F427019

General Info

Members Datasets Scaffolds Average Seq Length
375 228 750 158

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10010897|Ga0105247_100108974
Length 171
Sequence LAPRAEAHYLRLMGSECHHPDGAHPGLHGSVLQRALTVAEARCTATQERLTPPRRRVLQLLLEANAPLKAYDLIAVYGEPGVPAKPPTVYRALEFLERLGFAHRIESLNAYVPCRLAGETHSAAFLICDCCGTADEFEPDFQAQIAAADARGYDIRAVTLEVRGLCPACRA

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
222 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
225 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
226 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
227 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
228 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.27
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.27
Nodule 0.27
Rhizoplane 3.73
Rhizosphere 73.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10010897 3300009101 Bacteria 5492
2 JGI25157J39369_1025612 3300002741 Bacteria 688
3 JGI25153J46596_10034885 3300003215 Bacteria 1637
4 Ga0055530_10001027 3300003791 Bacteria 22214
5 Ga0055531_10007760 3300003794 Bacteria 5785
6 Ga0065165_1000413 3300005262 Bacteria 67911
7 Ga0065165_1025996 3300005262 Bacteria 1934
8 Ga0065165_1040949 3300005262 Bacteria 1378
9 Ga0070658_10098364 3300005327 Bacteria 2417
10 Ga0070683_100893498 3300005329 Bacteria 852
11 Ga0070670_100000020 3300005331 Bacteria 215458
12 Ga0070670_100016359 3300005331 Bacteria 6370
13 Ga0070666_10116163 3300005335 Bacteria 1853
14 Ga0070666_10150747 3300005335 Bacteria 1622
15 Ga0070666_10348508 3300005335 Bacteria 1059
16 Ga0070666_10429590 3300005335 Bacteria 952
17 Ga0070666_10569288 3300005335 Bacteria 825
18 Ga0070680_100077277 3300005336 Bacteria 2742
19 Ga0068868_100102273 3300005338 Bacteria 2320
20 Ga0070660_100676296 3300005339 Bacteria 865
21 Ga0070668_100000108 3300005347 Bacteria 50828
22 Ga0070668_100005083 3300005347 Bacteria 9743
23 Ga0070669_100008310 3300005353 Bacteria 7412
24 Ga0070675_101163964 3300005354 Bacteria 710
25 Ga0070671_100022027 3300005355 Bacteria 5205
26 Ga0070671_100091626 3300005355 Bacteria 2546
27 Ga0070659_100776368 3300005366 Bacteria 832
28 Ga0070667_100000163 3300005367 Bacteria 83059
29 Ga0070667_100004064 3300005367 Bacteria 12375
30 Ga0070667_100006909 3300005367 Bacteria 9429
31 Ga0070663_100426154 3300005455 Bacteria 1089
32 Ga0070678_100066871 3300005456 Bacteria 2673
33 Ga0070662_100346721 3300005457 Bacteria 1216
34 Ga0070681_10170000 3300005458 Bacteria 2102
35 Ga0070698_100701523 3300005471 Bacteria 954
36 Ga0070679_100269795 3300005530 Bacteria 1656
37 Ga0068853_100268392 3300005539 Bacteria 1571
38 Ga0068853_100515538 3300005539 Bacteria 1130
39 Ga0070665_100000441 3300005548 Bacteria 60634
40 Ga0070665_100001115 3300005548 Bacteria 33073
41 Ga0070665_100053931 3300005548 Bacteria 4032
42 Ga0070665_100058690 3300005548 Bacteria 3857
43 Ga0068855_100174189 3300005563 Bacteria 2435
44 Ga0068855_100278618 3300005563 Bacteria 1858
45 Ga0070664_100333902 3300005564 Bacteria 1376
46 Ga0068856_101047178 3300005614 Bacteria 834
47 Ga0068859_100000671 3300005617 Bacteria 34266
48 Ga0068859_100159713 3300005617 Bacteria 2333
49 Ga0068864_100000071 3300005618 Bacteria 111481
50 Ga0068864_100220377 3300005618 Bacteria 1750
51 Ga0068861_100140563 3300005719 Bacteria 1970
52 Ga0068870_10532599 3300005840 Bacteria 788
53 Ga0068863_100000037 3300005841 Bacteria 162638
54 Ga0068863_100000451 3300005841 Bacteria 41841
55 Ga0068863_100021083 3300005841 Bacteria 6224
56 Ga0068863_100124153 3300005841 Bacteria 2463
57 Ga0068858_100000029 3300005842 Bacteria 144691
58 Ga0068858_100002275 3300005842 Bacteria 19425
