F427151

General Info

Members Datasets Scaffolds Average Seq Length
375 265 750 123

Family's Representative Sequence

Representative Sequence 3300046557|Ga0495622_0340173|Ga0495622_0340173_129_569
Length 146
Sequence MAQCAIRTQVPTHHHDRTFMTRAILDDSQIHPAARPLIGSKHKDIVREVQAAIAAHQVVVVGMALNPFPRKARKILDVLGTPYKYLQYGSYLNQWHRRNALKMWSGWPTFPMIFVNGVLIGGASELQALVENGEFSAMLARKVREC

Samples

Sample ID Description Type Environment
1 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
230 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
234 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
235 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
236 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
237 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
246 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
249 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
250 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
251 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
252 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
253 2643221645 Massilia sp. Root351 Isolate Unclassified
254 2643221664 Massilia sp. Root418 Isolate Unclassified
255 2738541280 Massilia sp. GV090 Isolate Unclassified
256 2738541300 Massilia sp. GV016 Isolate Unclassified
257 2738543018 Massilia sp. GV045 Isolate Unclassified
258 2738543030 Massilia sp. GV097 Isolate Unclassified
259 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
260 2857553236 Duganella sp. R-74557 Isolate Unclassified
261 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
262 2919476304 Duganella sp. 3397 Isolate Unclassified
263 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
264 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
265 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0.53
Isolates 4.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.27
Nodule 0
Rhizoplane 4.27
Rhizosphere 68
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495622_0340173 3300046557 Bacteria 650
2 JGI25152J39213_1000357 3300002773 Bacteria 28520
3 JGI25150J39212_1005094 3300002774 Bacteria 2840
4 JGI25153J46596_10012766 3300003215 Bacteria 3599
5 Ga0006777J48905_1034290 3300003308 Bacteria 1294
6 Ga0007417J51691_1126448 3300003544 Unclassified 519
7 Ga0055524_1000282 3300003775 Bacteria 49809
8 Ga0055530_10032389 3300003791 Bacteria 1360
9 Ga0055543_1037818 3300004625 Bacteria 823
10 Ga0065165_1002188 3300005262 Bacteria 17582
11 Ga0065165_1146164 3300005262 Bacteria 555
12 Ga0070676_10010066 3300005328 Bacteria 5121
13 Ga0070676_10915870 3300005328 Bacteria 654
14 Ga0070690_100026886 3300005330 Bacteria 3553
15 Ga0070670_100177905 3300005331 Bacteria 1846
16 Ga0070677_10011721 3300005333 Bacteria 3029
17 Ga0068869_100056308 3300005334 Bacteria 2867
18 Ga0070666_10040369 3300005335 Bacteria 3115
19 Ga0068868_100149204 3300005338 Bacteria 1925
20 Ga0070660_100138475 3300005339 Bacteria 1951
21 Ga0070660_100554707 3300005339 Bacteria 959
22 Ga0070689_100307589 3300005340 Bacteria 1321
23 Ga0070687_100033500 3300005343 Bacteria 2537
24 Ga0070661_100019013 3300005344 Bacteria 4891
25 Ga0070668_100018791 3300005347 Bacteria 5190
26 Ga0070669_100002788 3300005353 Bacteria 12611
27 Ga0070669_100950138 3300005353 Bacteria 736
28 Ga0070675_100019387 3300005354 Bacteria 5419
29 Ga0070675_101560459 3300005354 Bacteria 609
30 Ga0070671_100006379 3300005355 Bacteria 9420
31 Ga0070674_100004423 3300005356 Bacteria 8012
32 Ga0070674_100829078 3300005356 Bacteria 801
33 Ga0070673_100349096 3300005364 Bacteria 1313
34 Ga0070673_100416464 3300005364 Bacteria 1204
35 Ga0070659_100001958 3300005366 Bacteria 14717
36 Ga0070659_100833798 3300005366 Bacteria 803
37 Ga0070659_101454234 3300005366 Bacteria 610
