F427286

General Info

Members Datasets Scaffolds Average Seq Length
376 268 752 140

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100218738|Ga0068855_1002187383
Length 153
Sequence MNVTIYHNPACGTSRNTLAMIRNAGIDPTVIEYLKTPPSREELAKMIADARLSVREAIRQKDTPYAELGLDNPALTDDQLLDAMLKDPILINRPFVITPLGTRLSRPSEVVLEILPETHKGAFTKEDGEKVIDEFGNRIAGGKDAGPAAAPGG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
36 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
41 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
42 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
83 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
84 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
85 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
86 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
87 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
88 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
89 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
90 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
91 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
157 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
158 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
162 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
165 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
166 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
167 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
168 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
169 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
170 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
171 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
172 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
173 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
174 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
175 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
176 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
177 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
178 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
179 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
180 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
181 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
182 2519899620 Rhizobium sp. Pop5 Isolate Nodule
183 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
184 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
185 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
186 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
187 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
188 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
189 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
190 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
191 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
192 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
193 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
194 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
195 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
196 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
197 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
198 2643221599 Rhizobium sp. Root708 Isolate Unclassified
199 2643221618 Ensifer sp. Root231 Isolate Unclassified
200 2643221626 Ensifer sp. Root31 Isolate Unclassified
201 2643221655 Ensifer sp. Root1252 Isolate Unclassified
202 2643221659 Ensifer sp. Root127 Isolate Unclassified
203 2643221698 Ensifer sp. Root142 Isolate Unclassified
204 2643221712 Ensifer sp. Root258 Isolate Unclassified
205 2643221723 Ensifer sp. Root278 Isolate Unclassified
206 2718218365 Rhizobium sp. N731 Isolate Nodule
207 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
208 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