59 Ga0068858_100006867 3300005842 Bacteria 11061
60 Ga0068858_100273687 3300005842 Bacteria 1607
61 Ga0068858_101539886 3300005842 Bacteria 656
62 Ga0068860_100001003 3300005843 Bacteria 31241
63 Ga0068860_100024705 3300005843 Bacteria 5803
64 Ga0068862_100001526 3300005844 Bacteria 21211
65 Ga0068862_100009403 3300005844 Bacteria 8086
66 Ga0070717_10017847 3300006028 Bacteria 5532
67 Ga0075368_10004613 3300006042 Bacteria 4684
68 Ga0075364_10020776 3300006051 Bacteria 4132
69 Ga0075369_10135700 3300006186 Bacteria 1120
70 Ga0097621_100674305 3300006237 Bacteria 950
71 Ga0075370_10044701 3300006353 Bacteria 2504
72 Ga0075370_10137822 3300006353 Bacteria 1426
73 Ga0097620_100000671 3300006931 Bacteria 34266
74 Ga0097620_100159714 3300006931 Bacteria 2333
75 Ga0079104_1011613 3300006946 Bacteria 2820
76 Ga0105251_10245690 3300009011 Bacteria 806
77 Ga0105250_10010104 3300009092 Bacteria 3940
78 Ga0105240_10010073 3300009093 Bacteria 13307
79 Ga0105240_10056843 3300009093 Bacteria 4894
80 Ga0105240_10095217 3300009093 Bacteria 3631
81 Ga0105245_10521686 3300009098 Bacteria 1207
82 Ga0105247_10089876 3300009101 Bacteria 1948
83 Ga0105241_10236207 3300009174 Bacteria 1543
84 Ga0105248_10003631 3300009177 Bacteria 17121
85 Ga0105248_10010680 3300009177 Bacteria 10131
86 Ga0105248_10016560 3300009177 Bacteria 8118
87 Ga0105248_10065640 3300009177 Bacteria 4075
88 Ga0105248_10130271 3300009177 Bacteria 2837
89 Ga0105248_10195884 3300009177 Bacteria 2276
90 Ga0105248_10326723 3300009177 Bacteria 1728
91 Ga0105238_10034198 3300009551 Bacteria 5172
92 Ga0105238_10134611 3300009551 Bacteria 2449
93 Ga0105238_10208917 3300009551 Bacteria 1928
94 Ga0105249_10000792 3300009553 Bacteria 28363
95 Ga0105249_10295623 3300009553 Bacteria 1622
96 Ga0105239_10635125 3300010375 Bacteria 1219
97 Ga0105239_11735400 3300010375 Bacteria 723
98 Ga0105239_12691809 3300010375 Bacteria 580
99 Ga0157373_10003885 3300013100 Bacteria 11291
100 Ga0157370_10152054 3300013104 Bacteria 2153
101 Ga0157370_10413092 3300013104 Bacteria 1242
102 Ga0157374_10741499 3300013296 Bacteria 997
103 Ga0157378_10987766 3300013297 Bacteria 876
104 Ga0163162_10238020 3300013306 Bacteria 1951
105 Ga0157372_10015498 3300013307 Bacteria 8172
106 Ga0157375_10215194 3300013308 Bacteria 2079
107 Ga0163163_10002745 3300014325 Bacteria 14860
108 Ga0163163_10080460 3300014325 Bacteria 3258
109 Ga0163163_10158362 3300014325 Bacteria 2309
110 Ga0163163_10268839 3300014325 Bacteria 1756
111 Ga0163163_12127133 3300014325 Bacteria 621
112 Ga0157380_10636732 3300014326 Bacteria 1061
113 Ga0157379_10000579 3300014968 Bacteria 29639
114 Ga0157379_10032944 3300014968 Bacteria 4620
115 Ga0157379_10054090 3300014968 Bacteria 3587
116 Ga0157379_11789979 3300014968 Bacteria 603
117 Ga0157376_10818814 3300014969 Bacteria 945
118 Ga0163161_11102508 3300017792 Bacteria 682
119 Ga0206353_11242593 3300020082 Bacteria 640
120 Ga0213876_10019194 3300021384 Bacteria 3610
121 Ga0209026_1000474 3300025250 Bacteria 30684
122 Ga0209026_1022919 3300025250 Bacteria 954
123 Ga0209148_1002910 3300025254 Bacteria 5217
124 Ga0209758_1004816 3300025297 Bacteria 10893
125 Ga0209050_1000029 3300025298 Bacteria 465801
126 Ga0209257_1000152 3300025304 Bacteria 189432
127 Ga0209257_1000660 3300025304 Bacteria 54233
128 Ga0207713_1133657 3300025735 Bacteria 817
129 Ga0207710_10008377 3300025900 Bacteria 4361
130 Ga0207710_10168419 3300025900 Bacteria 1070
131 Ga0207680_10075806 3300025903 Bacteria 2099
132 Ga0207680_10144520 3300025903 Bacteria 1580
133 Ga0207680_10152048 3300025903 Bacteria 1544
134 Ga0207680_10318754 3300025903 Bacteria 1087