38 Ga0070667_100003227 3300005367 Bacteria 13952
39 Ga0070667_100187338 3300005367 Bacteria 1832
40 Ga0070701_10257604 3300005438 Bacteria 1056
41 Ga0070700_101081412 3300005441 Bacteria 664
42 Ga0070663_100439874 3300005455 Bacteria 1073
43 Ga0070678_100115379 3300005456 Bacteria 2108
44 Ga0070678_100865372 3300005456 Unclassified 824
45 Ga0070678_100880177 3300005456 Bacteria 818
46 Ga0070662_100026921 3300005457 Bacteria 3987
47 Ga0070662_100070820 3300005457 Bacteria 2569
48 Ga0070662_100207422 3300005457 Bacteria 1558
49 Ga0068867_100012509 3300005459 Bacteria 6005
50 Ga0068867_100117383 3300005459 Bacteria 2052
51 Ga0070672_100002386 3300005543 Bacteria 11888
52 Ga0070672_100255765 3300005543 Bacteria 1476
53 Ga0070672_100638203 3300005543 Bacteria 930
54 Ga0070665_100575644 3300005548 Bacteria 1139
55 Ga0070665_101122275 3300005548 Bacteria 798
56 Ga0068855_102330673 3300005563 Bacteria 535
57 Ga0070664_100004866 3300005564 Bacteria 10758
58 Ga0070664_100139925 3300005564 Bacteria 2130
59 Ga0068857_100067691 3300005577 Bacteria 3178
60 Ga0068854_100047196 3300005578 Bacteria 3069
61 Ga0068856_100042265 3300005614 Bacteria 4483
62 Ga0068852_100033431 3300005616 Bacteria 4269
63 Ga0068852_100154599 3300005616 Bacteria 2136
64 Ga0068859_100004293 3300005617 Bacteria 14552
65 Ga0068859_100625907 3300005617 Bacteria 1169
66 Ga0068864_100069110 3300005618 Bacteria 3070
67 Ga0068861_100005367 3300005719 Bacteria 8668
68 Ga0068851_10227294 3300005834 Bacteria 1051
69 Ga0068863_100008294 3300005841 Bacteria 10155
70 Ga0068863_100116244 3300005841 Bacteria 2549
71 Ga0068863_100153170 3300005841 Bacteria 2206
72 Ga0068858_100006561 3300005842 Bacteria 11319
73 Ga0068858_101748878 3300005842 Bacteria 614
74 Ga0068860_100001194 3300005843 Bacteria 28367
75 Ga0075365_10492943 3300006038 Bacteria 866
76 Ga0075368_10092024 3300006042 Bacteria 1241
77 Ga0075368_10237324 3300006042 Bacteria 777
78 Ga0075363_100021838 3300006048 Bacteria 3230
79 Ga0075363_100290908 3300006048 Bacteria 947
80 Ga0075364_10341779 3300006051 Bacteria 1020
81 Ga0075364_10938541 3300006051 Bacteria 589
82 Ga0070715_10379631 3300006163 Bacteria 780
83 Ga0075362_10004451 3300006177 Bacteria 5038
84 Ga0075362_10084924 3300006177 Bacteria 1463
85 Ga0075367_10179168 3300006178 Bacteria 1321
86 Ga0075367_10316804 3300006178 Bacteria 983
87 Ga0075369_10004699 3300006186 Bacteria 5065
88 Ga0075369_10069615 3300006186 Bacteria 1547
89 Ga0075366_10003499 3300006195 Bacteria 8295
90 Ga0075366_10060287 3300006195 Bacteria 2254
91 Ga0075366_10256631 3300006195 Bacteria 1067
92 Ga0097621_100048150 3300006237 Bacteria 3457
93 Ga0068871_101743647 3300006358 Bacteria 591
94 Ga0068865_100010254 3300006881 Bacteria 5827
95 Ga0097620_100004293 3300006931 Bacteria 14552
96 Ga0097620_100625939 3300006931 Bacteria 1169
97 Ga0105244_10040842 3300009036 Bacteria 2406
98 Ga0105240_10039041 3300009093 Bacteria 6083
99 Ga0111539_11135736 3300009094 Bacteria 908
100 Ga0111539_11607619 3300009094 Bacteria 754
101 Ga0105245_10257710 3300009098 Bacteria 1696
102 Ga0105243_10005693 3300009148 Bacteria 9692
103 Ga0105241_11021408 3300009174 Bacteria 775
104 Ga0105242_10062412 3300009176 Bacteria 3066
105 Ga0105242_10289258 3300009176 Bacteria 1491
106 Ga0105242_11093769 3300009176 Bacteria 811
107 Ga0105248_10246085 3300009177 Bacteria 2013
108 Ga0105248_10450698 3300009177 Bacteria 1450
109 Ga0105237_10008330 3300009545 Bacteria 11250
110 Ga0105238_10341671 3300009551 Bacteria 1485
111 Ga0105238_11209762 3300009551 Bacteria 780
112 Ga0105249_10042411 3300009553 Bacteria 4138
113 Ga0105249_12830608 3300009553 Bacteria 556
114 Ga0105239_10136895 3300010375 Bacteria 2727
115 Ga0157373_10298194 3300013100 Bacteria 1144
116 Ga0157374_10057712 3300013296 Bacteria 3626
