F427262

General Info

Members Datasets Scaffolds Average Seq Length
376 204 752 300

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100236935|Ga0070669_1002369351
Length 320
Sequence MTFTQLEYIIAVDNARHFARAAAQCFVTQPTLSMQIHKLEEELGIKIFDRSRQPVLPTEAGSAIIMQARNIIAETKTIHEIVQVQKGILHGRLALGIIPTLAPYLLPLFIASFIKKYPLVKLIVSELTTDLIISKLRDGKIDAGILVTPLQETGINEDPLFYEELVTFVSKTNAAYKKNYVLAADIDPDKLWLLEEGHCFRSQIVNLCELKKKSQEGHHFEYEAGSIETLIRLVETNDGITIIPELAALNMRGKQQNQLRYFKSPAPVREISIATHRNQVKKRIIEALKEEILAAVPEKMEKNKKKKIIPVYPANNDSSF

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
180 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
193 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
200 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
201 2738541278 Niastella sp. CF465 Isolate Unclassified
202 2818991444 Filimonas endophytica 3197 Isolate Unclassified
203 2914759650 Rhizosphaericola mali Isolate Rhizosphere
204 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0
Rhizoplane 0.53
Rhizosphere 86.44
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100236935 3300005353 Unclassified 1448
2 JGI25406J46586_10020788 3300003203 Bacteria 2646
3 rootH1_10153382 3300003316 Bacteria 2187
4 rootH2_10001169 3300003320 Bacteria 4508
5 rootH2_10037451 3300003320 Bacteria 28858
6 rootL2_10179259 3300003322 Bacteria 1832
7 rootL2_10323410 3300003322 Bacteria 1994
8 rootH1_10023435 3300003323 Bacteria 23065
9 Ga0055536_1007144 3300003781 Bacteria 5055
10 Ga0065165_1000501 3300005262 Bacteria 60618
11 Ga0070690_100021007 3300005330 Bacteria 3983
12 Ga0068869_100229356 3300005334 Unclassified 1475
13 Ga0070666_10006049 3300005335 Bacteria 7434
14 Ga0070682_100086507 3300005337 Bacteria 2041
15 Ga0068868_100001434 3300005338 Bacteria 16445
16 Ga0068868_100119988 3300005338 Bacteria 2144
17 Ga0070660_100080493 3300005339 Bacteria 2556
18 Ga0070661_100041129 3300005344 Bacteria 3373
19 Ga0070675_100132518 3300005354 Bacteria 2125
20 Ga0070671_100236912 3300005355 Bacteria 1549
21 Ga0070671_100295665 3300005355 Bacteria 1378
22 Ga0070674_100174373 3300005356 Bacteria 1642
23 Ga0070673_100051646 3300005364 Bacteria 3221
24 Ga0070673_100079012 3300005364 Bacteria 2662
25 Ga0070688_100115438 3300005365 Bacteria 1791
26 Ga0070667_100006513 3300005367 Bacteria 9709
27 Ga0070667_100008663 3300005367 Bacteria 8429
28 Ga0070667_100468536 3300005367 Unclassified 1152
29 Ga0068867_100096355 3300005459 Bacteria 2252
30 Ga0068867_100107336 3300005459 Bacteria 2140
31 Ga0070679_100160817 3300005530 Bacteria 2220
32 Ga0070679_100507725 3300005530 Bacteria 1149
33 Ga0070684_100024863 3300005535 Bacteria 5027
34 Ga0068853_100001810 3300005539 Bacteria 15718
35 Ga0068853_100018962 3300005539 Bacteria 5698
36 Ga0068853_100124297 3300005539 Bacteria 2304
37 Ga0070693_100066105 3300005547 Bacteria 2115
38 Ga0068855_100008375 3300005563 Bacteria 12505
39 Ga0068855_100011690 3300005563 Bacteria 10608
40 Ga0068855_100024245 3300005563 Bacteria 7263
41 Ga0068855_100055910 3300005563 Bacteria 4633
42 Ga0068857_100021700 3300005577 Bacteria 5650
43 Ga0068857_100138916 3300005577 Bacteria 2195
44 Ga0068854_100003818 3300005578 Bacteria 9429
45 Ga0068854_100090762 3300005578 Bacteria 2272
46 Ga0068856_100024839 3300005614 Bacteria 5837
47 Ga0068856_100064620 3300005614 Bacteria 3616
48 Ga0068852_100002379 3300005616 Bacteria 12954
49 Ga0068852_100245670 3300005616 Bacteria 1712
50 Ga0068859_100000588 3300005617 Bacteria 36240
51 Ga0068859_100008683 3300005617 Bacteria 10273
52 Ga0068859_100012413 3300005617 Bacteria 8572
53 Ga0068859_100455585 3300005617 Bacteria 1375
54 Ga0068861_100489292 3300005719 Unclassified 1110