135 Ga0207705_10073434 3300025909 Bacteria 2482
136 Ga0207654_10469742 3300025911 Bacteria 885
137 Ga0207707_10109839 3300025912 Bacteria 2410
138 Ga0207695_10008153 3300025913 Bacteria 13172
139 Ga0207695_10045603 3300025913 Bacteria 4652
140 Ga0207695_10100658 3300025913 Bacteria 2885
141 Ga0207695_10300377 3300025913 Bacteria 1497
142 Ga0207671_10747390 3300025914 Bacteria 777
143 Ga0207652_10758731 3300025921 Bacteria 863
144 Ga0207681_10012022 3300025923 Bacteria 5332
145 Ga0207694_10010971 3300025924 Bacteria 6842
146 Ga0207694_10299789 3300025924 Bacteria 1323
147 Ga0207694_10394671 3300025924 Bacteria 1150
148 Ga0207650_10000175 3300025925 Bacteria 75521
149 Ga0207650_10499814 3300025925 Bacteria 1016
150 Ga0207650_10611520 3300025925 Bacteria 917
151 Ga0207687_10478567 3300025927 Bacteria 1036
152 Ga0207644_10029877 3300025931 Bacteria 3783
153 Ga0207644_10158429 3300025931 Bacteria 1757
154 Ga0207644_10178465 3300025931 Bacteria 1663
155 Ga0207706_10063615 3300025933 Bacteria 3248
156 Ga0207711_10000978 3300025941 Bacteria 27393
157 Ga0207711_10001642 3300025941 Bacteria 20636
158 Ga0207711_10003500 3300025941 Bacteria 13594
159 Ga0207711_10032153 3300025941 Bacteria 4436
160 Ga0207711_10073485 3300025941 Bacteria 2972
161 Ga0207711_10682129 3300025941 Bacteria 958
162 Ga0207711_11408344 3300025941 Bacteria 640
163 Ga0207661_11166549 3300025944 Bacteria 709
164 Ga0207667_10300818 3300025949 Bacteria 1639
165 Ga0207667_10426759 3300025949 Bacteria 1348
166 Ga0207667_10749283 3300025949 Bacteria 976
167 Ga0207651_10037154 3300025960 Bacteria 3188
168 Ga0207712_10000376 3300025961 Bacteria 39304
169 Ga0207668_10000001 3300025972 Bacteria 266091
170 Ga0207668_10000123 3300025972 Bacteria 54467
171 Ga0207658_10000118 3300025986 Bacteria 87228
172 Ga0207658_10006171 3300025986 Bacteria 8181
173 Ga0207658_10009958 3300025986 Bacteria 6460
174 Ga0207703_10000079 3300026035 Bacteria 112451
175 Ga0207703_10002421 3300026035 Bacteria 16199
176 Ga0207703_10002470 3300026035 Bacteria 16035
177 Ga0207703_10537367 3300026035 Bacteria 1101
178 Ga0207703_11135033 3300026035 Bacteria 751
179 Ga0207639_10041264 3300026041 Bacteria 3451
180 Ga0207678_10765829 3300026067 Bacteria 851
181 Ga0207702_10970906 3300026078 Bacteria 843
182 Ga0207641_10000034 3300026088 Bacteria 217752
183 Ga0207641_10001419 3300026088 Bacteria 23630
184 Ga0207641_10007520 3300026088 Bacteria 9066
185 Ga0207641_10104924 3300026088 Bacteria 2496
186 Ga0207641_10235200 3300026088 Bacteria 1705
187 Ga0207641_10274819 3300026088 Bacteria 1582
188 Ga0207641_11037919 3300026088 Bacteria 817
189 Ga0207676_10000376 3300026095 Bacteria 38031
190 Ga0207676_10000506 3300026095 Bacteria 32940
191 Ga0207676_10053642 3300026095 Bacteria 3156
192 Ga0207675_100039063 3300026118 Bacteria 4429
193 Ga0207675_100052311 3300026118 Bacteria 3811
194 Ga0207675_100350426 3300026118 Bacteria 1447
195 Ga0207675_100660415 3300026118 Bacteria 1052
196 Ga0207683_10066175 3300026121 Bacteria 3186
197 Ga0207698_11434861 3300026142 Bacteria 705
198 Ga0268266_10001669 3300028379 Bacteria 25581
199 Ga0268266_10008699 3300028379 Bacteria 9000
200 Ga0268266_10039683 3300028379 Bacteria 4010
201 Ga0268266_10711177 3300028379 Bacteria 968
202 Ga0268265_10000901 3300028380 Bacteria 27588
203 Ga0268265_10263523 3300028380 Bacteria 1533
204 Ga0268264_10000481 3300028381 Bacteria 53088
205 Ga0268264_10028199 3300028381 Bacteria 4591
206 Ga0307517_10001099 3300028786 Bacteria 45677
207 Ga0307517_10038132 3300028786 Bacteria 5338
208 Ga0265327_10002690 3300031251 Bacteria 18258
209 Ga0265327_10015586 3300031251 Bacteria 4894