117 Ga0157378_13221748 3300013297 Bacteria 507
118 Ga0163162_10003822 3300013306 Bacteria 14433
119 Ga0157372_10800868 3300013307 Bacteria 1095
120 Ga0157375_10019822 3300013308 Bacteria 6129
121 Ga0163163_12186344 3300014325 Bacteria 612
122 Ga0157380_10027869 3300014326 Bacteria 4302
123 Ga0157380_10275688 3300014326 Bacteria 1536
124 Ga0182008_10000244 3300014497 Bacteria 42053
125 Ga0157379_10052919 3300014968 Bacteria 3627
126 Ga0157379_10070210 3300014968 Bacteria 3133
127 Ga0157379_10794745 3300014968 Bacteria 893
128 Ga0157376_10644621 3300014969 Bacteria 1059
129 Ga0157376_10666748 3300014969 Bacteria 1042
130 Ga0182006_1000002 3300015261 Bacteria 887990
131 Ga0182007_10000073 3300015262 Bacteria 80601
132 Ga0182005_1000002 3300015265 Bacteria 908499
133 Ga0163161_10002952 3300017792 Bacteria 12051
134 Ga0163161_10026451 3300017792 Bacteria 4109
135 Ga0163161_10058854 3300017792 Bacteria 2793
136 Ga0163161_10171807 3300017792 Bacteria 1658
137 Ga0213872_10026996 3300021361 Bacteria 2637
138 Ga0207425_1000001 3300025245 Bacteria 2525432
139 Ga0209129_1000001 3300025258 Bacteria 1452436
140 Ga0209565_1010457 3300025263 Bacteria 2300
141 Ga0209565_1013188 3300025263 Bacteria 1942
142 Ga0209673_1010931 3300025273 Bacteria 3786
143 Ga0209758_1000073 3300025297 Bacteria 276262
144 Ga0209050_1050481 3300025298 Bacteria 1057
145 Ga0209256_1000116 3300025299 Bacteria 169876
146 Ga0209051_1017018 3300025303 Bacteria 3264
147 Ga0209257_1007380 3300025304 Bacteria 6654
148 Ga0207655_1031022 3300025728 Bacteria 2472
149 Ga0207682_10035164 3300025893 Bacteria 2023
150 Ga0207680_10047343 3300025903 Bacteria 2547
151 Ga0207647_10452928 3300025904 Bacteria 719
152 Ga0207685_10246684 3300025905 Bacteria 862
153 Ga0207645_10002656 3300025907 Bacteria 13911
154 Ga0207645_11145466 3300025907 Bacteria 523
155 Ga0207705_10316608 3300025909 Bacteria 1198
156 Ga0207695_10210327 3300025913 Bacteria 1856
157 Ga0207671_10007511 3300025914 Bacteria 9453
158 Ga0207662_10109739 3300025918 Bacteria 1719
159 Ga0207657_10158185 3300025919 Bacteria 1841
160 Ga0207657_10374753 3300025919 Bacteria 1121
161 Ga0207649_10016734 3300025920 Bacteria 4143
162 Ga0207649_10463304 3300025920 Bacteria 959
163 Ga0207649_11173586 3300025920 Bacteria 607
164 Ga0207681_10000326 3300025923 Bacteria 34311
165 Ga0207681_10621808 3300025923 Bacteria 894
166 Ga0207694_11431020 3300025924 Bacteria 584
167 Ga0207650_10073226 3300025925 Bacteria 2580
168 Ga0207650_10380120 3300025925 Bacteria 1166
169 Ga0207659_10015668 3300025926 Bacteria 4919
170 Ga0207659_10206433 3300025926 Bacteria 1572
171 Ga0207687_10036793 3300025927 Bacteria 3335
172 Ga0207644_10000223 3300025931 Bacteria 39200
173 Ga0207644_10089601 3300025931 Bacteria 2290
174 Ga0207644_10953721 3300025931 Unclassified 719
175 Ga0207690_10000831 3300025932 Bacteria 19793
176 Ga0207690_10734046 3300025932 Bacteria 813
177 Ga0207706_10007785 3300025933 Bacteria 9885
178 Ga0207706_10070108 3300025933 Bacteria 3083
179 Ga0207706_10196829 3300025933 Bacteria 1768
180 Ga0207706_10804270 3300025933 Bacteria 798
181 Ga0207686_10057096 3300025934 Bacteria 2456
182 Ga0207686_10173195 3300025934 Bacteria 1524
183 Ga0207686_11555338 3300025934 Bacteria 546
184 Ga0207709_10030812 3300025935 Bacteria 3124
185 Ga0207709_10095250 3300025935 Bacteria 1956
186 Ga0207670_11503700 3300025936 Bacteria 572
187 Ga0207669_10001267 3300025937 Bacteria 10717
188 Ga0207704_10007026 3300025938 Bacteria 5290
189 Ga0207704_10932481 3300025938 Bacteria 731
190 Ga0207691_10006061 3300025940 Bacteria 11679
191 Ga0207691_10042218 3300025940 Bacteria 4205
192 Ga0207691_10247911 3300025940 Bacteria 1538
193 Ga0207691_10837044 3300025940 Bacteria 772
