F427042

General Info

Members Datasets Scaffolds Average Seq Length
375 240 750 165

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10584352|Ga0157375_105843522
Length 182
Sequence MTDINDHTVQNITAKEKVVSSIWHFLDEVCDPEIPVLSIIDLGIVRDIVLSSSNNKEFEGTVVITPTYSGCPAMDVISMDIRMKLIENGYKNIKVNTILSPPWTTEWMSEKGKEKLKAYGIAPPNPKQIVCDTKLFAESEAIQCPLCNSYSTKLISQFGSTPCKALYQCQQCKEPFDYFKCH

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
154 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
207 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
228 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 2738541278 Niastella sp. CF465 Isolate Unclassified
236 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
237 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
238 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
239 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
240 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0.27
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 0
Rhizoplane 3.47
Rhizosphere 82.4
Stem 0
Stem Tuber 0
Unclassified 16.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10584352 3300013308 Unclassified 1277
2 JGI25151J46595_10000400 3300003187 Bacteria 45092
3 rootH2_10159088 3300003320 Bacteria 2617
4 rootL2_10240789 3300003322 Unclassified 1272
5 rootH1_10039676 3300003323 Unclassified 2205
6 rootH1_10040666 3300003323 Bacteria 11714
7 rootH1_10229344 3300003323 Bacteria 2132
8 Ga0065165_1024450 3300005262 Bacteria 2028
9 Ga0065714_10345483 3300005288 Unclassified 641
10 Ga0065707_10291515 3300005295 Bacteria 1024
11 Ga0070658_10279629 3300005327 Bacteria 1420
12 Ga0070676_10002454 3300005328 Bacteria 9494
13 Ga0070676_10006356 3300005328 Bacteria 6314
14 Ga0070683_100161089 3300005329 Bacteria 2129
15 Ga0070690_100008855 3300005330 Bacteria 5814
16 Ga0070690_100861579 3300005330 Bacteria 706
17 Ga0070670_100053214 3300005331 Unclassified 3476
18 Ga0070670_100105336 3300005331 Bacteria 2430
19 Ga0070670_100548519 3300005331 Bacteria 1031
20 Ga0068869_100155709 3300005334 Unclassified 1775
21 Ga0068869_100241209 3300005334 Bacteria 1440
22 Ga0070666_10788837 3300005335 Unclassified 699
23 Ga0070680_100012129 3300005336 Bacteria 6692
24 Ga0070682_100000041 3300005337 Bacteria 142152
25 Ga0070660_100084219 3300005339 Bacteria 2499
26 Ga0070660_100197000 3300005339 Bacteria 1633
27 Ga0070689_100121049 3300005340 Unclassified 2090
28 Ga0070661_100307531 3300005344 Unclassified 1235
29 Ga0070668_100797799 3300005347 Bacteria 839
30 Ga0070669_100107891 3300005353 Unclassified 2109
31 Ga0070669_100925215 3300005353 Bacteria 745
32 Ga0070675_100079437 3300005354 Unclassified 2733
33 Ga0070675_100236644 3300005354 Bacteria 1594
34 Ga0070675_100445075 3300005354 Unclassified 1161
35 Ga0070671_100448915 3300005355 Bacteria 1106
36 Ga0070674_100066054 3300005356 Bacteria 2541
37 Ga0070688_100008553 3300005365 Bacteria 5563
38 Ga0070659_101173790 3300005366 Unclassified 678
39 Ga0070667_100230235 3300005367 Bacteria 1652
40 Ga0070709_10372119 3300005434 Bacteria 1060
41 Ga0070713_101513573 3300005436 Bacteria 651
42 Ga0070700_100060573 3300005441 Unclassified 2386
43 Ga0070694_100371113 3300005444 Bacteria 1114
44 Ga0070663_100678629 3300005455 Unclassified 874
45 Ga0070662_100145454 3300005457 Bacteria 1841
46 Ga0070662_100180489 3300005457 Bacteria 1664
47 Ga0070662_100312154 3300005457 Unclassified 1280
48 Ga0070681_10013651 3300005458 Bacteria 8084
49 Ga0070681_10069872 3300005458 Bacteria 3478
50 Ga0070681_11468404 3300005458 Bacteria 606
51 Ga0068867_100038258 3300005459 Bacteria 3492
52 Ga0070698_100232102 3300005471 Unclassified 1778