210 Ga0307513_10000348 3300031456 Bacteria 67217
211 Ga0307513_10001617 3300031456 Bacteria 32329
212 Ga0307513_10003966 3300031456 Bacteria 19876
213 Ga0307513_10020347 3300031456 Bacteria 7875
214 Ga0307513_10565712 3300031456 Bacteria 848
215 Ga0307508_10456057 3300031616 Bacteria 871
216 Ga0307413_10628714 3300031824 Bacteria 882
217 Ga0307416_100920855 3300032002 Bacteria 975
218 Ga0307414_11225234 3300032004 Bacteria 695
219 Ga0307411_10445556 3300032005 Bacteria 1082
220 Ga0307510_10472250 3300033180 Bacteria 696
221 Ga0373926_0257695 3300035083 Bacteria 677
222 Ga0373944_0029065 3300035089 Bacteria 1650
223 Ga0373936_0002059 3300035113 Bacteria 7453
224 Ga0373939_0174891 3300035114 Bacteria 797
225 Ga0373927_0000622 3300035695 Bacteria 26882
226 Ga0373947_0098964 3300035725 Bacteria 1830
227 Ga0373937_0658299 3300036401 Bacteria 993
228 Ga0373925_0000067 3300037068 Bacteria 110348
229 Ga0373925_0368368 3300037068 Bacteria 1169
230 Ga0395899_0000095 3300037312 Bacteria 152790
231 Ga0395900_0000006 3300037418 Bacteria 495364
232 Ga0395898_0006778 3300037466 Bacteria 12192
233 Ga0395898_1220744 3300037466 Bacteria 683
234 Ga0395905_0003726 3300037471 Bacteria 16150
235 Ga0395905_0143876 3300037471 Bacteria 2243
236 Ga0395905_0793710 3300037471 Bacteria 850
237 Ga0395905_1431718 3300037471 Bacteria 595
238 Ga0395901_0000001 3300038443 Bacteria 800383
239 Ga0395901_0392885 3300038443 Bacteria 1426
240 Ga0436365_1082675 3300039437 Bacteria 4050
241 Ga0436360_0911673 3300039438 Bacteria 1881
242 Ga0495629_0113986 3300046459 Bacteria 1884
243 Ga0495638_0567983 3300046460 Bacteria 561
244 Ga0495664_0638120 3300046477 Bacteria 632
245 Ga0495585_0162522 3300046492 Bacteria 1158
246 Ga0495585_0502401 3300046492 Bacteria 576
247 Ga0495583_0025976 3300046506 Bacteria 2914
248 Ga0495606_0326545 3300046507 Bacteria 822
249 Ga0495620_0135121 3300046515 Bacteria 966
250 Ga0495620_0184010 3300046515 Bacteria 807
251 Ga0495628_0372786 3300046516 Bacteria 1046
252 Ga0495630_0570134 3300046517 Bacteria 868
253 Ga0495631_0301432 3300046518 Bacteria 682
254 Ga0495637_0092500 3300046520 Bacteria 1191
255 Ga0495643_0014348 3300046522 Bacteria 4715
256 Ga0495642_0003606 3300046528 Bacteria 6084
257 Ga0495642_0107407 3300046528 Bacteria 1191
258 Ga0495621_0096014 3300046539 Bacteria 1123
259 Ga0495621_0219052 3300046539 Bacteria 770
260 Ga0495597_0002477 3300046542 Bacteria 11654
261 Ga0495622_0004680 3300046557 Bacteria 6347
262 Ga0495668_0072153 3300046616 Bacteria 1897
263 Ga0495668_0080688 3300046616 Bacteria 1785
264 Ga0495668_0126331 3300046616 Bacteria 1400
265 Ga0495668_0129365 3300046616 Bacteria 1382
266 Ga0495668_0236027 3300046616 Bacteria 1001
267 Ga0495668_0244274 3300046616 Bacteria 983
268 Ga0495668_0503747 3300046616 Bacteria 667
269 Ga0495611_0070074 3300046648 Bacteria 1602
270 Ga0495625_0131739 3300046660 Bacteria 1693
271 Ga0495625_0316696 3300046660 Bacteria 994
272 Ga0495625_0547856 3300046660 Bacteria 701
273 Ga0495659_0440278 3300046664 Bacteria 566
274 Ga0495669_0000020 3300046684 Bacteria 122868
275 Ga0495669_0000449 3300046684 Bacteria 19393
276 Ga0495669_0089716 3300046684 Bacteria 1418
277 Ga0495613_0417457 3300046689 Bacteria 913
278 Ga0495670_0318958 3300046691 Bacteria 834
279 Ga0495670_0390287 3300046691 Bacteria 752
280 Ga0495581_0494902 3300047315 Bacteria 711
281 Ga0495636_0118427 3300047318 Bacteria 1170
282 Ga0495674_0431987 3300047319 Bacteria 1060
283 Ga0495672_0083204 3300047320 Bacteria 1778
284 Ga0495672_0401543 3300047320 Bacteria 627
285 Ga0495687_046504 3300047443 Bacteria 1873