194 Ga0207711_10110132 3300025941 Bacteria 2448
195 Ga0207711_10307182 3300025941 Bacteria 1464
196 Ga0207711_11025060 3300025941 Bacteria 765
197 Ga0207689_10004382 3300025942 Bacteria 12844
198 Ga0207689_10029351 3300025942 Bacteria 4594
199 Ga0207689_10878439 3300025942 Bacteria 757
200 Ga0207689_11639414 3300025942 Bacteria 534
201 Ga0207679_10000629 3300025945 Bacteria 23458
202 Ga0207679_10581677 3300025945 Bacteria 1007
203 Ga0207712_10034579 3300025961 Bacteria 3425
204 Ga0207640_10112631 3300025981 Bacteria 1932
205 Ga0207658_10022628 3300025986 Bacteria 4378
206 Ga0207658_10673505 3300025986 Bacteria 934
207 Ga0207677_10223746 3300026023 Bacteria 1511
208 Ga0207677_10341021 3300026023 Bacteria 1252
209 Ga0207703_10000504 3300026035 Bacteria 40430
210 Ga0207703_11491164 3300026035 Bacteria 651
211 Ga0207678_10120895 3300026067 Bacteria 2235
212 Ga0207678_10499786 3300026067 Bacteria 1060
213 Ga0207708_11030766 3300026075 Bacteria 716
214 Ga0207702_10038119 3300026078 Bacteria 4026
215 Ga0207641_10002204 3300026088 Bacteria 18325
216 Ga0207641_10076838 3300026088 Bacteria 2888
217 Ga0207641_10079920 3300026088 Bacteria 2836
218 Ga0207641_11676561 3300026088 Bacteria 638
219 Ga0207648_10037167 3300026089 Bacteria 4288
220 Ga0207648_10067053 3300026089 Bacteria 3129
221 Ga0207676_10158278 3300026095 Bacteria 1959
222 Ga0207676_11400604 3300026095 Bacteria 695
223 Ga0207675_100012424 3300026118 Bacteria 7956
224 Ga0207675_100501818 3300026118 Bacteria 1208
225 Ga0207683_10087645 3300026121 Bacteria 2768
226 Ga0207683_10131312 3300026121 Bacteria 2253
227 Ga0207683_11314761 3300026121 Bacteria 669
228 Ga0207698_10014993 3300026142 Bacteria 5174
229 Ga0207698_10030043 3300026142 Bacteria 3902
230 Ga0209813_10030412 3300027866 Bacteria 1587
231 Ga0268266_10645224 3300028379 Bacteria 1019
232 Ga0268265_10482892 3300028380 Bacteria 1164
233 Ga0268264_10024442 3300028381 Bacteria 4932
234 Ga0268264_10209367 3300028381 Bacteria 1789
235 Ga0307515_10320698 3300028794 Bacteria 1216
236 Ga0307408_100008652 3300031548 Bacteria 6721
237 Ga0307508_10130631 3300031616 Bacteria 2115
238 Ga0307413_10075223 3300031824 Bacteria 2143
239 Ga0316583_10132225 3300032133 Bacteria 869
240 Ga0316574_0476281 3300035398 Bacteria 780
241 Ga0395900_0578641 3300037418 Bacteria 1065
242 Ga0395905_0001177 3300037471 Bacteria 32676
243 Ga0395905_0485457 3300037471 Bacteria 1135
244 Ga0436361_0096607 3300039447 Bacteria 4888
245 Ga0451793_0454755 3300041452 Bacteria 1996
246 Ga0451802_0170379 3300041460 Bacteria 820
247 Ga0451802_1255762 3300041460 Bacteria 655
248 Ga0451804_1089298 3300041463 Bacteria 583
249 Ga0451853_1384115 3300041512 Bacteria 665
250 Ga0451853_3020787 3300041512 Bacteria 610
251 Ga0450919_000255 3300042121 Bacteria 6111
252 Ga0450898_005665 3300042134 Bacteria 1896
253 Ga0450918_001154 3300042531 Bacteria 5416
254 Ga0451577_0008705 3300042876 Bacteria 9843
255 Ga0451577_0425066 3300042876 Bacteria 1206
256 Ga0466965_0059961 3300044683 Bacteria 1900
257 Ga0453684_1885672 3300044712 Bacteria 605
258 Ga0466968_0574668 3300044735 Bacteria 567
259 Ga0466960_0017602 3300044901 Bacteria 3119
260 Ga0451576_1508932 3300045051 Unclassified 698
261 Ga0495629_0023920 3300046459 Bacteria 4351
262 Ga0495606_0029316 3300046507 Bacteria 3867
263 Ga0495631_0000073 3300046518 Bacteria 64358
264 Ga0495632_0004607 3300046519 Bacteria 9337
265 Ga0495654_0010839 3300046530 Bacteria 4950
266 Ga0495654_0187426 3300046530 Bacteria 892
267 Ga0495609_0145216 3300046538 Bacteria 1011
268 Ga0495597_0034554 3300046542 Bacteria 2284
269 Ga0495645_0702251 3300046543 Bacteria 614
270 Ga0495622_0036614 3300046557 Bacteria 2287
271 Ga0495622_0048725 3300046557 Bacteria 1968
272 Ga0495633_0000329 3300046558 Bacteria 53611