53 Ga0070699_100164106 3300005518 Unclassified 1967
54 Ga0070699_100825993 3300005518 Bacteria 848
55 Ga0070679_100005411 3300005530 Bacteria 11831
56 Ga0070679_100293998 3300005530 Bacteria 1575
57 Ga0070679_100431426 3300005530 Bacteria 1263
58 Ga0068853_100186281 3300005539 Bacteria 1884
59 Ga0068853_100201998 3300005539 Bacteria 1809
60 Ga0068853_100362945 3300005539 Bacteria 1350
61 Ga0070672_100082380 3300005543 Unclassified 2581
62 Ga0070672_100471247 3300005543 Bacteria 1083
63 Ga0070686_100102903 3300005544 Bacteria 1932
64 Ga0070686_100143200 3300005544 Bacteria 1666
65 Ga0070686_100217599 3300005544 Bacteria 1379
66 Ga0068855_100011161 3300005563 Bacteria 10847
67 Ga0068855_100144830 3300005563 Bacteria 2706
68 Ga0070664_100031149 3300005564 Bacteria 4453
69 Ga0070664_100239862 3300005564 Unclassified 1627
70 Ga0070664_100437675 3300005564 Bacteria 1199
71 Ga0068857_100009540 3300005577 Bacteria 8428
72 Ga0068857_100470262 3300005577 Bacteria 1177
73 Ga0068857_100512753 3300005577 Bacteria 1126
74 Ga0068854_100319650 3300005578 Bacteria 1261
75 Ga0068854_100723802 3300005578 Bacteria 861
76 Ga0068856_100279387 3300005614 Bacteria 1686
77 Ga0068852_100443334 3300005616 Bacteria 1284
78 Ga0068852_100672305 3300005616 Unclassified 1044
79 Ga0068859_100128544 3300005617 Unclassified 2604
80 Ga0068859_100314578 3300005617 Bacteria 1659
81 Ga0068864_100180804 3300005618 Unclassified 1928
82 Ga0068864_101525364 3300005618 Bacteria 671
83 Ga0068861_100030506 3300005719 Bacteria 3952
84 Ga0068861_100337250 3300005719 Bacteria 1318
85 Ga0068870_10009534 3300005840 Unclassified 4423
86 Ga0068858_101431060 3300005842 Bacteria 681
87 Ga0068860_100004507 3300005843 Bacteria 14213
88 Ga0068860_100543985 3300005843 Bacteria 1163
89 Ga0068860_101034804 3300005843 Bacteria 839
90 Ga0068862_100063851 3300005844 Bacteria 3169
91 Ga0068862_101116767 3300005844 Unclassified 784
92 Ga0070717_10003988 3300006028 Bacteria 10622
93 Ga0070717_10621839 3300006028 Bacteria 980
94 Ga0070712_100759048 3300006175 Bacteria 830
95 Ga0075366_10189747 3300006195 Bacteria 1249
96 Ga0097621_101535349 3300006237 Unclassified 632
97 Ga0068871_100295733 3300006358 Bacteria 1420
98 Ga0068871_100799723 3300006358 Unclassified 869
99 Ga0075428_100167701 3300006844 Bacteria 2382
100 Ga0075430_100041979 3300006846 Bacteria 3868
101 Ga0075430_100148955 3300006846 Bacteria 1949
102 Ga0068865_100210401 3300006881 Bacteria 1515
103 Ga0075436_100143583 3300006914 Bacteria 1678
104 Ga0097620_100128534 3300006931 Unclassified 2604
105 Ga0097620_100314577 3300006931 Bacteria 1659
106 Ga0105240_10139147 3300009093 Bacteria 2904
107 Ga0105240_10181436 3300009093 Bacteria 2484
108 Ga0111539_10017557 3300009094 Bacteria 8856
109 Ga0111539_10165345 3300009094 Bacteria 2587
110 Ga0105245_10208371 3300009098 Bacteria 1881
111 Ga0105243_10292676 3300009148 Bacteria 1472
112 Ga0105242_10057942 3300009176 Unclassified 3174
113 Ga0105242_10412117 3300009176 Unclassified 1264
114 Ga0105242_11316769 3300009176 Bacteria 747
115 Ga0105242_11563703 3300009176 Unclassified 692
116 Ga0105248_10274140 3300009177 Bacteria 1900
117 Ga0105237_10091536 3300009545 Bacteria 3031
118 Ga0105237_10831737 3300009545 Bacteria 930
119 Ga0105249_10014727 3300009553 Bacteria 6913
120 Ga0105249_10090671 3300009553 Bacteria 2858
121 Ga0105249_10564429 3300009553 Bacteria 1190
122 Ga0105239_10003342 3300010375 Bacteria 19721
123 Ga0105239_10325198 3300010375 Unclassified 1734
124 Ga0105246_10118659 3300011119 Bacteria 1956
125 Ga0105246_10258066 3300011119 Bacteria 1387
126 Ga0157373_10873421 3300013100 Bacteria 666