209 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
210 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
211 2728369397 Rhizobium sp. N1314 Isolate Nodule
212 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
213 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
214 2791355256 Rhizobium sp. M10 Isolate Nodule
215 2791355262 Rhizobium sp. M1 Isolate Nodule
216 2791355263 Rhizobium chutanense C5 Isolate Nodule
217 2791355265 Rhizobium sp. H4 Isolate Nodule
218 2802429633 Rhizobium anhuiense J3 Isolate Nodule
219 2802429634 Rhizobium anhuiense S10 Isolate Nodule
220 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
221 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
222 2802429637 Rhizobium anhuiense C15 Isolate Nodule
223 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
224 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
225 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
226 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
227 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
228 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
229 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
230 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
231 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
232 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
233 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
234 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
235 2844163670 Ensifer sp. 1H6 Isolate Unclassified
236 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
237 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
238 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
239 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
240 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
241 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
242 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
243 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
244 2936381700 Rhizobium chutanense C16 Isolate Unclassified
245 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
246 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
247 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
248 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
249 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
250 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
251 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
252 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
253 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
254 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
255 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
256 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
257 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
258 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
259 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
260 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
261 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
262 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
263 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
264 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
265 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
266 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
267 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
268 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.74
Metatranscriptomes 0
Isolates 29.26

Biome Distribution

Category Percentage (%)
Aerial Root 1.06
Bulb 0
Endosphere 30.05
Nodule 17.29
Rhizoplane 3.99
Rhizosphere 30.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100218738 3300005563 Bacteria 2137
2 JGI25162J39368_1000481 3300002737 Bacteria 30539
3 JGI25158J39367_1000149 3300002739 Bacteria 16457
