050496 nmdc:mga07m45_12927_c1 nmdc:mga07m45_12927_c1_3196_3825 208
354 3300050496 nmdc:mga07m45_15951_c1 nmdc:mga07m45_15951_c1_2011_2640 208
355 3300050496 nmdc:mga07m45_358809_c1 nmdc:mga07m45_358809_c1_71_700 208
356 3300050507 nmdc:mga05p37_20525_c1 nmdc:mga05p37_20525_c1_1448_2074 208
357 3300050509 nmdc:mga0qj67_112891_c1 nmdc:mga0qj67_112891_c1_617_1243 208
358 3300050511 nmdc:mga08y16_398125_c1 nmdc:mga08y16_398125_c1_308_934 208
359 3300050516 nmdc:mga0sz30_1333_c2 nmdc:mga0sz30_1333_c2_3766_4392 208
360 3300050516 nmdc:mga0sz30_204517_c1 nmdc:mga0sz30_204517_c1_239_865 208
361 3300050516 nmdc:mga0sz30_26641_c1 nmdc:mga0sz30_26641_c1_964_1590 208
362 3300050516 nmdc:mga0sz30_74514_c1 nmdc:mga0sz30_74514_c1_619_1302 208
363 3300050516 nmdc:mga0sz30_97603_c1 nmdc:mga0sz30_97603_c1_262_915 208
364 3300053080 Ga0500635_0000059 Ga0500635_0000059_13321_13983 208
365 3300053087 Ga0500643_001717 Ga0500643_001717_6020_6646 208
366 3300053104 Ga0500556_0025439 Ga0500556_0025439_885_1562 208
367 3300053131 Ga0500652_000245 Ga0500652_000245_6049_6705 208
368 3300053131 Ga0500652_073079 Ga0500652_073079_394_1050 208
369 3300053136 Ga0500559_0055365 Ga0500559_0055365_1032_1688 208
370 3300053143 Ga0500579_168066 Ga0500579_168066_167_829 208
371 3300053153 Ga0500616_0007108 Ga0500616_0007108_3238_3864 208
372 3300053153 Ga0500616_0042582 Ga0500616_0042582_1595_2272 208
373 3300053158 Ga0500627_0026662 Ga0500627_0026662_987_1643 208
374 3300053730 Ga0500645_000183 Ga0500645_000183_11206_11862 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

114

205

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3noq-assembly1.cif.gz_A crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens 0.9128 1 203
7l9q-assembly1.cif.gz_B wild-type pseudomonas fluorescens isocyanide hydratase (wt-1) at 274k, refmac5-refined 0.9102 1 203
7la0-assembly1.cif.gz_B pseudomonas fluorescens g150a isocyanide hydratase (g150a-2) at 274k, refmac5-refined 0.904 1 203
3noo-assembly1.cif.gz_B crystal structure of c101a isocyanide hydratase from pseudomonas fluorescens 0.8925 1 203
7lav-assembly1.cif.gz_A pseudomonas fluorescens g150t isocyanide hydratase (g150t-1) at 274k, refmac5-refined 0.8907 1 203
ID Description Score Start End Superfamily
af_O16228_2_184_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8787 2 200 3.40.50.880
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8744 1 203 3.40.50.880
3ot1B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8647 2 197 3.40.50.880
4xllB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8604 1 202 3.40.50.880
af_Q4D6D8_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8569 2 199 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A0H5RIV5-F1-model_v4 ThiJ/PfpI domain-containing protein 0.9971 1 208 GO:0006355
AF-A0A7R7MSX4-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9946 1 207 GO:0006355
AF-A0A1A0V059-F1-model_v4 deleted 0.9934 1 207
AF-A0A024K1C8-F1-model_v4 ThiJ/PfpI domain-containing protein 0.9924 1 207 GO:0006355
AF-A0A0H5RIV5-F1-model_v4 ThiJ/PfpI domain-containing protein 0.9924 1 208 GO:0006355

Feature Viewer

pLDDT pTM Quality
95.88 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map