127 Ga0157371_10325202 3300013102 Bacteria 1116
128 Ga0157370_10107975 3300013104 Bacteria 2603
129 Ga0157370_10224719 3300013104 Bacteria 1738
130 Ga0157370_11203362 3300013104 Bacteria 683
131 Ga0157369_10001508 3300013105 Bacteria 28570
132 Ga0157369_10001587 3300013105 Bacteria 27857
133 Ga0157369_10131395 3300013105 Bacteria 2653
134 Ga0157369_10193979 3300013105 Bacteria 2133
135 Ga0157374_10142860 3300013296 Bacteria 2324
136 Ga0157374_10352685 3300013296 Bacteria 1462
137 Ga0157374_10833540 3300013296 Bacteria 939
138 Ga0157374_10881698 3300013296 Bacteria 912
139 Ga0157378_10022575 3300013297 Bacteria 5537
140 Ga0157378_10378202 3300013297 Bacteria 1390
141 Ga0157378_10490289 3300013297 Unclassified 1226
142 Ga0157378_11182367 3300013297 Bacteria 804
143 Ga0163162_10014309 3300013306 Bacteria 7752
144 Ga0163162_10069481 3300013306 Bacteria 3574
145 Ga0163162_10163440 3300013306 Unclassified 2349
146 Ga0163162_11106202 3300013306 Bacteria 898
147 Ga0157372_10074450 3300013307 Bacteria 3829
148 Ga0157372_10517187 3300013307 Bacteria 1391
149 Ga0157372_11925505 3300013307 Bacteria 679
150 Ga0157375_10027292 3300013308 Bacteria 5336
151 Ga0157375_10047205 3300013308 Bacteria 4204
152 Ga0157375_10172528 3300013308 Unclassified 2311
153 Ga0163163_10252718 3300014325 Bacteria 1813
154 Ga0163163_10307129 3300014325 Unclassified 1639
155 Ga0163163_10773112 3300014325 Bacteria 1024
156 Ga0163163_11908540 3300014325 Unclassified 654
157 Ga0157380_10013266 3300014326 Bacteria 6004
158 Ga0157380_10093001 3300014326 Bacteria 2493
159 Ga0157377_10045490 3300014745 Unclassified 2452
160 Ga0157379_10329725 3300014968 Bacteria 1394
161 Ga0157376_10122474 3300014969 Bacteria 2307
162 Ga0163161_10912908 3300017792 Bacteria 745
163 Ga0213874_10039216 3300021377 Bacteria 1410
164 Ga0213874_10060583 3300021377 Bacteria 1184
165 Ga0213876_10004724 3300021384 Bacteria 7572
166 Ga0213876_10011635 3300021384 Bacteria 4697
167 Ga0213876_10059930 3300021384 Bacteria 2008
168 Ga0213875_10023311 3300021388 Bacteria 2957
169 Ga0213871_10005584 3300021441 Bacteria 2605
170 Ga0209130_1001198 3300025284 Bacteria 18428
171 Ga0209025_1000486 3300025294 Bacteria 76804
172 Ga0209758_1003759 3300025297 Bacteria 13424
173 Ga0207426_1000092 3300025302 Bacteria 278907
174 Ga0207645_10660045 3300025907 Bacteria 711
175 Ga0207643_10003655 3300025908 Bacteria 8289
176 Ga0207705_10034859 3300025909 Bacteria 3599
177 Ga0207707_10450207 3300025912 Bacteria 1102
178 Ga0207707_11187817 3300025912 Bacteria 618
179 Ga0207695_10318935 3300025913 Unclassified 1444
180 Ga0207693_10612328 3300025915 Bacteria 847
181 Ga0207663_10848039 3300025916 Bacteria 729
182 Ga0207660_10320374 3300025917 Bacteria 1238
183 Ga0207660_10380797 3300025917 Bacteria 1134
184 Ga0207662_10539269 3300025918 Bacteria 807
185 Ga0207657_10055887 3300025919 Bacteria 3407
186 Ga0207652_10013322 3300025921 Bacteria 6658
187 Ga0207652_10336468 3300025921 Bacteria 1363
188 Ga0207652_10464388 3300025921 Bacteria 1141
189 Ga0207652_10555910 3300025921 Bacteria 1031
190 Ga0207681_10023454 3300025923 Unclassified 3947
191 Ga0207681_10840291 3300025923 Bacteria 768
192 Ga0207650_10145163 3300025925 Bacteria 1868
193 Ga0207650_10660600 3300025925 Bacteria 881
194 Ga0207659_10028098 3300025926 Unclassified 3818
195 Ga0207659_10461387 3300025926 Bacteria 1071
196 Ga0207659_10675412 3300025926 Unclassified 884
197 Ga0207687_10253947 3300025927 Bacteria 1399
198 Ga0207700_10155833 3300025928 Bacteria 1892
199 Ga0207700_11188985 3300025928 Bacteria 681
200 Ga0207644_10358317 3300025931 Bacteria 1186
201 Ga0207644_11257842 3300025931 Bacteria 622
202 Ga0207706_10053488 3300025933 Bacteria 3564