286 Ga0495677_0041697 3300047445 Bacteria 1680
287 Ga0495677_0085034 3300047445 Bacteria 1188
288 Ga0495685_076012 3300047447 Bacteria 1122
289 Ga0495681_0072148 3300047470 Bacteria 1562
290 Ga0495686_0027535 3300047472 Bacteria 3709
291 Ga0495593_0010957 3300047673 Bacteria 5221
292 Ga0495602_0177073 3300048088 Bacteria 1649
293 Ga0496101_0553116 3300048904 Bacteria 910
294 Ga0496101_0582214 3300048904 Bacteria 885
295 Ga0496101_0595693 3300048904 Bacteria 874
296 Ga0496102_0119738 3300048905 Bacteria 2458
297 Ga0496106_0177938 3300048909 Bacteria 1688
298 Ga0496106_0210667 3300048909 Bacteria 1548
299 Ga0496108_0071538 3300048911 Bacteria 2927
300 Ga0496109_0055818 3300048912 Bacteria 3603
301 Ga0496110_0283733 3300048913 Bacteria 1508
302 Ga0496110_1020006 3300048913 Bacteria 735
303 Ga0496111_0216791 3300048914 Bacteria 1422
304 Ga0496115_0001146 3300048918 Bacteria 19143
305 Ga0496115_0141478 3300048918 Bacteria 1985
306 Ga0496115_0443361 3300048918 Bacteria 1049
307 Ga0496117_0017711 3300048920 Bacteria 5941
308 Ga0496118_0177518 3300048921 Bacteria 1291
309 Ga0496120_0161393 3300048923 Bacteria 1117
310 Ga0496121_0000130 3300048924 Bacteria 168094
311 Ga0495682_0068117 3300049460 Bacteria 1282
312 Ga0501032_0384548 3300049569 Bacteria 902
313 Ga0501033_0040462 3300049570 Bacteria 3479
314 Ga0501034_0489749 3300049571 Bacteria 1144
315 Ga0501034_0910664 3300049571 Bacteria 767
316 Ga0501047_0000825 3300049581 Bacteria 32128
317 Ga0501047_0111604 3300049581 Bacteria 2617
318 Ga0501047_0214299 3300049581 Bacteria 1783
319 Ga0501048_0159793 3300049582 Bacteria 1594
320 Ga0501048_0589614 3300049582 Bacteria 798
321 Ga0501080_1116490 3300049742 Bacteria 680
322 Ga0501035_0333203 3300049822 Bacteria 1273
323 Ga0501044_0009009 3300049823 Bacteria 10914
324 Ga0501044_0086941 3300049823 Bacteria 3158
325 Ga0501044_0540508 3300049823 Bacteria 1063
326 nmdc:mga00v17_2280_c1 3300050491 Bacteria 9840
327 nmdc:mga0k408_101762_c1 3300050493 Bacteria 1694
328 nmdc:mga06z11_97560_c1 3300050494 Bacteria 1607
329 nmdc:mga04h51_95263_c1 3300050495 Bacteria 1077
330 nmdc:mga07m45_1914_c1 3300050496 Bacteria 9617
331 nmdc:mga0sz30_124900_c1 3300050516 Bacteria 1132
332 Ga0495601_0457874 3300053077 Bacteria 825
333 Ga0500635_0000328 3300053080 Bacteria 16376
334 Ga0500578_0250265 3300053086 Bacteria 1068
335 Ga0500643_001289 3300053087 Bacteria 14770
336 Ga0500643_025236 3300053087 Bacteria 1877
337 Ga0500647_0096207 3300053091 Bacteria 1416
338 Ga0500651_0278724 3300053093 Bacteria 965
339 Ga0500566_0229716 3300053094 Bacteria 916
340 Ga0500641_0095903 3300053096 Bacteria 1269
341 Ga0500555_021013 3300053103 Bacteria 1880
342 Ga0500555_110432 3300053103 Bacteria 692
343 Ga0500556_0011407 3300053104 Bacteria 2632
344 Ga0500562_000461 3300053108 Bacteria 9854
345 Ga0500562_003674 3300053108 Bacteria 3854
346 Ga0500569_029265 3300053109 Bacteria 1533
347 Ga0500572_205786 3300053111 Bacteria 644
348 Ga0500595_037514 3300053119 Bacteria 1580
349 Ga0500595_040602 3300053119 Bacteria 1499
350 Ga0500607_106005 3300053121 Bacteria 1387
351 Ga0500608_001574 3300053122 Bacteria 8182
352 Ga0500608_041069 3300053122 Bacteria 2218
353 Ga0500614_001953 3300053123 Bacteria 4732
354 Ga0500642_0046847 3300053130 Bacteria 1892
355 Ga0500658_0095679 3300053134 Bacteria 1290
356 Ga0500559_0031621 3300053136 Bacteria 2271
357 Ga0500559_0123479 3300053136 Bacteria 1205
358 Ga0500577_0444043 3300053142 Bacteria 567
359 Ga0500590_084300 3300053148 Bacteria 1555
360 Ga0500616_0151720 3300053153 Bacteria 1072
361 Ga0500619_025601 3300053154 Bacteria 1749
362 Ga0500638_091524 3300053162 Bacteria 1431