4 JGI25150J39212_1021308 3300002774 Bacteria 987
5 JGI25159J45721_1000183 3300002987 Bacteria 28912
6 JGI25159J45721_1000251 3300002987 Bacteria 25319
7 JGI25151J46595_10000282 3300003187 Bacteria 57997
8 JGI25151J46595_10015235 3300003187 Bacteria 3398
9 JGI25165J46597_1002127 3300003214 Bacteria 7154
10 JGI25165J46597_1021663 3300003214 Bacteria 839
11 JGI25153J46596_10010822 3300003215 Bacteria 4090
12 JGI25160J50197_1000001 3300003354 Bacteria 782301
13 JGI25160J50197_1002049 3300003354 Bacteria 9606
14 JGI25160J50197_1004330 3300003354 Bacteria 6152
15 JGI25160J50197_1095059 3300003354 Bacteria 536
16 JGI25161J50226_1000001 3300003374 Bacteria 655036
17 JGI25161J50226_1000295 3300003374 Bacteria 28072
18 JGI25161J50226_1003455 3300003374 Bacteria 3606
19 Ga0055526_1002502 3300003771 Bacteria 12378
20 Ga0055526_1012763 3300003771 Bacteria 3628
21 Ga0055524_1002083 3300003775 Bacteria 10571
22 Ga0055524_1027970 3300003775 Bacteria 1698
23 Ga0055528_1000064 3300003790 Bacteria 85584
24 Ga0055528_1002295 3300003790 Bacteria 10352
25 Ga0055528_1011180 3300003790 Bacteria 3588
26 Ga0055528_1027997 3300003790 Bacteria 1566
27 Ga0055540_1006691 3300003792 Bacteria 4519
28 Ga0058692_1002907 3300003856 Bacteria 5538
29 Ga0055543_1000066 3300004625 Bacteria 97081
30 Ga0055543_1000089 3300004625 Bacteria 79924
31 Ga0055543_1001222 3300004625 Bacteria 10771
32 Ga0065165_1000008 3300005262 Bacteria 334429
33 Ga0065165_1006873 3300005262 Bacteria 5785
34 Ga0065165_1008827 3300005262 Bacteria 4635
35 Ga0065165_1022864 3300005262 Bacteria 2132
36 Ga0070670_100016136 3300005331 Bacteria 6411
37 Ga0070670_101293348 3300005331 Bacteria 667
38 Ga0070682_100613481 3300005337 Bacteria 861
39 Ga0070671_100033364 3300005355 Bacteria 4257
40 Ga0070667_100105126 3300005367 Bacteria 2443
41 Ga0070665_100265416 3300005548 Bacteria 1718
42 Ga0070664_101375141 3300005564 Bacteria 667
43 Ga0068852_100058602 3300005616 Bacteria 3337
44 Ga0075365_10098754 3300006038 Bacteria 1998
45 Ga0075368_10009721 3300006042 Bacteria 3464
46 Ga0075368_10038030 3300006042 Bacteria 1883
47 Ga0075363_100132121 3300006048 Bacteria 1401
48 Ga0075367_10000754 3300006178 Bacteria 12622
49 Ga0075367_10019863 3300006178 Bacteria 3732
50 Ga0075367_10686353 3300006178 Bacteria 651
51 Ga0075366_10019853 3300006195 Bacteria 3893
52 Ga0075370_10002806 3300006353 Bacteria 8169
53 Ga0075370_10642240 3300006353 Bacteria 644
54 Ga0105244_10031057 3300009036 Bacteria 2837
55 Ga0105240_10001761 3300009093 Bacteria 36533
56 Ga0105248_10044345 3300009177 Bacteria 4987
57 Ga0105248_12966100 3300009177 Bacteria 541
58 Ga0105237_10001133 3300009545 Bacteria 35775
59 Ga0123341_1000282 3300009765 Bacteria 28101
60 Ga0123342_1010026 3300009766 Bacteria 11023
61 Ga0123342_1018102 3300009766 Bacteria 5700
62 Ga0105239_10023161 3300010375 Bacteria 6844
63 Ga0157370_10001556 3300013104 Bacteria 28420
64 Ga0157374_10092156 3300013296 Bacteria 2891
65 Ga0182007_10003450 3300015262 Bacteria 7448
66 Ga0182005_1004085 3300015265 Bacteria 4781
67 Ga0209760_103175 3300025207 Bacteria 1471
68 Ga0209436_100014 3300025208 Bacteria 127004
69 Ga0209436_109209 3300025208 Bacteria 1903
70 Ga0209437_100023 3300025233 Bacteria 614195
71 Ga0207425_1001234 3300025245 Bacteria 11206
72 Ga0207425_1002908 3300025245 Bacteria 5739
73 Ga0209677_102943 3300025253 Bacteria 5947
74 Ga0209129_1000167 3300025258 Bacteria 97701
75 Ga0209129_1002720 3300025258 Bacteria 8286
76 Ga0209129_1006603 3300025258 Bacteria 3692
77 Ga0209129_1013161 3300025258 Bacteria 1841
78 Ga0209233_1000219 3300025261 Bacteria 104797
79 Ga0209233_1000345 3300025261 Bacteria 45341
80 Ga0209673_1000013 3300025273 Bacteria 571633
81 Ga0209673_1000341 3300025273 Bacteria 85808
82 Ga0209673_1001119 3300025273 Bacteria 29848