55 Ga0068851_10217535 3300005834 Unclassified 1072
56 Ga0068863_100002277 3300005841 Bacteria 19080
57 Ga0068863_100051546 3300005841 Bacteria 3900
58 Ga0068858_100000141 3300005842 Bacteria 76388
59 Ga0068860_100000252 3300005843 Bacteria 79891
60 Ga0068860_100003398 3300005843 Bacteria 16371
61 Ga0068860_100053129 3300005843 Bacteria 3853
62 Ga0068860_100060473 3300005843 Bacteria 3600
63 Ga0068860_100097162 3300005843 Bacteria 2808
64 Ga0068860_100128502 3300005843 Bacteria 2430
65 Ga0081539_10002032 3300005985 Bacteria 30481
66 Ga0075366_10047958 3300006195 Bacteria 2532
67 Ga0075366_10130304 3300006195 Bacteria 1517
68 Ga0075366_10135414 3300006195 Bacteria 1488
69 Ga0075366_10236373 3300006195 Unclassified 1114
70 Ga0097621_100007848 3300006237 Bacteria 7654
71 Ga0097621_100013099 3300006237 Bacteria 6167
72 Ga0097621_100088676 3300006237 Bacteria 2585
73 Ga0097621_100576423 3300006237 Bacteria 1026
74 Ga0068871_100004396 3300006358 Bacteria 9796
75 Ga0068871_100011840 3300006358 Bacteria 6413
76 Ga0068871_100022149 3300006358 Bacteria 4898
77 Ga0068871_100163478 3300006358 Unclassified 1904
78 Ga0068871_100285970 3300006358 Bacteria 1443
79 Ga0068865_100025780 3300006881 Bacteria 3872
80 Ga0097620_100000588 3300006931 Bacteria 36240
81 Ga0097620_100008683 3300006931 Bacteria 10273
82 Ga0097620_100012413 3300006931 Bacteria 8572
83 Ga0097620_100455577 3300006931 Bacteria 1375
84 Ga0105240_10000431 3300009093 Bacteria 77497
85 Ga0105240_10001434 3300009093 Bacteria 40792
86 Ga0105240_10003449 3300009093 Bacteria 24537
87 Ga0105240_10003572 3300009093 Bacteria 24125
88 Ga0105240_10004355 3300009093 Bacteria 21610
89 Ga0105240_10006516 3300009093 Bacteria 17139
90 Ga0105240_10025695 3300009093 Bacteria 7736
91 Ga0105245_10262478 3300009098 Bacteria 1681
92 Ga0105247_10000606 3300009101 Bacteria 29002
93 Ga0105247_10030870 3300009101 Bacteria 3250
94 Ga0114129_10002037 3300009147 Bacteria 27713
95 Ga0105243_10129654 3300009148 Bacteria 2138
96 Ga0105241_10007371 3300009174 Bacteria 8093
97 Ga0105241_10018532 3300009174 Bacteria 5120
98 Ga0105241_10030710 3300009174 Bacteria 4018
99 Ga0105241_10213641 3300009174 Bacteria 1617
100 Ga0105242_10407908 3300009176 Bacteria 1270
101 Ga0105237_10002049 3300009545 Bacteria 25638
102 Ga0105237_10012201 3300009545 Bacteria 9059
103 Ga0105237_10013246 3300009545 Bacteria 8653
104 Ga0105237_10015708 3300009545 Bacteria 7871
105 Ga0105237_10065005 3300009545 Bacteria 3644
106 Ga0105238_10001088 3300009551 Bacteria 27427
107 Ga0105238_10184051 3300009551 Bacteria 2066
108 Ga0105249_10006091 3300009553 Bacteria 10457
109 Ga0105239_10001881 3300010375 Bacteria 27435
110 Ga0105239_10002232 3300010375 Bacteria 24792
111 Ga0105239_10002512 3300010375 Bacteria 23336
112 Ga0105239_10015165 3300010375 Bacteria 8540
113 Ga0105239_10024455 3300010375 Bacteria 6655
114 Ga0105239_10225287 3300010375 Bacteria 2103
115 Ga0105239_10263707 3300010375 Bacteria 1936
116 Ga0157373_10048425 3300013100 Bacteria 3030
117 Ga0157373_10052036 3300013100 Bacteria 2915
118 Ga0157371_10008983 3300013102 Bacteria 7902
119 Ga0157371_10204843 3300013102 Bacteria 1415
120 Ga0157370_10106315 3300013104 Bacteria 2626
121 Ga0157370_10107834 3300013104 Bacteria 2605
122 Ga0157370_10126856 3300013104 Unclassified 2382
123 Ga0157370_10159766 3300013104 Bacteria 2097
124 Ga0157370_10274152 3300013104 Bacteria 1559
125 Ga0157370_10374838 3300013104 Unclassified 1311
126 Ga0157369_10015758 3300013105 Bacteria 8517
127 Ga0157369_10017716 3300013105 Bacteria 7999
128 Ga0157369_10095191 3300013105 Bacteria 3178
129 Ga0157374_10000025 3300013296 Bacteria 245131