203 Ga0207706_10298027 3300025933 Unclassified 1405
204 Ga0207686_10054628 3300025934 Bacteria 2502
205 Ga0207704_11154904 3300025938 Bacteria 659
206 Ga0207665_10112115 3300025939 Bacteria 1917
207 Ga0207691_10088436 3300025940 Unclassified 2778
208 Ga0207691_10321185 3300025940 Unclassified 1327
209 Ga0207691_10755322 3300025940 Bacteria 819
210 Ga0207689_10047300 3300025942 Bacteria 3553
211 Ga0207689_10225961 3300025942 Unclassified 1547
212 Ga0207689_10250111 3300025942 Bacteria 1466
213 Ga0207661_10473490 3300025944 Bacteria 1143
214 Ga0207661_10685677 3300025944 Unclassified 942
215 Ga0207667_10009678 3300025949 Bacteria 11337
216 Ga0207667_10213986 3300025949 Bacteria 1975
217 Ga0207667_10454701 3300025949 Bacteria 1301
218 Ga0207651_10664349 3300025960 Bacteria 916
219 Ga0207712_10039731 3300025961 Unclassified 3225
220 Ga0207640_10029632 3300025981 Bacteria 3362
221 Ga0207640_10402583 3300025981 Bacteria 1115
222 Ga0207640_10957673 3300025981 Bacteria 751
223 Ga0207677_10851661 3300026023 Bacteria 819
224 Ga0207639_10159013 3300026041 Bacteria 1902
225 Ga0207639_10341496 3300026041 Bacteria 1335
226 Ga0207639_10453243 3300026041 Bacteria 1165
227 Ga0207639_10507873 3300026041 Bacteria 1102
228 Ga0207678_10865364 3300026067 Unclassified 799
229 Ga0207708_10768008 3300026075 Unclassified 828
230 Ga0207702_10390807 3300026078 Bacteria 1339
231 Ga0207676_10803249 3300026095 Bacteria 918
232 Ga0207674_10066409 3300026116 Unclassified 3633
233 Ga0207674_10258337 3300026116 Bacteria 1689
234 Ga0207675_100006933 3300026118 Bacteria 10720
235 Ga0207675_100034358 3300026118 Bacteria 4727
236 Ga0207698_10267874 3300026142 Bacteria 1573
237 Ga0268266_10335191 3300028379 Bacteria 1419
238 Ga0268265_10055102 3300028380 Bacteria 3020
239 Ga0268264_10002110 3300028381 Bacteria 17720
240 Ga0268264_10045884 3300028381 Bacteria 3630
241 Ga0268264_10476348 3300028381 Bacteria 1213
242 Ga0307517_10542924 3300028786 Bacteria 583
243 Ga0307515_10000031 3300028794 Bacteria 358648
244 Ga0307513_10102545 3300031456 Bacteria 2880
245 Ga0307513_10214255 3300031456 Bacteria 1754
246 Ga0307513_10342626 3300031456 Unclassified 1245
247 Ga0307509_10132556 3300031507 Bacteria 2444
248 Ga0307410_10046318 3300031852 Bacteria 2901
249 Ga0307412_10399752 3300031911 Bacteria 1118
250 Ga0307416_100078680 3300032002 Bacteria 2776
251 Ga0307416_100099584 3300032002 Bacteria 2525
252 Ga0307415_100011911 3300032126 Bacteria 5004
253 Ga0307415_100642405 3300032126 Bacteria 950
254 Ga0373943_0347286 3300035170 Bacteria 850
255 Ga0436364_1495722 3300037853 Unclassified 1293
256 Ga0436365_0070052 3300039437 Bacteria 17912
257 Ga0436365_1607053 3300039437 Bacteria 47115
258 Ga0436365_1890468 3300039437 Bacteria 4997
259 Ga0436360_0239211 3300039438 Bacteria 3096
260 Ga0436360_1133769 3300039438 Bacteria 2302
261 Ga0436363_0801232 3300039450 Bacteria 10108
262 Ga0436362_0182727 3300039453 Bacteria 1111
263 Ga0436362_1063716 3300039453 Bacteria 2917
264 Ga0439436_0002217 3300041404 Bacteria 5820
265 Ga0451791_1305226 3300041451 Bacteria 936
266 Ga0451798_0207773 3300041458 Bacteria 947
267 Ga0451798_0392976 3300041458 Bacteria 1190
268 Ga0451800_1129986 3300041459 Bacteria 1040
269 Ga0451802_1834505 3300041460 Unclassified 920
270 Ga0451804_0054560 3300041463 Bacteria 906
271 Ga0451807_0203573 3300041486 Bacteria 566
272 Ga0451807_2709847 3300041486 Bacteria 685
273 Ga0451847_0958825 3300041503 Bacteria 678
274 Ga0451853_2852072 3300041512 Bacteria 2585
275 Ga0439448_0007581 3300042005 Bacteria 3150
276 Ga0439449_0022225 3300042007 Bacteria 2374
277 Ga0439449_0112997 3300042007 Bacteria 1006