363 Ga0500636_0086749 3300053177 Bacteria 1797
364 Ga0500636_0096453 3300053177 Bacteria 1687
365 Ga0500637_0113746 3300053178 Bacteria 1569
366 Ga0500637_0125061 3300053178 Bacteria 1491
367 Ga0500576_062057 3300053725 Bacteria 1632
368 Ga0500625_077787 3300053729 Bacteria 1456
369 Ga0500645_002611 3300053730 Bacteria 7899
370 Ga0500645_160443 3300053730 Bacteria 617
371 Ga0500596_002173 3300053735 Bacteria 3885
372 2643999970 2643221598 Bacteria 4578346
373 2644088398 2643221614 Bacteria 4260023
374 2644343634 2643221661 Bacteria 4267604
375 2644368888 2643221666 Bacteria 4265935
376 Ga0105247_10010897
377 JGI25157J39369_1025612
378 JGI25153J46596_10034885
379 Ga0055530_10001027
380 Ga0055531_10007760
381 Ga0065165_1000413
382 Ga0065165_1025996
383 Ga0065165_1040949
384 Ga0070658_10098364
385 Ga0070683_100893498
386 Ga0070670_100000020
387 Ga0070670_100016359
388 Ga0070666_10116163
389 Ga0070666_10150747
390 Ga0070666_10348508
391 Ga0070666_10429590
392 Ga0070666_10569288
393 Ga0070680_100077277
394 Ga0068868_100102273
395 Ga0070660_100676296
396 Ga0070668_100000108
397 Ga0070668_100005083
398 Ga0070669_100008310
399 Ga0070675_101163964
400 Ga0070671_100022027
401 Ga0070671_100091626
402 Ga0070659_100776368
403 Ga0070667_100000163
404 Ga0070667_100004064
405 Ga0070667_100006909
406 Ga0070663_100426154
407 Ga0070678_100066871
408 Ga0070662_100346721
409 Ga0070681_10170000
410 Ga0070698_100701523
411 Ga0070679_100269795
412 Ga0068853_100268392
413 Ga0068853_100515538
414 Ga0070665_100000441
415 Ga0070665_100001115
416 Ga0070665_100053931
417 Ga0070665_100058690
418 Ga0068855_100174189
419 Ga0068855_100278618
420 Ga0070664_100333902
421 Ga0068856_101047178
422 Ga0068859_100000671
423 Ga0068859_100159713
424 Ga0068864_100000071
425 Ga0068864_100220377
426 Ga0068861_100140563
427 Ga0068870_10532599
428 Ga0068863_100000037
429 Ga0068863_100000451
430 Ga0068863_100021083
431 Ga0068863_100124153
432 Ga0068858_100000029
433 Ga0068858_100002275
434 Ga0068858_100006867
435 Ga0068858_100273687
436 Ga0068858_101539886
437 Ga0068860_100001003
438 Ga0068860_100024705
439 Ga0068862_100001526
440 Ga0068862_100009403
441 Ga0070717_10017847
442 Ga0075368_10004613
443 Ga0075364_10020776
444 Ga0075369_10135700
445 Ga0097621_100674305
446 Ga0075370_10044701
447 Ga0075370_10137822
448 Ga0097620_100000671
449 Ga0097620_100159714
450 Ga0079104_1011613
451 Ga0105251_10245690
452 Ga0105250_10010104
453 Ga0105240_10010073
454 Ga0105240_10056843
455 Ga0105240_10095217
456 Ga0105245_10521686
457 Ga0105247_10089876
458 Ga0105241_10236207
459 Ga0105248_10003631
460 Ga0105248_10010680
461 Ga0105248_10016560
462 Ga0105248_10065640
463 Ga0105248_10130271
464 Ga0105248_10195884
465 Ga0105248_10326723
466 Ga0105238_10034198
467 Ga0105238_10134611
468 Ga0105238_10208917
469 Ga0105249_10000792
470 Ga0105249_10295623
471 Ga0105239_10635125
472 Ga0105239_11735400
473 Ga0105239_12691809
474 Ga0157373_10003885
475 Ga0157370_10152054
476 Ga0157370_10413092
477 Ga0157374_10741499
478 Ga0157378_10987766
479 Ga0163162_10238020
480 Ga0157372_10015498
481 Ga0157375_10215194
482 Ga0163163_10002745
483 Ga0163163_10080460
484 Ga0163163_10158362
485 Ga0163163_10268839
486 Ga0163163_12127133
487 Ga0157380_10636732
488 Ga0157379_10000579
489 Ga0157379_10032944
490 Ga0157379_10054090
491 Ga0157379_11789979
492 Ga0157376_10818814
493 Ga0163161_11102508
494 Ga0206353_11242593
495 Ga0213876_10019194
496 Ga0209026_1000474
497 Ga0209026_1022919
498 Ga0209148_1002910
499 Ga0209758_1004816
500 Ga0209050_1000029
501 Ga0209257_1000152
502 Ga0209257_1000660
503 Ga0207713_1133657
504 Ga0207710_10008377
505 Ga0207710_10168419