130 Ga0157374_10070506 3300013296 Bacteria 3294
131 Ga0157374_10094941 3300013296 Bacteria 2851
132 Ga0157374_10223013 3300013296 Bacteria 1850
133 Ga0157374_10568821 3300013296 Bacteria 1142
134 Ga0157378_10003494 3300013297 Bacteria 13950
135 Ga0157378_10004116 3300013297 Bacteria 12844
136 Ga0157378_10054099 3300013297 Bacteria 3574
137 Ga0157378_10187688 3300013297 Bacteria 1948
138 Ga0157378_10228086 3300013297 Bacteria 1773
139 Ga0163162_10000124 3300013306 Bacteria 68603
140 Ga0163162_10001303 3300013306 Bacteria 23341
141 Ga0163162_10027712 3300013306 Bacteria 5603
142 Ga0163162_10142083 3300013306 Bacteria 2514
143 Ga0163162_10168845 3300013306 Bacteria 2312
144 Ga0163162_10654938 3300013306 Bacteria 1174
145 Ga0157372_10002269 3300013307 Bacteria 20833
146 Ga0157372_10002934 3300013307 Bacteria 18400
147 Ga0157372_10117662 3300013307 Unclassified 3048
148 Ga0157372_10463334 3300013307 Unclassified 1477
149 Ga0157375_10027858 3300013308 Bacteria 5286
150 Ga0157375_10484991 3300013308 Bacteria 1401
151 Ga0163163_10377598 3300014325 Bacteria 1475
152 Ga0163163_10474638 3300014325 Unclassified 1312
153 Ga0157380_10001657 3300014326 Bacteria 14681
154 Ga0157380_10009117 3300014326 Bacteria 7094
155 Ga0157380_10014693 3300014326 Bacteria 5733
156 Ga0157380_10071121 3300014326 Bacteria 2814
157 Ga0157379_10000730 3300014968 Bacteria 26590
158 Ga0157379_10073694 3300014968 Bacteria 3056
159 Ga0157379_10292592 3300014968 Unclassified 1483
160 Ga0157376_10016798 3300014969 Bacteria 5566
161 Ga0157376_10021568 3300014969 Bacteria 5005
162 Ga0163161_10020306 3300017792 Bacteria 4661
163 Ga0209646_1001005 3300025246 Bacteria 8660
164 Ga0209676_1003343 3300025292 Bacteria 10009
165 Ga0207426_1000170 3300025302 Bacteria 164216
166 Ga0207656_10153511 3300025321 Unclassified 1092
167 Ga0207710_10000175 3300025900 Bacteria 65485
168 Ga0207710_10019236 3300025900 Bacteria 2913
169 Ga0207680_10001105 3300025903 Bacteria 12710
170 Ga0207647_10008161 3300025904 Bacteria 7525
171 Ga0207645_10043071 3300025907 Bacteria 2888
172 Ga0207654_10012124 3300025911 Bacteria 4411
173 Ga0207654_10029548 3300025911 Bacteria 3002
174 Ga0207707_10075419 3300025912 Bacteria 2942
175 Ga0207707_10326349 3300025912 Bacteria 1324
176 Ga0207707_10359149 3300025912 Bacteria 1254
177 Ga0207695_10000282 3300025913 Bacteria 126242
178 Ga0207695_10001411 3300025913 Bacteria 40483
179 Ga0207695_10001469 3300025913 Bacteria 39469
180 Ga0207695_10003026 3300025913 Bacteria 24133
181 Ga0207695_10041052 3300025913 Bacteria 4953
182 Ga0207695_10051044 3300025913 Bacteria 4346
183 Ga0207671_10001751 3300025914 Bacteria 24414
184 Ga0207671_10003380 3300025914 Bacteria 15969
185 Ga0207671_10006312 3300025914 Bacteria 10588
186 Ga0207671_10008658 3300025914 Bacteria 8590
187 Ga0207671_10013131 3300025914 Bacteria 6615
188 Ga0207671_10015533 3300025914 Bacteria 5955
189 Ga0207671_10110587 3300025914 Bacteria 2090
190 Ga0207671_10183440 3300025914 Bacteria 1629
191 Ga0207660_10005350 3300025917 Bacteria 8336
192 Ga0207657_10008680 3300025919 Bacteria 10288
193 Ga0207649_10108107 3300025920 Bacteria 1853
194 Ga0207652_10085334 3300025921 Bacteria 2767
195 Ga0207652_10365960 3300025921 Bacteria 1301
196 Ga0207694_10045297 3300025924 Bacteria 3398
197 Ga0207694_10114251 3300025924 Bacteria 2150
198 Ga0207694_10160818 3300025924 Unclassified 1814
199 Ga0207650_10073090 3300025925 Bacteria 2582
200 Ga0207659_10027806 3300025926 Bacteria 3834
201 Ga0207659_10028669 3300025926 Bacteria 3786
202 Ga0207659_10322581 3300025926 Bacteria 1275
203 Ga0207687_10298908 3300025927 Unclassified 1296
204 Ga0207690_10383171 3300025932 Unclassified 1118