83 Ga0209673_1003671 3300025273 Bacteria 8855
84 Ga0209673_1009269 3300025273 Bacteria 4287
85 Ga0209673_1027066 3300025273 Bacteria 1871
86 Ga0209130_1000003 3300025284 Bacteria 677988
87 Ga0209130_1000004 3300025284 Bacteria 633436
88 Ga0209675_1060276 3300025291 Bacteria 753
89 Ga0209676_1095692 3300025292 Bacteria 643
90 Ga0209025_1000695 3300025294 Bacteria 57400
91 Ga0209025_1002595 3300025294 Bacteria 18674
92 Ga0209025_1005846 3300025294 Bacteria 9841
93 Ga0209025_1006552 3300025294 Bacteria 8988
94 Ga0209025_1015638 3300025294 Bacteria 4554
95 Ga0209564_1000807 3300025295 Bacteria 42868
96 Ga0209564_1001512 3300025295 Bacteria 23269
97 Ga0209564_1001590 3300025295 Bacteria 22195
98 Ga0209564_1040410 3300025295 Bacteria 1267
99 Ga0209758_1000598 3300025297 Bacteria 56164
100 Ga0209758_1038265 3300025297 Bacteria 1841
101 Ga0209758_1081891 3300025297 Bacteria 973
102 Ga0209758_1083580 3300025297 Bacteria 957
103 Ga0209256_1000308 3300025299 Bacteria 85808
104 Ga0209256_1000769 3300025299 Bacteria 41649
105 Ga0209256_1001491 3300025299 Bacteria 23822
106 Ga0209256_1049305 3300025299 Bacteria 1026
107 Ga0207426_1000003 3300025302 Bacteria 1063212
108 Ga0207426_1000011 3300025302 Bacteria 791203
109 Ga0207426_1000039 3300025302 Bacteria 439937
110 Ga0207426_1021139 3300025302 Bacteria 2252
111 Ga0209051_1001029 3300025303 Bacteria 26488
112 Ga0209257_1020425 3300025304 Bacteria 2449
113 Ga0207655_1095736 3300025728 Bacteria 1034
114 Ga0207655_1237308 3300025728 Bacteria 523
115 Ga0207647_10402005 3300025904 Bacteria 772
116 Ga0207695_10000842 3300025913 Bacteria 56321
117 Ga0207671_10000903 3300025914 Bacteria 37499
118 Ga0207694_10134245 3300025924 Bacteria 1986
119 Ga0207709_11197397 3300025935 Bacteria 626
120 Ga0207667_10018672 3300025949 Bacteria 7769
121 Ga0207667_10900041 3300025949 Bacteria 877
122 Ga0207668_11218928 3300025972 Bacteria 676
123 Ga0207658_10076220 3300025986 Bacteria 2554
124 Ga0207702_10106234 3300026078 Bacteria 2487
125 Ga0207698_10037118 3300026142 Bacteria 3585
126 Ga0209371_1000280 3300027312 Bacteria 58641
127 Ga0209371_1001094 3300027312 Bacteria 20193
128 Ga0209371_1002832 3300027312 Bacteria 9207
129 Ga0209371_1003589 3300027312 Bacteria 7416
130 Ga0209371_1018359 3300027312 Bacteria 1780
131 Ga0209813_10033934 3300027866 Bacteria 1520
132 Ga0209813_10274925 3300027866 Bacteria 647
133 Ga0268266_10093869 3300028379 Bacteria 2633
134 Ga0268266_10211619 3300028379 Bacteria 1778
135 Ga0268265_10957254 3300028380 Bacteria 844
136 Ga0307515_10022261 3300028794 Bacteria 11178
137 Ga0268256_1000234 3300030500 Bacteria 58641
138 Ga0268256_1001474 3300030500 Bacteria 14020
139 Ga0268256_1002532 3300030500 Bacteria 9207
140 Ga0268256_1015358 3300030500 Bacteria 2239
141 Ga0268256_1015498 3300030500 Bacteria 2221
142 Ga0307405_10000430 3300031731 Bacteria 15691
143 Ga0307412_10160625 3300031911 Bacteria 1669
144 Ga0307416_101513047 3300032002 Bacteria 777
145 Ga0439436_0162432 3300041404 Bacteria 632
146 Ga0439465_0041712 3300041413 Bacteria 1486
147 Ga0451802_0705652 3300041460 Bacteria 1281
148 Ga0451833_0512897 3300041491 Bacteria 2096
149 Ga0451837_0890765 3300041494 Bacteria 4567
150 Ga0451839_1006201 3300041496 Bacteria 5423
151 Ga0451845_0414771 3300041501 Bacteria 604
152 Ga0451845_0736367 3300041501 Bacteria 2512
153 Ga0451847_0140940 3300041503 Bacteria 2847
154 Ga0451849_0948916 3300041505 Bacteria 2861
155 Ga0451851_0205427 3300041507 Bacteria 4145
156 Ga0451851_1211284 3300041507 Bacteria 1860
157 Ga0451843_0599589 3300041509 Bacteria 1552
158 Ga0451855_0267958 3300041511 Bacteria 3114
159 Ga0451853_0264502 3300041512 Bacteria 1550
160 Ga0439431_0085232 3300041997 Bacteria 856
161 Ga0495638_0000323 3300046460 Bacteria 60784
162 Ga0495638_0109797 3300046460 Bacteria 1640