273 Ga0495633_0245741 3300046558 Bacteria 817
274 Ga0495656_0451705 3300046615 Bacteria 677
275 Ga0495668_0268523 3300046616 Bacteria 934
276 Ga0495611_0136577 3300046648 Bacteria 1145
277 Ga0495625_0001295 3300046660 Bacteria 31401
278 Ga0495659_0000021 3300046664 Bacteria 73067
279 Ga0495588_0082582 3300046674 Bacteria 1678
280 Ga0495671_0000102 3300046692 Bacteria 77849
281 Ga0495671_0115445 3300046692 Bacteria 1311
282 Ga0495589_0124162 3300046794 Bacteria 1242
283 Ga0495600_0427124 3300046809 Bacteria 822
284 Ga0495660_0003721 3300046810 Bacteria 9363
285 Ga0495660_0031545 3300046810 Bacteria 2979
286 Ga0495660_0086662 3300046810 Bacteria 1634
287 Ga0495672_0000259 3300047320 Bacteria 73356
288 Ga0495677_0118241 3300047445 Bacteria 1010
289 Ga0495686_0095221 3300047472 Bacteria 1803
290 Ga0495593_0014907 3300047673 Bacteria 4415
291 Ga0496104_0772732 3300048907 Bacteria 867
292 Ga0496105_0066453 3300048908 Bacteria 2977
293 Ga0496108_0565700 3300048911 Unclassified 991
294 Ga0496109_0189753 3300048912 Bacteria 1931
295 Ga0496110_1365138 3300048913 Bacteria 618
296 Ga0496111_0059619 3300048914 Bacteria 2766
297 Ga0496111_0235812 3300048914 Bacteria 1359
298 Ga0496112_0073838 3300048915 Bacteria 3371
299 Ga0496113_0032641 3300048916 Bacteria 3784
300 Ga0496114_1306037 3300048917 Bacteria 612
301 Ga0496115_0489463 3300048918 Bacteria 990
302 Ga0496116_0071421 3300048919 Bacteria 2198
303 Ga0496117_0000001 3300048920 Bacteria 2526244
304 Ga0496118_0000002 3300048921 Bacteria 1690764
305 Ga0496121_0003928 3300048924 Bacteria 20597
306 Ga0496121_0008764 3300048924 Bacteria 11803
307 Ga0496121_0258198 3300048924 Bacteria 1204
308 Ga0496122_0003134 3300048925 Bacteria 22145
309 Ga0496123_0002013 3300048926 Bacteria 26237
310 Ga0496124_0235764 3300048927 Bacteria 1364
311 Ga0496125_0250561 3300048928 Bacteria 1117
312 Ga0496126_0981744 3300048929 Bacteria 635
313 Ga0496126_1130049 3300048929 Bacteria 580
314 Ga0495678_000128 3300049459 Bacteria 89099
315 Ga0495682_0002601 3300049460 Bacteria 8472
316 nmdc:mga03683_16424_c1 3300050489 Bacteria 2781
317 nmdc:mga03683_54836_c1 3300050489 Bacteria 1672
318 nmdc:mga03683_67059_c1 3300050489 Bacteria 1527
319 nmdc:mga03n38_3672_c1 3300050490 Bacteria 4965
320 nmdc:mga00v17_10121_c1 3300050491 Bacteria 5138
321 nmdc:mga0yw44_389730_c1 3300050492 Bacteria 941
322 nmdc:mga0k408_22049_c1 3300050493 Bacteria 3583
323 nmdc:mga0k408_252674_c1 3300050493 Bacteria 1053
324 nmdc:mga0k408_4946_c1 3300050493 Bacteria 7060
325 nmdc:mga0k408_56722_c1 3300050493 Bacteria 2274
326 nmdc:mga06z11_125397_c1 3300050494 Bacteria 1436
327 nmdc:mga06z11_176476_c1 3300050494 Bacteria 1230
328 nmdc:mga04h51_8220_c1 3300050495 Bacteria 2786
329 nmdc:mga07m45_8793_c1 3300050496 Bacteria 5206
330 nmdc:mga08y16_789619_c1 3300050511 Bacteria 943
331 nmdc:mga0sz30_121443_c1 3300050516 Bacteria 1148
332 nmdc:mga0sz30_25403_c1 3300050516 Bacteria 2422
333 Ga0500578_0001085 3300053086 Bacteria 29483
334 Ga0500643_013845 3300053087 Bacteria 2826
335 Ga0500644_0314332 3300053088 Bacteria 672
336 Ga0500646_0011730 3300053090 Bacteria 2256
337 Ga0500583_0438410 3300053092 Bacteria 622
338 Ga0500650_0340192 3300053098 Bacteria 658
339 Ga0500571_000031 3300053110 Bacteria 45855
340 Ga0500572_039223 3300053111 Bacteria 1366
341 Ga0500594_0007412 3300053118 Bacteria 2481
342 Ga0500597_025303 3300053120 Bacteria 2391
343 Ga0500623_266641 3300053127 Bacteria 555
344 Ga0500626_055931 3300053128 Bacteria 1770
345 Ga0500628_060791 3300053129 Bacteria 922
346 Ga0500652_006366 3300053131 Bacteria 3798
347 Ga0500559_0010999 3300053136 Bacteria 3874
348 Ga0500564_041928 3300053138 Bacteria 2105
349 Ga0500568_0007198 3300053139 Bacteria 5482
350 Ga0500568_0196932 3300053139 Bacteria 738