205 Ga0207686_10294779 3300025934 Unclassified 1202
206 Ga0207704_10352568 3300025938 Bacteria 1146
207 Ga0207691_10113023 3300025940 Bacteria 2414
208 Ga0207689_10058951 3300025942 Bacteria 3158
209 Ga0207689_10109540 3300025942 Bacteria 2269
210 Ga0207661_10026829 3300025944 Bacteria 4394
211 Ga0207667_10000403 3300025949 Bacteria 58481
212 Ga0207667_10001258 3300025949 Bacteria 31777
213 Ga0207667_10010666 3300025949 Bacteria 10725
214 Ga0207667_10045986 3300025949 Bacteria 4622
215 Ga0207667_10312426 3300025949 Bacteria 1605
216 Ga0207667_10446459 3300025949 Bacteria 1315
217 Ga0207651_10424356 3300025960 Bacteria 1136
218 Ga0207712_10026076 3300025961 Bacteria 3891
219 Ga0207712_10032401 3300025961 Bacteria 3527
220 Ga0207640_10026393 3300025981 Bacteria 3526
221 Ga0207640_10072586 3300025981 Bacteria 2322
222 Ga0207658_10029891 3300025986 Unclassified 3853
223 Ga0207677_10010638 3300026023 Bacteria 5212
224 Ga0207677_10118763 3300026023 Bacteria 1984
225 Ga0207677_10235619 3300026023 Bacteria 1477
226 Ga0207703_10000147 3300026035 Bacteria 82822
227 Ga0207703_10002892 3300026035 Bacteria 14620
228 Ga0207639_10197345 3300026041 Bacteria 1723
229 Ga0207702_10039074 3300026078 Bacteria 3975
230 Ga0207641_10000133 3300026088 Bacteria 109199
231 Ga0207641_10006390 3300026088 Bacteria 9936
232 Ga0207648_10001120 3300026089 Bacteria 30104
233 Ga0207648_10035364 3300026089 Bacteria 4400
234 Ga0207648_10057613 3300026089 Bacteria 3390
235 Ga0207648_10125064 3300026089 Bacteria 2262
236 Ga0207676_10012264 3300026095 Bacteria 6135
237 Ga0207674_10000600 3300026116 Bacteria 47324
238 Ga0207674_10027536 3300026116 Bacteria 6010
239 Ga0207674_10383957 3300026116 Bacteria 1358
240 Ga0207698_10028376 3300026142 Bacteria 3990
241 Ga0207698_10214729 3300026142 Bacteria 1733
242 Ga0209999_1024454 3300027543 Bacteria 1114
243 Ga0268266_10000026 3300028379 Bacteria 434485
244 Ga0268264_10000015 3300028381 Bacteria 508501
245 Ga0268264_10000019 3300028381 Bacteria 488112
246 Ga0268264_10000054 3300028381 Bacteria 317048
247 Ga0268264_10002332 3300028381 Bacteria 16777
248 Ga0268264_10040368 3300028381 Bacteria 3856
249 Ga0268264_10373372 3300028381 Bacteria 1364
250 Ga0268264_10532036 3300028381 Unclassified 1150
251 Ga0307517_10001171 3300028786 Bacteria 44114
252 Ga0307515_10000002 3300028794 Bacteria 1231751
253 Ga0307515_10000024 3300028794 Bacteria 393119
254 Ga0307511_10000024 3300030521 Bacteria 112616
255 Ga0265327_10000051 3300031251 Bacteria 257963
256 Ga0265327_10000148 3300031251 Bacteria 151952
257 Ga0265316_10064155 3300031344 Unclassified 2846
258 Ga0307513_10035173 3300031456 Bacteria 5610
259 Ga0307509_10088015 3300031507 Bacteria 3189
260 Ga0307508_10000162 3300031616 Bacteria 80675
261 Ga0307516_10005057 3300031730 Bacteria 15964
262 Ga0307405_10001696 3300031731 Bacteria 9400
263 Ga0307405_10139449 3300031731 Bacteria 1688
264 Ga0307413_10176259 3300031824 Bacteria 1519
265 Ga0307412_10039826 3300031911 Bacteria 3037
266 Ga0307414_10243963 3300032004 Bacteria 1489
267 Ga0307414_10287569 3300032004 Bacteria 1384
268 Ga0307411_10117198 3300032005 Bacteria 1918
269 Ga0307415_100162772 3300032126 Bacteria 1731
270 Ga0307510_10003234 3300033180 Bacteria 18935
271 Ga0373927_0046201 3300035695 Bacteria 2818
272 Ga0373937_0268573 3300036401 Bacteria 1610
273 Ga0439436_0017933 3300041404 Bacteria 2118
274 Ga0439439_0001945 3300041406 Bacteria 4278
275 Ga0451802_1442689 3300041460 Bacteria 1364
276 Ga0451853_3654459 3300041512 Bacteria 3791
277 Ga0439449_0005229 3300042007 Bacteria 4978
278 Ga0439457_000054 3300042014 Bacteria 23780
279 Ga0439462_0014927 3300042015 Bacteria 1999