163 Ga0495585_0022058 3300046492 Bacteria 3655
164 Ga0495585_0027310 3300046492 Bacteria 3257
165 Ga0495607_0116384 3300046501 Bacteria 1410
166 Ga0495583_0049520 3300046506 Bacteria 1924
167 Ga0495606_0000485 3300046507 Bacteria 65008
168 Ga0495606_0011182 3300046507 Bacteria 7347
169 Ga0495606_0094546 3300046507 Bacteria 1832
170 Ga0495606_0239484 3300046507 Bacteria 1012
171 Ga0495610_0041427 3300046512 Bacteria 2312
172 Ga0495631_0081500 3300046518 Bacteria 1396
173 Ga0495631_0093432 3300046518 Bacteria 1295
174 Ga0495663_0043405 3300046525 Bacteria 1373
175 Ga0495597_0118766 3300046542 Bacteria 1103
176 Ga0495633_0013899 3300046558 Bacteria 4221
177 Ga0495633_0163344 3300046558 Bacteria 1027
178 Ga0495668_0041009 3300046616 Bacteria 2581
179 Ga0495625_0005963 3300046660 Bacteria 10954
180 Ga0495625_0019590 3300046660 Bacteria 5243
181 Ga0495625_0633914 3300046660 Bacteria 638
182 Ga0495625_0668884 3300046660 Bacteria 616
183 Ga0495661_0039051 3300046665 Bacteria 2952
184 Ga0495670_0045562 3300046691 Bacteria 2190
185 Ga0495649_0217446 3300046694 Bacteria 989
186 Ga0495636_0595718 3300047318 Bacteria 540
187 Ga0495672_0010083 3300047320 Bacteria 6763
188 Ga0495687_001125 3300047443 Bacteria 25971
189 Ga0495679_074302 3300047446 Bacteria 974
190 Ga0495673_0134277 3300047469 Bacteria 970
191 Ga0495686_0072228 3300047472 Bacteria 2122
192 Ga0495686_0198724 3300047472 Bacteria 1152
193 Ga0495686_0404024 3300047472 Bacteria 733
194 Ga0495686_0463655 3300047472 Bacteria 671
195 Ga0496100_0017328 3300048903 Bacteria 4250
196 Ga0496101_0790291 3300048904 Bacteria 748
197 Ga0496102_0342606 3300048905 Bacteria 1407
198 Ga0496103_0001155 3300048906 Bacteria 18233
199 Ga0496105_0466035 3300048908 Bacteria 996
200 Ga0496106_0000038 3300048909 Bacteria 111983
201 Ga0496108_0215487 3300048911 Bacteria 1667
202 Ga0496110_0009481 3300048913 Bacteria 7881
203 Ga0496111_0117993 3300048914 Bacteria 1958
204 Ga0496113_0477825 3300048916 Bacteria 1001
205 Ga0496116_0065742 3300048919 Bacteria 2324
206 Ga0496116_0065867 3300048919 Bacteria 2321
207 Ga0496116_0078313 3300048919 Bacteria 2062
208 Ga0496116_0099052 3300048919 Bacteria 1747
209 Ga0496116_0364011 3300048919 Bacteria 656
210 Ga0496117_0006094 3300048920 Bacteria 12348
211 Ga0496117_0065712 3300048920 Bacteria 2464
212 Ga0496118_0015803 3300048921 Bacteria 6962
213 Ga0496118_0113916 3300048921 Bacteria 1785
214 Ga0496119_0047648 3300048922 Bacteria 2664
215 Ga0496120_0017520 3300048923 Bacteria 4641
216 Ga0496120_0131865 3300048923 Bacteria 1279
217 Ga0496121_0003855 3300048924 Bacteria 20864
218 Ga0496121_0006197 3300048924 Bacteria 14994
219 Ga0496121_0007782 3300048924 Bacteria 12834
220 Ga0496121_0023389 3300048924 Bacteria 5953
221 Ga0496121_0101002 3300048924 Bacteria 2226
222 Ga0496122_0000462 3300048925 Bacteria 84546
223 Ga0496122_0011645 3300048925 Bacteria 8868
224 Ga0496122_0092096 3300048925 Bacteria 2062
225 Ga0496123_0000048 3300048926 Bacteria 244152
226 Ga0496123_0013941 3300048926 Bacteria 6697
227 Ga0496123_0062559 3300048926 Bacteria 2384
228 Ga0496124_0021877 3300048927 Bacteria 5882
229 Ga0496124_0394186 3300048927 Bacteria 963
230 Ga0496124_0732771 3300048927 Bacteria 622
231 Ga0496125_0009162 3300048928 Bacteria 10230
232 Ga0496125_0047511 3300048928 Bacteria 3588
233 Ga0496125_0070486 3300048928 Bacteria 2736
234 Ga0496126_0308867 3300048929 Bacteria 1302
235 Ga0495682_0293428 3300049460 Bacteria 574
236 Ga0501033_0700540 3300049570 Bacteria 689
237 Ga0501034_0297730 3300049571 Bacteria 1550
238 Ga0501036_0140203 3300049572 Bacteria 2040
239 Ga0501038_0086706 3300049574 Bacteria 2630
240 Ga0501039_0034120 3300049575 Bacteria 3927
241 Ga0501068_0330057 3300049584 Bacteria 979
242 Ga0501073_0089250 3300049589 Bacteria 2143