506 Ga0207680_10075806
507 Ga0207680_10144520
508 Ga0207680_10152048
509 Ga0207680_10318754
510 Ga0207705_10073434
511 Ga0207654_10469742
512 Ga0207707_10109839
513 Ga0207695_10008153
514 Ga0207695_10045603
515 Ga0207695_10100658
516 Ga0207695_10300377
517 Ga0207671_10747390
518 Ga0207652_10758731
519 Ga0207681_10012022
520 Ga0207694_10010971
521 Ga0207694_10299789
522 Ga0207694_10394671
523 Ga0207650_10000175
524 Ga0207650_10499814
525 Ga0207650_10611520
526 Ga0207687_10478567
527 Ga0207644_10029877
528 Ga0207644_10158429
529 Ga0207644_10178465
530 Ga0207706_10063615
531 Ga0207711_10000978
532 Ga0207711_10001642
533 Ga0207711_10003500
534 Ga0207711_10032153
535 Ga0207711_10073485
536 Ga0207711_10682129
537 Ga0207711_11408344
538 Ga0207661_11166549
539 Ga0207667_10300818
540 Ga0207667_10426759
541 Ga0207667_10749283
542 Ga0207651_10037154
543 Ga0207712_10000376
544 Ga0207668_10000001
545 Ga0207668_10000123
546 Ga0207658_10000118
547 Ga0207658_10006171
548 Ga0207658_10009958
549 Ga0207703_10000079
550 Ga0207703_10002421
551 Ga0207703_10002470
552 Ga0207703_10537367
553 Ga0207703_11135033
554 Ga0207639_10041264
555 Ga0207678_10765829
556 Ga0207702_10970906
557 Ga0207641_10000034
558 Ga0207641_10001419
559 Ga0207641_10007520
560 Ga0207641_10104924
561 Ga0207641_10235200
562 Ga0207641_10274819
563 Ga0207641_11037919
564 Ga0207676_10000376
565 Ga0207676_10000506
566 Ga0207676_10053642
567 Ga0207675_100039063
568 Ga0207675_100052311
569 Ga0207675_100350426
570 Ga0207675_100660415
571 Ga0207683_10066175
572 Ga0207698_11434861
573 Ga0268266_10001669
574 Ga0268266_10008699
575 Ga0268266_10039683
576 Ga0268266_10711177
577 Ga0268265_10000901
578 Ga0268265_10263523
579 Ga0268264_10000481
580 Ga0268264_10028199
581 Ga0307517_10001099
582 Ga0307517_10038132
583 Ga0265327_10002690
584 Ga0265327_10015586
585 Ga0307513_10000348
586 Ga0307513_10001617
587 Ga0307513_10003966
588 Ga0307513_10020347
589 Ga0307513_10565712
590 Ga0307508_10456057
591 Ga0307413_10628714
592 Ga0307416_100920855
593 Ga0307414_11225234
594 Ga0307411_10445556
595 Ga0307510_10472250
596 Ga0373926_0257695
597 Ga0373944_0029065
598 Ga0373936_0002059
599 Ga0373939_0174891
600 Ga0373927_0000622
601 Ga0373947_0098964
602 Ga0373937_0658299
603 Ga0373925_0000067
604 Ga0373925_0368368
605 Ga0395899_0000095
606 Ga0395900_0000006
607 Ga0395898_0006778
608 Ga0395898_1220744
609 Ga0395905_0003726
610 Ga0395905_0143876
611 Ga0395905_0793710
612 Ga0395905_1431718
613 Ga0395901_0000001
614 Ga0395901_0392885
615 Ga0436365_1082675
616 Ga0436360_0911673
617 Ga0495629_0113986
618 Ga0495638_0567983
619 Ga0495664_0638120
620 Ga0495585_0162522
621 Ga0495585_0502401
622 Ga0495583_0025976
623 Ga0495606_0326545
624 Ga0495620_0135121
625 Ga0495620_0184010
626 Ga0495628_0372786
627 Ga0495630_0570134
628 Ga0495631_0301432
629 Ga0495637_0092500
630 Ga0495643_0014348
631 Ga0495642_0003606
632 Ga0495642_0107407
633 Ga0495621_0096014
634 Ga0495621_0219052
635 Ga0495597_0002477
636 Ga0495622_0004680
637 Ga0495668_0072153
638 Ga0495668_0080688
639 Ga0495668_0126331
640 Ga0495668_0129365
641 Ga0495668_0236027
642 Ga0495668_0244274
643 Ga0495668_0503747
644 Ga0495611_0070074
645 Ga0495625_0131739
646 Ga0495625_0316696
647 Ga0495625_0547856
648 Ga0495659_0440278
649 Ga0495669_0000020
650 Ga0495669_0000449
651 Ga0495669_0089716
652 Ga0495613_0417457
653 Ga0495670_0318958
654 Ga0495670_0390287
655 Ga0495581_0494902
656 Ga0495636_0118427
657 Ga0495674_0431987
658 Ga0495672_0083204
659 Ga0495672_0401543
660 Ga0495687_046504
661 Ga0495677_0041697
662 Ga0495677_0085034
663 Ga0495685_076012
664 Ga0495681_0072148