280 Ga0450898_011353 3300042134 Unclassified 1457
281 Ga0450899_001400 3300042135 Bacteria 2694
282 Ga0439446_0057192 3300042156 Bacteria 1173
283 Ga0466969_0003430 3300044656 Bacteria 8431
284 Ga0466972_0000032 3300044658 Bacteria 159445
285 Ga0466972_0000205 3300044658 Bacteria 43008
286 Ga0466972_0033088 3300044658 Bacteria 2536
287 Ga0466972_0039642 3300044658 Bacteria 2298
288 Ga0466966_0000054 3300044684 Bacteria 82352
289 Ga0466961_0005579 3300044693 Bacteria 7947
290 Ga0466964_0106609 3300044706 Bacteria 1244
291 Ga0453684_0227368 3300044712 Bacteria 2156
292 Ga0466971_0032677 3300044719 Bacteria 2331
293 Ga0466971_0049804 3300044719 Bacteria 1885
294 Ga0466968_0065065 3300044735 Bacteria 1578
295 Ga0466970_0025509 3300044765 Bacteria 3095
296 Ga0466957_0000656 3300044842 Bacteria 17549
297 Ga0466957_0019164 3300044842 Bacteria 4024
298 Ga0466959_0000012 3300045049 Bacteria 168961
299 Ga0466959_0000436 3300045049 Bacteria 24268
300 Ga0466958_0020026 3300045836 Bacteria 3899
301 Ga0495638_0127724 3300046460 Bacteria 1497
302 Ga0495580_0089818 3300046472 Bacteria 2139
303 Ga0495606_0003604 3300046507 Bacteria 16293
304 Ga0495648_0000493 3300046524 Bacteria 42504
305 Ga0495665_0079870 3300046531 Bacteria 1721
306 Ga0495645_0140432 3300046543 Bacteria 1686
307 Ga0495668_0000191 3300046616 Bacteria 90923
308 Ga0495668_0003162 3300046616 Bacteria 12690
309 Ga0495611_0002528 3300046648 Bacteria 8319
310 Ga0495658_0057185 3300046683 Bacteria 2227
311 Ga0495649_0081408 3300046694 Bacteria 1731
312 Ga0495649_0121234 3300046694 Bacteria 1383
313 Ga0495672_0033398 3300047320 Bacteria 3188
314 Ga0495687_000031 3300047443 Bacteria 274659
315 Ga0495686_0000128 3300047472 Bacteria 156223
316 Ga0495686_0028362 3300047472 Bacteria 3646
317 Ga0495686_0104546 3300047472 Bacteria 1705
318 Ga0496115_0105857 3300048918 Bacteria 2309
319 Ga0496121_0011870 3300048924 Bacteria 9595
320 Ga0496124_0062985 3300048927 Bacteria 3101
321 Ga0501032_0036133 3300049569 Bacteria 3374
322 Ga0501033_0023176 3300049570 Bacteria 4682
323 Ga0501033_0075174 3300049570 Bacteria 2480
324 Ga0501034_0004635 3300049571 Bacteria 15228
325 Ga0501034_0012164 3300049571 Bacteria 8899
326 Ga0501034_0195510 3300049571 Bacteria 1982
327 Ga0501034_0687933 3300049571 Unclassified 922
328 Ga0501036_0090059 3300049572 Bacteria 2592
329 Ga0501037_0085548 3300049573 Bacteria 2283
330 Ga0501038_0015399 3300049574 Bacteria 6952
331 Ga0501043_0091803 3300049579 Bacteria 2387
332 Ga0501043_0126197 3300049579 Bacteria 2007
333 Ga0501043_0251245 3300049579 Bacteria 1362
334 Ga0501046_0397366 3300049580 Bacteria 996
335 Ga0501047_0003414 3300049581 Bacteria 15035
336 Ga0501047_0029171 3300049581 Bacteria 5321
337 Ga0501047_0042976 3300049581 Bacteria 4366
338 Ga0501047_0123219 3300049581 Bacteria 2473
339 Ga0501047_0137287 3300049581 Bacteria 2325
340 Ga0501070_0409119 3300049586 Unclassified 1096
341 Ga0501073_0063561 3300049589 Bacteria 2574
342 Ga0501219_000235 3300049703 Bacteria 10559
343 Ga0501225_0003122 3300049705 Bacteria 5063
344 Ga0501079_0058714 3300049741 Bacteria 2969
345 Ga0501083_0045354 3300049744 Bacteria 2974
346 Ga0501241_010736 3300049758 Unclassified 1664
347 Ga0501044_0011310 3300049823 Bacteria 9672
348 Ga0501044_0013869 3300049823 Bacteria 8710
349 Ga0501044_0065602 3300049823 Bacteria 3702
350 Ga0501044_0310739 3300049823 Bacteria 1503
351 Ga0501284_00015 3300050005 Bacteria 104438
352 nmdc:mga0k408_139010_c1 3300050493 Bacteria 1444
353 nmdc:mga0k408_46811_c1 3300050493 Bacteria 2498
354 nmdc:mga0k408_62762_c1 3300050493 Bacteria 2161
355 nmdc:mga05p37_1846_c2 3300050507 Bacteria 21167