278 Ga0439457_001639 3300042014 Bacteria 6669
279 Ga0439462_0002704 3300042015 Bacteria 4165
280 Ga0450923_002148 3300042125 Bacteria 2773
281 Ga0439458_0148647 3300042157 Bacteria 627
282 Ga0439460_0022169 3300042461 Bacteria 1740
283 Ga0451577_0228369 3300042876 Bacteria 1683
284 Ga0451577_0860399 3300042876 Bacteria 817
285 Ga0466969_0000207 3300044656 Bacteria 32129
286 Ga0466972_0020808 3300044658 Bacteria 3276
287 Ga0466972_0111156 3300044658 Bacteria 1295
288 Ga0466966_0040349 3300044684 Bacteria 3004
289 Ga0466961_0006156 3300044693 Bacteria 7616
290 Ga0466961_0173898 3300044693 Unclassified 1339
291 Ga0466963_0237543 3300044694 Bacteria 1278
292 Ga0466968_0017398 3300044735 Unclassified 2873
293 Ga0466970_0127496 3300044765 Bacteria 1396
294 Ga0466957_0164691 3300044842 Bacteria 1442
295 Ga0466957_0186641 3300044842 Bacteria 1356
296 Ga0466959_0000236 3300045049 Bacteria 34631
297 Ga0466959_0038938 3300045049 Bacteria 3513
298 Ga0451576_0006385 3300045051 Bacteria 14478
299 Ga0451576_0090357 3300045051 Bacteria 3185
300 Ga0451576_0853124 3300045051 Bacteria 956
301 Ga0466958_0076857 3300045836 Bacteria 2050
302 Ga0466967_0008578 3300045976 Bacteria 7510
303 Ga0466967_0165313 3300045976 Bacteria 2079
304 Ga0466967_0482534 3300045976 Bacteria 1215
305 Ga0466967_0919516 3300045976 Bacteria 870
306 Ga0495583_0177449 3300046506 Bacteria 873
307 Ga0495583_0234909 3300046506 Bacteria 738
308 Ga0495632_0404442 3300046519 Bacteria 596
309 Ga0495622_0090747 3300046557 Unclassified 1404
310 Ga0495667_0553018 3300046559 Bacteria 719
311 Ga0495625_0504837 3300046660 Unclassified 739
312 Ga0495669_0268247 3300046684 Bacteria 820
313 Ga0496104_0066873 3300048907 Bacteria 3413
314 Ga0496104_0769635 3300048907 Bacteria 869
315 Ga0496105_0152559 3300048908 Unclassified 1899
316 Ga0496105_0760552 3300048908 Bacteria 739
317 Ga0496114_0328341 3300048917 Bacteria 1352
318 Ga0501300_009215 3300049523 Bacteria 1441
319 Ga0501031_0307757 3300049568 Bacteria 1027
320 Ga0501032_0298387 3300049569 Bacteria 1042
321 Ga0501033_0718625 3300049570 Bacteria 679
322 Ga0501036_1597546 3300049572 Bacteria 526
323 Ga0501037_0261652 3300049573 Unclassified 1208
324 Ga0501037_0698311 3300049573 Bacteria 675
325 Ga0501039_0367288 3300049575 Bacteria 1130
326 Ga0501041_0507477 3300049577 Bacteria 767
327 Ga0501042_0074481 3300049578 Bacteria 2430
328 Ga0501046_0904219 3300049580 Bacteria 616
329 Ga0501047_0065226 3300049581 Bacteria 3510
330 Ga0501070_0416232 3300049586 Bacteria 1086
331 Ga0501072_0142614 3300049588 Bacteria 1910
332 Ga0501072_0772229 3300049588 Bacteria 753
333 Ga0501074_1011520 3300049590 Bacteria 584
334 Ga0501075_0102697 3300049591 Bacteria 2171
335 Ga0501076_0570921 3300049592 Bacteria 933
336 Ga0501207_037829 3300049654 Bacteria 831
337 Ga0501251_015395 3300049681 Bacteria 961
338 Ga0501257_019228 3300049686 Bacteria 1597
339 Ga0501079_1655306 3300049741 Bacteria 503
340 Ga0501080_0415457 3300049742 Bacteria 1209
341 Ga0501081_0795831 3300049743 Bacteria 711
342 Ga0501035_0069392 3300049822 Bacteria 3125
343 Ga0501035_0223660 3300049822 Bacteria 1606
344 Ga0501044_0144040 3300049823 Bacteria 2370
345 Ga0501045_0085849 3300049824 Bacteria 2323
346 nmdc:mga0k408_36753_c1 3300050493 Bacteria 2811
347 nmdc:mga05p37_11042_c1 3300050507 Bacteria 10730
348 nmdc:mga0qj67_132114_c1 3300050509 Bacteria 2022
349 nmdc:mga0qj67_53202_c1 3300050509 Bacteria 3205
350 nmdc:mga08y16_122543_c1 3300050511 Bacteria 2705
351 nmdc:mga08x19_37643_c1 3300050514 Bacteria 3071
352 nmdc:mga08x19_618937_c1 3300050514 Bacteria 767
353 Ga0500578_0172196 3300053086 Bacteria 1338