665 Ga0495686_0027535
666 Ga0495593_0010957
667 Ga0495602_0177073
668 Ga0496101_0553116
669 Ga0496101_0582214
670 Ga0496101_0595693
671 Ga0496102_0119738
672 Ga0496106_0177938
673 Ga0496106_0210667
674 Ga0496108_0071538
675 Ga0496109_0055818
676 Ga0496110_0283733
677 Ga0496110_1020006
678 Ga0496111_0216791
679 Ga0496115_0001146
680 Ga0496115_0141478
681 Ga0496115_0443361
682 Ga0496117_0017711
683 Ga0496118_0177518
684 Ga0496120_0161393
685 Ga0496121_0000130
686 Ga0495682_0068117
687 Ga0501032_0384548
688 Ga0501033_0040462
689 Ga0501034_0489749
690 Ga0501034_0910664
691 Ga0501047_0000825
692 Ga0501047_0111604
693 Ga0501047_0214299
694 Ga0501048_0159793
695 Ga0501048_0589614
696 Ga0501080_1116490
697 Ga0501035_0333203
698 Ga0501044_0009009
699 Ga0501044_0086941
700 Ga0501044_0540508
701 nmdc:mga00v17_2280_c1
702 nmdc:mga0k408_101762_c1
703 nmdc:mga06z11_97560_c1
704 nmdc:mga04h51_95263_c1
705 nmdc:mga07m45_1914_c1
706 nmdc:mga0sz30_124900_c1
707 Ga0495601_0457874
708 Ga0500635_0000328
709 Ga0500578_0250265
710 Ga0500643_001289
711 Ga0500643_025236
712 Ga0500647_0096207
713 Ga0500651_0278724
714 Ga0500566_0229716
715 Ga0500641_0095903
716 Ga0500555_021013
717 Ga0500555_110432
718 Ga0500556_0011407
719 Ga0500562_000461
720 Ga0500562_003674
721 Ga0500569_029265
722 Ga0500572_205786
723 Ga0500595_037514
724 Ga0500595_040602
725 Ga0500607_106005
726 Ga0500608_001574
727 Ga0500608_041069
728 Ga0500614_001953
729 Ga0500642_0046847
730 Ga0500658_0095679
731 Ga0500559_0031621
732 Ga0500559_0123479
733 Ga0500577_0444043
734 Ga0500590_084300
735 Ga0500616_0151720
736 Ga0500619_025601
737 Ga0500638_091524
738 Ga0500636_0086749
739 Ga0500636_0096453
740 Ga0500637_0113746
741 Ga0500637_0125061
742 Ga0500576_062057
743 Ga0500625_077787
744 Ga0500645_002611
745 Ga0500645_160443
746 Ga0500596_002173
747 2643999970
748 2644088398
749 2644343634
750 2644368888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

45

163

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qwp-assembly1.cif.gz_M cryoem structure of bacterial transcription close complex (rpc) 0.701 39 94
6ty0-assembly1.cif.gz_B nt part crystal structure of the rymv-encoded viral rna silencing suppressor p1 0.6396 106 153
6xv2-assembly1.cif.gz_A full structure of rymv p1 protein, derived from crystallographic and nmr data. 0.6327 106 156
4v4n-assembly1.cif.gz_BG structure of the methanococcus jannaschii ribosome-secyebeta channel complex 0.6088 104 131
6skf-assembly1.cif.gz_Ah cryo-em structure of t. kodakarensis 70s ribosome 0.5782 106 129
ID Description Score Start End Superfamily
4mteC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.924 17 85 1.10.10.10
4mtdB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9138 14 85 1.10.10.10
2w57B02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Ferric-uptake regulator, C-terminal dimerisarion domain 0.8629 107 150 3.30.1490.190
2xigC02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Ferric-uptake regulator, C-terminal dimerisarion domain 0.8476 107 154 3.30.1490.190
2fe3B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8367 19 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A350UAA5-F1-model_v4 Transcriptional repressor 0.8853 107 156 GO:0003677
GO:0003700
GO:0005737
GO:0046872
AF-A0A0S7ZWL0-F1-model_v4 Fur family transcriptional regulator 0.8312 6 85 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A3B8UF65-F1-model_v4 Fur family transcriptional regulator 0.8311 1 86
AF-I3X517-F1-model_v4 Uncharacterized protein 0.8127 94 153 GO:0003677
GO:0003700
GO:0046872
AF-A0A3B8UF65-F1-model_v4 Fur family transcriptional regulator 0.7961 1 86

Map