243 Ga0501074_0119843 3300049590 Bacteria 1882
244 Ga0501035_0118163 3300049822 Bacteria 2320
245 nmdc:mga03683_12148_c1 3300050489 Bacteria 3138
246 nmdc:mga03n38_182566_c1 3300050490 Bacteria 1076
247 nmdc:mga0yw44_103865_c1 3300050492 Bacteria 1813
248 nmdc:mga0yw44_11627_c1 3300050492 Bacteria 4555
249 nmdc:mga0k408_42482_c1 3300050493 Bacteria 2619
250 nmdc:mga06z11_130508_c1 3300050494 Bacteria 1411
251 nmdc:mga06z11_694092_c1 3300050494 Bacteria 620
252 nmdc:mga04h51_307110_c1 3300050495 Bacteria 648
253 nmdc:mga07m45_552485_c1 3300050496 Bacteria 666
254 Ga0500610_0229379 3300053079 Bacteria 872
255 Ga0500658_0026682 3300053134 Bacteria 2227
256 Ga0500568_0000280 3300053139 Bacteria 42298
257 Ga0500568_0000424 3300053139 Bacteria 31935
258 Ga0500573_0000575 3300053140 Bacteria 16057
259 Ga0500604_0133656 3300053151 Bacteria 835
260 Ga0500606_085435 3300053152 Bacteria 1068
261 Ga0500616_0001884 3300053153 Bacteria 18878
262 Ga0500622_0000170 3300053156 Bacteria 70088
263 Ga0500622_0349880 3300053156 Bacteria 614
264 Ga0500633_0000432 3300053160 Bacteria 6576
265 Ga0500638_000485 3300053162 Bacteria 9739
266 Ga0500636_0120936 3300053177 Bacteria 1469
267 2509392438 2509276021 Bacteria 7634384
268 2510133544 2510065019 Bacteria 6903379
269 2510894925 2510461076 Bacteria 8618824
270 2511195871 2510917030 Bacteria 7460662
271 2513599441 2513237088 Bacteria 6927906
272 2513629855 2513237093 Bacteria 7545552
273 2513708489 2513237103 Bacteria 7647401
274 2513865395 2513237138 Bacteria 7368160
275 2513914505 2513237144 Bacteria 7530820
276 2513928246 2513237146 Bacteria 7166346
277 2514022049 2513237162 Bacteria 7468464
278 2515112524 2515075009 Bacteria 7288508
279 2515632864 2515154113 Bacteria 7807172
280 2515640009 2515154114 Bacteria 7848616
281 2515655795 2515154116 Bacteria 7552979
282 2517036250 2516653077 Bacteria 7555578
283 2517095387 2517093000 Bacteria 7412387
284 2517406987 2517287029 Bacteria 6905599
285 2520378589 2519899620 Bacteria 6499161
286 2585226613 2582581298 Bacteria 7315509
287 2585228617 2582581299 Bacteria 6518058
288 2585281291 2582581308 Bacteria 7413247
289 2585282729 2582581308 Bacteria 7413247
290 2585325164 2582581315 Bacteria 7318924
291 2585336419 2582581316 Bacteria 7774528
292 2585535513 2585427527 Bacteria 7273426
293 2585537734 2585427528 Bacteria 6842387
294 2585549687 2585427529 Bacteria 7395659
295 2585556127 2585427530 Bacteria 7383882
296 2585835684 2585427593 Bacteria 7141551
297 2599331671 2599185156 Bacteria 5403036
298 2599335633 2599185156 Bacteria 5403036
299 2599416861 2599185170 Bacteria 7295545
300 2599602701 2599185210 Bacteria 5624189
301 2599723361 2599185236 Bacteria 6875203
302 2616310403 2615840626 Bacteria 7921970
303 2644005706 2643221599 Bacteria 6292121
304 2644005749 2643221599 Bacteria 6292121
305 2644109410 2643221618 Bacteria 7717186
306 2644145095 2643221626 Bacteria 8069654
307 2644307675 2643221655 Bacteria 7722067
308 2644332451 2643221659 Bacteria 7890716
309 2644544198 2643221698 Bacteria 7756764
310 2644613764 2643221712 Bacteria 7729434
311 2644672968 2643221723 Bacteria 7095460
312 2721158999 2718218365 Bacteria 6274507
313 2723027786 2721755556 Bacteria 6745503
314 2723561415 2721755684 Bacteria 6859907
315 2725950486 2724679232 Bacteria 7646494
316 2730108722 2728369352 Bacteria 6745171
317 2730298631 2728369397 Bacteria 6274511
318 2739032391 2738541333 Bacteria 7106503
319 2766066911 2765235942 Bacteria 7445910
320 2793294877 2791355256 Bacteria 6798008
321 2793335857 2791355262 Bacteria 6774204
322 2793341718 2791355263 Bacteria 6872478
323 2793352870 2791355265 Bacteria 6539969
324 2806043366 2802429633 Bacteria 7341974
325 2806050700 2802429634 Bacteria 7083200
326 2806057517 2802429635 Bacteria 7650140