356 Ga0500578_0000001 3300053086 Bacteria 317120
357 Ga0500578_0049064 3300053086 Bacteria 2708
358 Ga0500644_0001876 3300053088 Bacteria 5416
359 Ga0500644_0097440 3300053088 Bacteria 1112
360 Ga0500646_0010535 3300053090 Bacteria 2372
361 Ga0500583_0000048 3300053092 Bacteria 78503
362 Ga0500583_0000388 3300053092 Bacteria 14200
363 Ga0500562_000080 3300053108 Bacteria 43341
364 Ga0500642_0054120 3300053130 Bacteria 1781
365 Ga0500604_0002450 3300053151 Bacteria 5058
366 Ga0500622_0000176 3300053156 Bacteria 69125
367 Ga0500622_0007082 3300053156 Bacteria 6412
368 Ga0500636_0040616 3300053177 Bacteria 2751
369 Ga0500611_000029 3300053727 Bacteria 89288
370 Ga0500645_011556 3300053730 Bacteria 2880
371 Ga0500661_006450 3300055283 Bacteria 2181
372 2522552127 2522125168 Bacteria 7376607
373 2738728866 2738541278 Bacteria 9755573
374 2819587862 2818991444 Bacteria 6968812
375 2914759902 2914759650 Bacteria 4701441
376 2929158111 2929154850 Bacteria 6753285
377 Ga0070669_100236935
378 JGI25406J46586_10020788
379 rootH1_10153382
380 rootH2_10001169
381 rootH2_10037451
382 rootL2_10179259
383 rootL2_10323410
384 rootH1_10023435
385 Ga0055536_1007144
386 Ga0065165_1000501
387 Ga0070690_100021007
388 Ga0068869_100229356
389 Ga0070666_10006049
390 Ga0070682_100086507
391 Ga0068868_100001434
392 Ga0068868_100119988
393 Ga0070660_100080493
394 Ga0070661_100041129
395 Ga0070675_100132518
396 Ga0070671_100236912
397 Ga0070671_100295665
398 Ga0070674_100174373
399 Ga0070673_100051646
400 Ga0070673_100079012
401 Ga0070688_100115438
402 Ga0070667_100006513
403 Ga0070667_100008663
404 Ga0070667_100468536
405 Ga0068867_100096355
406 Ga0068867_100107336
407 Ga0070679_100160817
408 Ga0070679_100507725
409 Ga0070684_100024863
410 Ga0068853_100001810
411 Ga0068853_100018962
412 Ga0068853_100124297
413 Ga0070693_100066105
414 Ga0068855_100008375
415 Ga0068855_100011690
416 Ga0068855_100024245
417 Ga0068855_100055910
418 Ga0068857_100021700
419 Ga0068857_100138916
420 Ga0068854_100003818
421 Ga0068854_100090762
422 Ga0068856_100024839
423 Ga0068856_100064620
424 Ga0068852_100002379
425 Ga0068852_100245670
426 Ga0068859_100000588
427 Ga0068859_100008683
428 Ga0068859_100012413
429 Ga0068859_100455585
430 Ga0068861_100489292
431 Ga0068851_10217535
432 Ga0068863_100002277
433 Ga0068863_100051546
434 Ga0068858_100000141
435 Ga0068860_100000252
436 Ga0068860_100003398
437 Ga0068860_100053129
438 Ga0068860_100060473
439 Ga0068860_100097162
440 Ga0068860_100128502
441 Ga0081539_10002032
442 Ga0075366_10047958
443 Ga0075366_10130304
444 Ga0075366_10135414
445 Ga0075366_10236373
446 Ga0097621_100007848
447 Ga0097621_100013099
448 Ga0097621_100088676
449 Ga0097621_100576423
450 Ga0068871_100004396
451 Ga0068871_100011840
452 Ga0068871_100022149
453 Ga0068871_100163478
454 Ga0068871_100285970
455 Ga0068865_100025780
456 Ga0097620_100000588
457 Ga0097620_100008683
458 Ga0097620_100012413
459 Ga0097620_100455577
460 Ga0105240_10000431
461 Ga0105240_10001434
462 Ga0105240_10003449
463 Ga0105240_10003572
464 Ga0105240_10004355
465 Ga0105240_10006516
466 Ga0105240_10025695
467 Ga0105245_10262478
468 Ga0105247_10000606
469 Ga0105247_10030870
470 Ga0114129_10002037
471 Ga0105243_10129654
472 Ga0105241_10007371
473 Ga0105241_10018532
474 Ga0105241_10030710
475 Ga0105241_10213641
476 Ga0105242_10407908
477 Ga0105237_10002049
478 Ga0105237_10012201
479 Ga0105237_10013246
480 Ga0105237_10015708
481 Ga0105237_10065005
482 Ga0105238_10001088
483 Ga0105238_10184051
484 Ga0105249_10006091
485 Ga0105239_10001881
486 Ga0105239_10002232
487 Ga0105239_10002512
488 Ga0105239_10015165
489 Ga0105239_10024455
490 Ga0105239_10225287