351 Ga0500577_0036795 3300053142 Bacteria 1755
352 Ga0500604_0106805 3300053151 Bacteria 927
353 Ga0500616_0007329 3300053153 Bacteria 7032
354 Ga0500622_0000091 3300053156 Bacteria 93307
355 Ga0500634_0006006 3300053161 Bacteria 5834
356 Ga0500638_011409 3300053162 Bacteria 3939
357 Ga0500636_0028693 3300053177 Bacteria 3286
358 2587729862 2585428057 Bacteria 6737412
359 2587733522 2585428058 Bacteria 6853932
360 2601667559 2600255292 Bacteria 6300551
361 2644029342 2643221603 Bacteria 6147767
362 2644244969 2643221644 Bacteria 6865017
363 2644254261 2643221645 Bacteria 7207331
364 2644358072 2643221664 Bacteria 7272945
365 2738741081 2738541280 Bacteria 6630198
366 2738845540 2738541300 Bacteria 6675882
367 2739276595 2738543018 Bacteria 6718814
368 2739345639 2738543030 Bacteria 6719714
369 2857551720 2857547612 Bacteria 6179999
370 2857554336 2857553236 Bacteria 6166726
371 2885082827 2885080285 Bacteria 6355622
372 2919478547 2919476304 Bacteria 5888696
373 2928090664 2928084124 Bacteria 7159212
374 2932411168 2932410948 Bacteria 6312192
375 2932419265 2932416698 Bacteria 6315112
376 Ga0495622_0340173
377 JGI25152J39213_1000357
378 JGI25150J39212_1005094
379 JGI25153J46596_10012766
380 Ga0006777J48905_1034290
381 Ga0007417J51691_1126448
382 Ga0055524_1000282
383 Ga0055530_10032389
384 Ga0055543_1037818
385 Ga0065165_1002188
386 Ga0065165_1146164
387 Ga0070676_10010066
388 Ga0070676_10915870
389 Ga0070690_100026886
390 Ga0070670_100177905
391 Ga0070677_10011721
392 Ga0068869_100056308
393 Ga0070666_10040369
394 Ga0068868_100149204
395 Ga0070660_100138475
396 Ga0070660_100554707
397 Ga0070689_100307589
398 Ga0070687_100033500
399 Ga0070661_100019013
400 Ga0070668_100018791
401 Ga0070669_100002788
402 Ga0070669_100950138
403 Ga0070675_100019387
404 Ga0070675_101560459
405 Ga0070671_100006379
406 Ga0070674_100004423
407 Ga0070674_100829078
408 Ga0070673_100349096
409 Ga0070673_100416464
410 Ga0070659_100001958
411 Ga0070659_100833798
412 Ga0070659_101454234
413 Ga0070667_100003227
414 Ga0070667_100187338
415 Ga0070701_10257604
416 Ga0070700_101081412
417 Ga0070663_100439874
418 Ga0070678_100115379
419 Ga0070678_100865372
420 Ga0070678_100880177
421 Ga0070662_100026921
422 Ga0070662_100070820
423 Ga0070662_100207422
424 Ga0068867_100012509
425 Ga0068867_100117383
426 Ga0070672_100002386
427 Ga0070672_100255765
428 Ga0070672_100638203
429 Ga0070665_100575644
430 Ga0070665_101122275
431 Ga0068855_102330673
432 Ga0070664_100004866
433 Ga0070664_100139925
434 Ga0068857_100067691
435 Ga0068854_100047196
436 Ga0068856_100042265
437 Ga0068852_100033431
438 Ga0068852_100154599
439 Ga0068859_100004293
440 Ga0068859_100625907
441 Ga0068864_100069110
442 Ga0068861_100005367
443 Ga0068851_10227294
444 Ga0068863_100008294
445 Ga0068863_100116244
446 Ga0068863_100153170
447 Ga0068858_100006561
448 Ga0068858_101748878
449 Ga0068860_100001194
450 Ga0075365_10492943
451 Ga0075368_10092024
452 Ga0075368_10237324
453 Ga0075363_100021838
454 Ga0075363_100290908
455 Ga0075364_10341779
456 Ga0075364_10938541
457 Ga0070715_10379631
458 Ga0075362_10004451
459 Ga0075362_10084924
460 Ga0075367_10179168
461 Ga0075367_10316804
462 Ga0075369_10004699
463 Ga0075369_10069615
464 Ga0075366_10003499
465 Ga0075366_10060287
466 Ga0075366_10256631
467 Ga0097621_100048150
468 Ga0068871_101743647
469 Ga0068865_100010254
470 Ga0097620_100004293
471 Ga0097620_100625939
472 Ga0105244_10040842
473 Ga0105240_10039041
474 Ga0111539_11135736
475 Ga0111539_11607619
476 Ga0105245_10257710
477 Ga0105243_10005693
478 Ga0105241_11021408
479 Ga0105242_10062412
480 Ga0105242_10289258
481 Ga0105242_11093769
482 Ga0105248_10246085
483 Ga0105248_10450698
484 Ga0105237_10008330
485 Ga0105238_10341671
486 Ga0105238_11209762