354 Ga0500646_0005576 3300053090 Bacteria 3186
355 Ga0500646_0009121 3300053090 Bacteria 2540
356 Ga0500583_0000035 3300053092 Bacteria 96248
357 Ga0500583_0000392 3300053092 Bacteria 14055
358 Ga0500651_0482232 3300053093 Unclassified 686
359 Ga0500554_096057 3300053102 Bacteria 988
360 Ga0500556_0000341 3300053104 Bacteria 34888
361 Ga0500568_0052053 3300053139 Bacteria 1609
362 Ga0500585_060456 3300053144 Bacteria 1363
363 Ga0500589_011599 3300053147 Bacteria 3823
364 Ga0500622_0340231 3300053156 Bacteria 626
365 Ga0500639_122136 3300053163 Bacteria 1249
366 Ga0500637_0008871 3300053178 Bacteria 5092
367 Ga0500584_165711 3300053726 Bacteria 799
368 Ga0500645_057502 3300053730 Bacteria 1127
369 Ga0587077_029654 3300059493 Bacteria 1033
370 2738725193 2738541278 Bacteria 9755573
371 2858905211 2858902515 Bacteria 7086037
372 2867304320 2867302475 Bacteria 7087181
373 2867313654 2867312974 Bacteria 7058875
374 2867322522 2867319477 Bacteria 7069771
375 2867509708 2867507094 Bacteria 6506033
376 Ga0157375_10584352
377 JGI25151J46595_10000400
378 rootH2_10159088
379 rootL2_10240789
380 rootH1_10039676
381 rootH1_10040666
382 rootH1_10229344
383 Ga0065165_1024450
384 Ga0065714_10345483
385 Ga0065707_10291515
386 Ga0070658_10279629
387 Ga0070676_10002454
388 Ga0070676_10006356
389 Ga0070683_100161089
390 Ga0070690_100008855
391 Ga0070690_100861579
392 Ga0070670_100053214
393 Ga0070670_100105336
394 Ga0070670_100548519
395 Ga0068869_100155709
396 Ga0068869_100241209
397 Ga0070666_10788837
398 Ga0070680_100012129
399 Ga0070682_100000041
400 Ga0070660_100084219
401 Ga0070660_100197000
402 Ga0070689_100121049
403 Ga0070661_100307531
404 Ga0070668_100797799
405 Ga0070669_100107891
406 Ga0070669_100925215
407 Ga0070675_100079437
408 Ga0070675_100236644
409 Ga0070675_100445075
410 Ga0070671_100448915
411 Ga0070674_100066054
412 Ga0070688_100008553
413 Ga0070659_101173790
414 Ga0070667_100230235
415 Ga0070709_10372119
416 Ga0070713_101513573
417 Ga0070700_100060573
418 Ga0070694_100371113
419 Ga0070663_100678629
420 Ga0070662_100145454
421 Ga0070662_100180489
422 Ga0070662_100312154
423 Ga0070681_10013651
424 Ga0070681_10069872
425 Ga0070681_11468404
426 Ga0068867_100038258
427 Ga0070698_100232102
428 Ga0070699_100164106
429 Ga0070699_100825993
430 Ga0070679_100005411
431 Ga0070679_100293998
432 Ga0070679_100431426
433 Ga0068853_100186281
434 Ga0068853_100201998
435 Ga0068853_100362945
436 Ga0070672_100082380
437 Ga0070672_100471247
438 Ga0070686_100102903
439 Ga0070686_100143200
440 Ga0070686_100217599
441 Ga0068855_100011161
442 Ga0068855_100144830
443 Ga0070664_100031149
444 Ga0070664_100239862
445 Ga0070664_100437675
446 Ga0068857_100009540
447 Ga0068857_100470262
448 Ga0068857_100512753
449 Ga0068854_100319650
450 Ga0068854_100723802
451 Ga0068856_100279387
452 Ga0068852_100443334
453 Ga0068852_100672305
454 Ga0068859_100128544
455 Ga0068859_100314578
456 Ga0068864_100180804
457 Ga0068864_101525364
458 Ga0068861_100030506
459 Ga0068861_100337250
460 Ga0068870_10009534
461 Ga0068858_101431060
462 Ga0068860_100004507
463 Ga0068860_100543985
464 Ga0068860_101034804
465 Ga0068862_100063851
466 Ga0068862_101116767
467 Ga0070717_10003988
468 Ga0070717_10621839
469 Ga0070712_100759048
470 Ga0075366_10189747
471 Ga0097621_101535349
472 Ga0068871_100295733
473 Ga0068871_100799723
474 Ga0075428_100167701
475 Ga0075430_100041979
476 Ga0075430_100148955
477 Ga0068865_100210401
478 Ga0075436_100143583
479 Ga0097620_100128534
480 Ga0097620_100314577
481 Ga0105240_10139147
482 Ga0105240_10181436
483 Ga0111539_10017557
484 Ga0111539_10165345
485 Ga0105245_10208371
486 Ga0105243_10292676