491 Ga0105239_10263707
492 Ga0157373_10048425
493 Ga0157373_10052036
494 Ga0157371_10008983
495 Ga0157371_10204843
496 Ga0157370_10106315
497 Ga0157370_10107834
498 Ga0157370_10126856
499 Ga0157370_10159766
500 Ga0157370_10274152
501 Ga0157370_10374838
502 Ga0157369_10015758
503 Ga0157369_10017716
504 Ga0157369_10095191
505 Ga0157374_10000025
506 Ga0157374_10070506
507 Ga0157374_10094941
508 Ga0157374_10223013
509 Ga0157374_10568821
510 Ga0157378_10003494
511 Ga0157378_10004116
512 Ga0157378_10054099
513 Ga0157378_10187688
514 Ga0157378_10228086
515 Ga0163162_10000124
516 Ga0163162_10001303
517 Ga0163162_10027712
518 Ga0163162_10142083
519 Ga0163162_10168845
520 Ga0163162_10654938
521 Ga0157372_10002269
522 Ga0157372_10002934
523 Ga0157372_10117662
524 Ga0157372_10463334
525 Ga0157375_10027858
526 Ga0157375_10484991
527 Ga0163163_10377598
528 Ga0163163_10474638
529 Ga0157380_10001657
530 Ga0157380_10009117
531 Ga0157380_10014693
532 Ga0157380_10071121
533 Ga0157379_10000730
534 Ga0157379_10073694
535 Ga0157379_10292592
536 Ga0157376_10016798
537 Ga0157376_10021568
538 Ga0163161_10020306
539 Ga0209646_1001005
540 Ga0209676_1003343
541 Ga0207426_1000170
542 Ga0207656_10153511
543 Ga0207710_10000175
544 Ga0207710_10019236
545 Ga0207680_10001105
546 Ga0207647_10008161
547 Ga0207645_10043071
548 Ga0207654_10012124
549 Ga0207654_10029548
550 Ga0207707_10075419
551 Ga0207707_10326349
552 Ga0207707_10359149
553 Ga0207695_10000282
554 Ga0207695_10001411
555 Ga0207695_10001469
556 Ga0207695_10003026
557 Ga0207695_10041052
558 Ga0207695_10051044
559 Ga0207671_10001751
560 Ga0207671_10003380
561 Ga0207671_10006312
562 Ga0207671_10008658
563 Ga0207671_10013131
564 Ga0207671_10015533
565 Ga0207671_10110587
566 Ga0207671_10183440
567 Ga0207660_10005350
568 Ga0207657_10008680
569 Ga0207649_10108107
570 Ga0207652_10085334
571 Ga0207652_10365960
572 Ga0207694_10045297
573 Ga0207694_10114251
574 Ga0207694_10160818
575 Ga0207650_10073090
576 Ga0207659_10027806
577 Ga0207659_10028669
578 Ga0207659_10322581
579 Ga0207687_10298908
580 Ga0207690_10383171
581 Ga0207686_10294779
582 Ga0207704_10352568
583 Ga0207691_10113023
584 Ga0207689_10058951
585 Ga0207689_10109540
586 Ga0207661_10026829
587 Ga0207667_10000403
588 Ga0207667_10001258
589 Ga0207667_10010666
590 Ga0207667_10045986
591 Ga0207667_10312426
592 Ga0207667_10446459
593 Ga0207651_10424356
594 Ga0207712_10026076
595 Ga0207712_10032401
596 Ga0207640_10026393
597 Ga0207640_10072586
598 Ga0207658_10029891
599 Ga0207677_10010638
600 Ga0207677_10118763
601 Ga0207677_10235619
602 Ga0207703_10000147
603 Ga0207703_10002892
604 Ga0207639_10197345
605 Ga0207702_10039074
606 Ga0207641_10000133
607 Ga0207641_10006390
608 Ga0207648_10001120
609 Ga0207648_10035364
610 Ga0207648_10057613
611 Ga0207648_10125064
612 Ga0207676_10012264
613 Ga0207674_10000600
614 Ga0207674_10027536
615 Ga0207674_10383957
616 Ga0207698_10028376
617 Ga0207698_10214729
618 Ga0209999_1024454
619 Ga0268266_10000026
620 Ga0268264_10000015
621 Ga0268264_10000019
622 Ga0268264_10000054
623 Ga0268264_10002332
624 Ga0268264_10040368
625 Ga0268264_10373372
626 Ga0268264_10532036
627 Ga0307517_10001171
628 Ga0307515_10000002
629 Ga0307515_10000024
630 Ga0307511_10000024
631 Ga0265327_10000051
632 Ga0265327_10000148
633 Ga0265316_10064155
634 Ga0307513_10035173
635 Ga0307509_10088015
636 Ga0307508_10000162
637 Ga0307516_10005057
638 Ga0307405_10001696
639 Ga0307405_10139449
640 Ga0307413_10176259
641 Ga0307412_10039826
642 Ga0307414_10243963
643 Ga0307414_10287569
644 Ga0307411_10117198
645 Ga0307415_100162772
646 Ga0307510_10003234
647 Ga0373927_0046201
648 Ga0373937_0268573