487 Ga0105249_10042411
488 Ga0105249_12830608
489 Ga0105239_10136895
490 Ga0157373_10298194
491 Ga0157374_10057712
492 Ga0157378_13221748
493 Ga0163162_10003822
494 Ga0157372_10800868
495 Ga0157375_10019822
496 Ga0163163_12186344
497 Ga0157380_10027869
498 Ga0157380_10275688
499 Ga0182008_10000244
500 Ga0157379_10052919
501 Ga0157379_10070210
502 Ga0157379_10794745
503 Ga0157376_10644621
504 Ga0157376_10666748
505 Ga0182006_1000002
506 Ga0182007_10000073
507 Ga0182005_1000002
508 Ga0163161_10002952
509 Ga0163161_10026451
510 Ga0163161_10058854
511 Ga0163161_10171807
512 Ga0213872_10026996
513 Ga0207425_1000001
514 Ga0209129_1000001
515 Ga0209565_1010457
516 Ga0209565_1013188
517 Ga0209673_1010931
518 Ga0209758_1000073
519 Ga0209050_1050481
520 Ga0209256_1000116
521 Ga0209051_1017018
522 Ga0209257_1007380
523 Ga0207655_1031022
524 Ga0207682_10035164
525 Ga0207680_10047343
526 Ga0207647_10452928
527 Ga0207685_10246684
528 Ga0207645_10002656
529 Ga0207645_11145466
530 Ga0207705_10316608
531 Ga0207695_10210327
532 Ga0207671_10007511
533 Ga0207662_10109739
534 Ga0207657_10158185
535 Ga0207657_10374753
536 Ga0207649_10016734
537 Ga0207649_10463304
538 Ga0207649_11173586
539 Ga0207681_10000326
540 Ga0207681_10621808
541 Ga0207694_11431020
542 Ga0207650_10073226
543 Ga0207650_10380120
544 Ga0207659_10015668
545 Ga0207659_10206433
546 Ga0207687_10036793
547 Ga0207644_10000223
548 Ga0207644_10089601
549 Ga0207644_10953721
550 Ga0207690_10000831
551 Ga0207690_10734046
552 Ga0207706_10007785
553 Ga0207706_10070108
554 Ga0207706_10196829
555 Ga0207706_10804270
556 Ga0207686_10057096
557 Ga0207686_10173195
558 Ga0207686_11555338
559 Ga0207709_10030812
560 Ga0207709_10095250
561 Ga0207670_11503700
562 Ga0207669_10001267
563 Ga0207704_10007026
564 Ga0207704_10932481
565 Ga0207691_10006061
566 Ga0207691_10042218
567 Ga0207691_10247911
568 Ga0207691_10837044
569 Ga0207711_10110132
570 Ga0207711_10307182
571 Ga0207711_11025060
572 Ga0207689_10004382
573 Ga0207689_10029351
574 Ga0207689_10878439
575 Ga0207689_11639414
576 Ga0207679_10000629
577 Ga0207679_10581677
578 Ga0207712_10034579
579 Ga0207640_10112631
580 Ga0207658_10022628
581 Ga0207658_10673505
582 Ga0207677_10223746
583 Ga0207677_10341021
584 Ga0207703_10000504
585 Ga0207703_11491164
586 Ga0207678_10120895
587 Ga0207678_10499786
588 Ga0207708_11030766
589 Ga0207702_10038119
590 Ga0207641_10002204
591 Ga0207641_10076838
592 Ga0207641_10079920
593 Ga0207641_11676561
594 Ga0207648_10037167
595 Ga0207648_10067053
596 Ga0207676_10158278
597 Ga0207676_11400604
598 Ga0207675_100012424
599 Ga0207675_100501818
600 Ga0207683_10087645
601 Ga0207683_10131312
602 Ga0207683_11314761
603 Ga0207698_10014993
604 Ga0207698_10030043
605 Ga0209813_10030412
606 Ga0268266_10645224
607 Ga0268265_10482892
608 Ga0268264_10024442
609 Ga0268264_10209367
610 Ga0307515_10320698
611 Ga0307408_100008652
612 Ga0307508_10130631
613 Ga0307413_10075223
614 Ga0316583_10132225
615 Ga0316574_0476281
616 Ga0395900_0578641
617 Ga0395905_0001177
618 Ga0395905_0485457
619 Ga0436361_0096607
620 Ga0451793_0454755
621 Ga0451802_0170379
622 Ga0451802_1255762
623 Ga0451804_1089298
624 Ga0451853_1384115
625 Ga0451853_3020787
626 Ga0450919_000255
627 Ga0450898_005665
628 Ga0450918_001154
629 Ga0451577_0008705
630 Ga0451577_0425066
631 Ga0466965_0059961
632 Ga0453684_1885672
633 Ga0466968_0574668
634 Ga0466960_0017602
635 Ga0451576_1508932
636 Ga0495629_0023920
637 Ga0495606_0029316
638 Ga0495631_0000073
639 Ga0495632_0004607
640 Ga0495654_0010839
641 Ga0495654_0187426
642 Ga0495609_0145216
643 Ga0495597_0034554
644 Ga0495645_0702251
645 Ga0495622_0036614
646 Ga0495622_0048725
647 Ga0495633_0000329
648 Ga0495633_0245741
649 Ga0495656_0451705
650 Ga0495668_0268523