487 Ga0105242_10057942
488 Ga0105242_10412117
489 Ga0105242_11316769
490 Ga0105242_11563703
491 Ga0105248_10274140
492 Ga0105237_10091536
493 Ga0105237_10831737
494 Ga0105249_10014727
495 Ga0105249_10090671
496 Ga0105249_10564429
497 Ga0105239_10003342
498 Ga0105239_10325198
499 Ga0105246_10118659
500 Ga0105246_10258066
501 Ga0157373_10873421
502 Ga0157371_10325202
503 Ga0157370_10107975
504 Ga0157370_10224719
505 Ga0157370_11203362
506 Ga0157369_10001508
507 Ga0157369_10001587
508 Ga0157369_10131395
509 Ga0157369_10193979
510 Ga0157374_10142860
511 Ga0157374_10352685
512 Ga0157374_10833540
513 Ga0157374_10881698
514 Ga0157378_10022575
515 Ga0157378_10378202
516 Ga0157378_10490289
517 Ga0157378_11182367
518 Ga0163162_10014309
519 Ga0163162_10069481
520 Ga0163162_10163440
521 Ga0163162_11106202
522 Ga0157372_10074450
523 Ga0157372_10517187
524 Ga0157372_11925505
525 Ga0157375_10027292
526 Ga0157375_10047205
527 Ga0157375_10172528
528 Ga0163163_10252718
529 Ga0163163_10307129
530 Ga0163163_10773112
531 Ga0163163_11908540
532 Ga0157380_10013266
533 Ga0157380_10093001
534 Ga0157377_10045490
535 Ga0157379_10329725
536 Ga0157376_10122474
537 Ga0163161_10912908
538 Ga0213874_10039216
539 Ga0213874_10060583
540 Ga0213876_10004724
541 Ga0213876_10011635
542 Ga0213876_10059930
543 Ga0213875_10023311
544 Ga0213871_10005584
545 Ga0209130_1001198
546 Ga0209025_1000486
547 Ga0209758_1003759
548 Ga0207426_1000092
549 Ga0207645_10660045
550 Ga0207643_10003655
551 Ga0207705_10034859
552 Ga0207707_10450207
553 Ga0207707_11187817
554 Ga0207695_10318935
555 Ga0207693_10612328
556 Ga0207663_10848039
557 Ga0207660_10320374
558 Ga0207660_10380797
559 Ga0207662_10539269
560 Ga0207657_10055887
561 Ga0207652_10013322
562 Ga0207652_10336468
563 Ga0207652_10464388
564 Ga0207652_10555910
565 Ga0207681_10023454
566 Ga0207681_10840291
567 Ga0207650_10145163
568 Ga0207650_10660600
569 Ga0207659_10028098
570 Ga0207659_10461387
571 Ga0207659_10675412
572 Ga0207687_10253947
573 Ga0207700_10155833
574 Ga0207700_11188985
575 Ga0207644_10358317
576 Ga0207644_11257842
577 Ga0207706_10053488
578 Ga0207706_10298027
579 Ga0207686_10054628
580 Ga0207704_11154904
581 Ga0207665_10112115
582 Ga0207691_10088436
583 Ga0207691_10321185
584 Ga0207691_10755322
585 Ga0207689_10047300
586 Ga0207689_10225961
587 Ga0207689_10250111
588 Ga0207661_10473490
589 Ga0207661_10685677
590 Ga0207667_10009678
591 Ga0207667_10213986
592 Ga0207667_10454701
593 Ga0207651_10664349
594 Ga0207712_10039731
595 Ga0207640_10029632
596 Ga0207640_10402583
597 Ga0207640_10957673
598 Ga0207677_10851661
599 Ga0207639_10159013
600 Ga0207639_10341496
601 Ga0207639_10453243
602 Ga0207639_10507873
603 Ga0207678_10865364
604 Ga0207708_10768008
605 Ga0207702_10390807
606 Ga0207676_10803249
607 Ga0207674_10066409
608 Ga0207674_10258337
609 Ga0207675_100006933
610 Ga0207675_100034358
611 Ga0207698_10267874
612 Ga0268266_10335191
613 Ga0268265_10055102
614 Ga0268264_10002110
615 Ga0268264_10045884
616 Ga0268264_10476348
617 Ga0307517_10542924
618 Ga0307515_10000031
619 Ga0307513_10102545
620 Ga0307513_10214255
621 Ga0307513_10342626
622 Ga0307509_10132556
623 Ga0307410_10046318
624 Ga0307412_10399752
625 Ga0307416_100078680
626 Ga0307416_100099584
627 Ga0307415_100011911
628 Ga0307415_100642405
629 Ga0373943_0347286
630 Ga0436364_1495722
631 Ga0436365_0070052
632 Ga0436365_1607053
633 Ga0436365_1890468
634 Ga0436360_0239211
635 Ga0436360_1133769
636 Ga0436363_0801232
637 Ga0436362_0182727
638 Ga0436362_1063716
639 Ga0439436_0002217
640 Ga0451791_1305226
641 Ga0451798_0207773
642 Ga0451798_0392976
643 Ga0451800_1129986
644 Ga0451802_1834505
645 Ga0451804_0054560