649 Ga0439436_0017933
650 Ga0439439_0001945
651 Ga0451802_1442689
652 Ga0451853_3654459
653 Ga0439449_0005229
654 Ga0439457_000054
655 Ga0439462_0014927
656 Ga0450898_011353
657 Ga0450899_001400
658 Ga0439446_0057192
659 Ga0466969_0003430
660 Ga0466972_0000032
661 Ga0466972_0000205
662 Ga0466972_0033088
663 Ga0466972_0039642
664 Ga0466966_0000054
665 Ga0466961_0005579
666 Ga0466964_0106609
667 Ga0453684_0227368
668 Ga0466971_0032677
669 Ga0466971_0049804
670 Ga0466968_0065065
671 Ga0466970_0025509
672 Ga0466957_0000656
673 Ga0466957_0019164
674 Ga0466959_0000012
675 Ga0466959_0000436
676 Ga0466958_0020026
677 Ga0495638_0127724
678 Ga0495580_0089818
679 Ga0495606_0003604
680 Ga0495648_0000493
681 Ga0495665_0079870
682 Ga0495645_0140432
683 Ga0495668_0000191
684 Ga0495668_0003162
685 Ga0495611_0002528
686 Ga0495658_0057185
687 Ga0495649_0081408
688 Ga0495649_0121234
689 Ga0495672_0033398
690 Ga0495687_000031
691 Ga0495686_0000128
692 Ga0495686_0028362
693 Ga0495686_0104546
694 Ga0496115_0105857
695 Ga0496121_0011870
696 Ga0496124_0062985
697 Ga0501032_0036133
698 Ga0501033_0023176
699 Ga0501033_0075174
700 Ga0501034_0004635
701 Ga0501034_0012164
702 Ga0501034_0195510
703 Ga0501034_0687933
704 Ga0501036_0090059
705 Ga0501037_0085548
706 Ga0501038_0015399
707 Ga0501043_0091803
708 Ga0501043_0126197
709 Ga0501043_0251245
710 Ga0501046_0397366
711 Ga0501047_0003414
712 Ga0501047_0029171
713 Ga0501047_0042976
714 Ga0501047_0123219
715 Ga0501047_0137287
716 Ga0501070_0409119
717 Ga0501073_0063561
718 Ga0501219_000235
719 Ga0501225_0003122
720 Ga0501079_0058714
721 Ga0501083_0045354
722 Ga0501241_010736
723 Ga0501044_0011310
724 Ga0501044_0013869
725 Ga0501044_0065602
726 Ga0501044_0310739
727 Ga0501284_00015
728 nmdc:mga0k408_139010_c1
729 nmdc:mga0k408_46811_c1
730 nmdc:mga0k408_62762_c1
731 nmdc:mga05p37_1846_c2
732 Ga0500578_0000001
733 Ga0500578_0049064
734 Ga0500644_0001876
735 Ga0500644_0097440
736 Ga0500646_0010535
737 Ga0500583_0000048
738 Ga0500583_0000388
739 Ga0500562_000080
740 Ga0500642_0054120
741 Ga0500604_0002450
742 Ga0500622_0000176
743 Ga0500622_0007082
744 Ga0500636_0040616
745 Ga0500611_000029
746 Ga0500645_011556
747 Ga0500661_006450
748 2522552127
749 2738728866
750 2819587862
751 2914759902
752 2929158111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

3

62

0.97

PF03466

LysR_substrate

LysR substrate binding domain

86

297

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9747 1 86
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9746 1 84
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9532 1 89
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9469 1 90
5fo5-assembly1.cif.gz_A-2 structure of the dna-binding domain of escherichia coli methionine biosynthesis regulator metr 0.9431 1 82
ID Description Score Start End Superfamily
af_P27111_3_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.978 5 83 1.10.10.10
3m1eA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9777 1 84 1.10.10.10
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9752 1 86 1.10.10.10
3k1mA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9747 1 83 1.10.10.10
4ihtC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9746 1 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A431R8C7-F1-model_v4 LysR family transcriptional regulator 0.9076 2 89 GO:0003700
GO:0005829
AF-A0A376JFC9-F1-model_v4 deleted 0.9026 1 89
AF-A0A7W7T453-F1-model_v4 HTH lysR-type domain-containing protein 0.8995 1 87 GO:0003677
GO:0003700
GO:0032993
AF-A0A1Q5IPR2-F1-model_v4 Transcriptional regulator 0.8641 1 85 GO:0000976
GO:0003700
AF-A0A0C7NH01-F1-model_v4 deleted 0.8475 1 292

Map