651 Ga0495611_0136577
652 Ga0495625_0001295
653 Ga0495659_0000021
654 Ga0495588_0082582
655 Ga0495671_0000102
656 Ga0495671_0115445
657 Ga0495589_0124162
658 Ga0495600_0427124
659 Ga0495660_0003721
660 Ga0495660_0031545
661 Ga0495660_0086662
662 Ga0495672_0000259
663 Ga0495677_0118241
664 Ga0495686_0095221
665 Ga0495593_0014907
666 Ga0496104_0772732
667 Ga0496105_0066453
668 Ga0496108_0565700
669 Ga0496109_0189753
670 Ga0496110_1365138
671 Ga0496111_0059619
672 Ga0496111_0235812
673 Ga0496112_0073838
674 Ga0496113_0032641
675 Ga0496114_1306037
676 Ga0496115_0489463
677 Ga0496116_0071421
678 Ga0496117_0000001
679 Ga0496118_0000002
680 Ga0496121_0003928
681 Ga0496121_0008764
682 Ga0496121_0258198
683 Ga0496122_0003134
684 Ga0496123_0002013
685 Ga0496124_0235764
686 Ga0496125_0250561
687 Ga0496126_0981744
688 Ga0496126_1130049
689 Ga0495678_000128
690 Ga0495682_0002601
691 nmdc:mga03683_16424_c1
692 nmdc:mga03683_54836_c1
693 nmdc:mga03683_67059_c1
694 nmdc:mga03n38_3672_c1
695 nmdc:mga00v17_10121_c1
696 nmdc:mga0yw44_389730_c1
697 nmdc:mga0k408_22049_c1
698 nmdc:mga0k408_252674_c1
699 nmdc:mga0k408_4946_c1
700 nmdc:mga0k408_56722_c1
701 nmdc:mga06z11_125397_c1
702 nmdc:mga06z11_176476_c1
703 nmdc:mga04h51_8220_c1
704 nmdc:mga07m45_8793_c1
705 nmdc:mga08y16_789619_c1
706 nmdc:mga0sz30_121443_c1
707 nmdc:mga0sz30_25403_c1
708 Ga0500578_0001085
709 Ga0500643_013845
710 Ga0500644_0314332
711 Ga0500646_0011730
712 Ga0500583_0438410
713 Ga0500650_0340192
714 Ga0500571_000031
715 Ga0500572_039223
716 Ga0500594_0007412
717 Ga0500597_025303
718 Ga0500623_266641
719 Ga0500626_055931
720 Ga0500628_060791
721 Ga0500652_006366
722 Ga0500559_0010999
723 Ga0500564_041928
724 Ga0500568_0007198
725 Ga0500568_0196932
726 Ga0500577_0036795
727 Ga0500604_0106805
728 Ga0500616_0007329
729 Ga0500622_0000091
730 Ga0500634_0006006
731 Ga0500638_011409
732 Ga0500636_0028693
733 2587729862
734 2587733522
735 2601667559
736 2644029342
737 2644244969
738 2644254261
739 2644358072
740 2738741081
741 2738845540
742 2739276595
743 2739345639
744 2857551720
745 2857554336
746 2885082827
747 2919478547
748 2928090664
749 2932411168
750 2932419265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

58

120

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ht9-assembly1.cif.gz_B the structure of dimeric human glutaredoxin 2 0.8821 26 120
3h8q-assembly2.cif.gz_B crystal structure of glutaredoxin domain of human thioredoxin reductase 3 0.8796 23 124
2m46-assembly1.cif.gz_A solution nmr structure of sacol0876 from staphylococcus aureus col, nesg target zr353 and csgid target idp00841 0.8719 39 68
2fls-assembly1.cif.gz_A crystal structure of human glutaredoxin 2 complexed with glutathione 0.8713 26 120
2e7p-assembly5.cif.gz_D crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides 0.8698 26 120
ID Description Score Start End Superfamily
af_Q54EX7_20_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9308 21 123 3.40.30.10
af_Q54EX7_20_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9136 21 123 3.40.30.10
af_B4FIR4_56_163_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8755 24 121 3.40.30.10
2m46A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8719 39 68 3.40.30.10
2e7pD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8698 26 120 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A085WEH0-F1-model_v4 Glutaredoxin-related protein 0.9755 21 115 GO:0015035
AF-A0A3D0UWH2-F1-model_v4 deleted 0.9725 37 115
AF-A0A7Y5NTT3-F1-model_v4 Glutaredoxin 0.9687 20 125 GO:0005737
GO:0015038
GO:0034599
AF-A0A7S4MYB7-F1-model_v4 Glutaredoxin domain-containing protein 0.9544 20 122 GO:0005739
GO:0015035
AF-A0A7Y5NTT3-F1-model_v4 Glutaredoxin 0.9511 20 125 GO:0005737
GO:0015038
GO:0034599

Map