646 Ga0451807_0203573
647 Ga0451807_2709847
648 Ga0451847_0958825
649 Ga0451853_2852072
650 Ga0439448_0007581
651 Ga0439449_0022225
652 Ga0439449_0112997
653 Ga0439457_001639
654 Ga0439462_0002704
655 Ga0450923_002148
656 Ga0439458_0148647
657 Ga0439460_0022169
658 Ga0451577_0228369
659 Ga0451577_0860399
660 Ga0466969_0000207
661 Ga0466972_0020808
662 Ga0466972_0111156
663 Ga0466966_0040349
664 Ga0466961_0006156
665 Ga0466961_0173898
666 Ga0466963_0237543
667 Ga0466968_0017398
668 Ga0466970_0127496
669 Ga0466957_0164691
670 Ga0466957_0186641
671 Ga0466959_0000236
672 Ga0466959_0038938
673 Ga0451576_0006385
674 Ga0451576_0090357
675 Ga0451576_0853124
676 Ga0466958_0076857
677 Ga0466967_0008578
678 Ga0466967_0165313
679 Ga0466967_0482534
680 Ga0466967_0919516
681 Ga0495583_0177449
682 Ga0495583_0234909
683 Ga0495632_0404442
684 Ga0495622_0090747
685 Ga0495667_0553018
686 Ga0495625_0504837
687 Ga0495669_0268247
688 Ga0496104_0066873
689 Ga0496104_0769635
690 Ga0496105_0152559
691 Ga0496105_0760552
692 Ga0496114_0328341
693 Ga0501300_009215
694 Ga0501031_0307757
695 Ga0501032_0298387
696 Ga0501033_0718625
697 Ga0501036_1597546
698 Ga0501037_0261652
699 Ga0501037_0698311
700 Ga0501039_0367288
701 Ga0501041_0507477
702 Ga0501042_0074481
703 Ga0501046_0904219
704 Ga0501047_0065226
705 Ga0501070_0416232
706 Ga0501072_0142614
707 Ga0501072_0772229
708 Ga0501074_1011520
709 Ga0501075_0102697
710 Ga0501076_0570921
711 Ga0501207_037829
712 Ga0501251_015395
713 Ga0501257_019228
714 Ga0501079_1655306
715 Ga0501080_0415457
716 Ga0501081_0795831
717 Ga0501035_0069392
718 Ga0501035_0223660
719 Ga0501044_0144040
720 Ga0501045_0085849
721 nmdc:mga0k408_36753_c1
722 nmdc:mga05p37_11042_c1
723 nmdc:mga0qj67_132114_c1
724 nmdc:mga0qj67_53202_c1
725 nmdc:mga08y16_122543_c1
726 nmdc:mga08x19_37643_c1
727 nmdc:mga08x19_618937_c1
728 Ga0500578_0172196
729 Ga0500646_0005576
730 Ga0500646_0009121
731 Ga0500583_0000035
732 Ga0500583_0000392
733 Ga0500651_0482232
734 Ga0500554_096057
735 Ga0500556_0000341
736 Ga0500568_0052053
737 Ga0500585_060456
738 Ga0500589_011599
739 Ga0500622_0340231
740 Ga0500639_122136
741 Ga0500637_0008871
742 Ga0500584_165711
743 Ga0500645_057502
744 Ga0587077_029654
745 2738725193
746 2858905211
747 2867304320
748 2867313654
749 2867322522
750 2867509708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23451

130

180

0.95

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

19

96

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.9122 5 102
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8461 9 102
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8402 5 102
6tbl-assembly1.cif.gz_C crystal structure of mms19(ctd)-ciao1-ciao2b cia targeting complex 0.8365 10 89
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8164 9 97
ID Description Score Start End Superfamily
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.959 10 102 3.30.300.130
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9118 10 102 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8793 20 102 3.30.300.130
af_O53157_4_110_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8637 3 102 3.30.300.130
3cq2B00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8436 9 102 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A0A0D1F0-F1-model_v4 Phenylacetate-CoA oxygenase 1.003 9 81
AF-A0A6I5MKZ7-F1-model_v4 deleted 0.9879 10 111
AF-A0A1C5D2S9-F1-model_v4 Ring-1,2-phenylacetyl-CoA epoxidase subunit PaaD 0.9856 5 105
AF-A0A7C6TLK2-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.98 5 111
AF-G9ZWT5-F1-model_v4 Phenylacetate-CoA oxygenase, PaaJ subunit 0.9744 3 165

Map