327 2806064899 2802429636 Bacteria 7597525
328 2806072165 2802429637 Bacteria 7067217
329 2819641525 2818991453 Bacteria 7181617
330 2838022800 2838022645 Bacteria 6494267
331 2838041809 2838035591 Bacteria 7166484
332 2838044443 2838042994 Bacteria 6046894
333 2841864340 2841864319 Bacteria 6742987
334 2842114181 2842110456 Bacteria 7656360
335 2842201373 2842198810 Bacteria 6608673
336 2842205838 2842205361 Bacteria 6340321
337 2842217481 2842217011 Bacteria 7497767
338 2842279295 2842278818 Bacteria 6340002
339 2842345312 2842341865 Bacteria 7003929
340 2842398875 2842395702 Bacteria 6780583
341 2844170285 2844163670 Bacteria 7266046
342 2852390002 2852387548 Bacteria 8025568
343 2857519928 2857516855 Bacteria 7787325
344 2919106116 2919100787 Bacteria 7710546
345 2923556208 2923556063 Bacteria 6793593
346 2933019854 2933016740 Bacteria 6355406
347 2933590277 2933586486 Bacteria 7667493
348 2936372487 2936367885 Bacteria 7324495
349 2936376522 2936375103 Bacteria 6652732
350 2936387298 2936381700 Bacteria 7006523
351 2979103090 2979100975 Bacteria 5423623
352 2984513870 2984509177 Bacteria 5274802
353 2984523417 2984518228 Bacteria 5277463
354 2984542562 2984537506 Bacteria 5277481
355 2984606508 2984601300 Bacteria 5455244
356 2989772250 2989771324 Bacteria 5605128
357 3005411968 3005409236 Bacteria 7188837
358 3005415009 3005409236 Bacteria 7188837
359 3005423018 3005416602 Bacteria 7064308
360 3005447806 3005445848 Bacteria 6906074
361 639648765 639633055 Bacteria 7751309
362 8005293278 8005289223 Bacteria 6634003
363 8005315345 8005314921 Bacteria 7072929
364 8005379436 8005376324 Bacteria 6590079
365 8005463197 8005460587 Bacteria 7157962
366 8005557481 8005556819 Bacteria 6908598
367 8005568658 8005563573 Bacteria 7153261
368 8005574447 8005570704 Bacteria 6957481
369 8005685323 8005682033 Bacteria 6726518
370 8005694772 8005688590 Bacteria 6610080
371 8018166568 8018163183 Bacteria 7277977
372 8024486766 8024486573 Bacteria 6540512
373 8024488358 8024486573 Bacteria 6540512
374 8056879120 8056875544 Bacteria 4355797
375 8057580471 8057575449 Bacteria 7367519
376 8057874820 8057874678 Bacteria 7494653
377 Ga0068855_100218738
378 JGI25162J39368_1000481
379 JGI25158J39367_1000149
380 JGI25150J39212_1021308
381 JGI25159J45721_1000183
382 JGI25159J45721_1000251
383 JGI25151J46595_10000282
384 JGI25151J46595_10015235
385 JGI25165J46597_1002127
386 JGI25165J46597_1021663
387 JGI25153J46596_10010822
388 JGI25160J50197_1000001
389 JGI25160J50197_1002049
390 JGI25160J50197_1004330
391 JGI25160J50197_1095059
392 JGI25161J50226_1000001
393 JGI25161J50226_1000295
394 JGI25161J50226_1003455
395 Ga0055526_1002502
396 Ga0055526_1012763
397 Ga0055524_1002083
398 Ga0055524_1027970
399 Ga0055528_1000064
400 Ga0055528_1002295
401 Ga0055528_1011180
402 Ga0055528_1027997
403 Ga0055540_1006691
404 Ga0058692_1002907
405 Ga0055543_1000066
406 Ga0055543_1000089
407 Ga0055543_1001222
408 Ga0065165_1000008
409 Ga0065165_1006873
410 Ga0065165_1008827
411 Ga0065165_1022864
412 Ga0070670_100016136
413 Ga0070670_101293348
414 Ga0070682_100613481
415 Ga0070671_100033364
416 Ga0070667_100105126
417 Ga0070665_100265416
418 Ga0070664_101375141
419 Ga0068852_100058602
420 Ga0075365_10098754
421 Ga0075368_10009721
422 Ga0075368_10038030
423 Ga0075363_100132121
424 Ga0075367_10000754
425 Ga0075367_10019863
426 Ga0075367_10686353
427 Ga0075366_10019853
428 Ga0075370_10002806
429 Ga0075370_10642240
430 Ga0105244_10031057
431 Ga0105240_10001761
432 Ga0105248_10044345
433 Ga0105248_12966100
434 Ga0105237_10001133
435 Ga0123341_1000282
436 Ga0123342_1010026
437 Ga0123342_1018102
438 Ga0105239_10023161
439 Ga0157370_10001556
440 Ga0157374_10092156
441 Ga0182007_10003450
442 Ga0182005_1004085
443 Ga0209760_103175
444 Ga0209436_100014
445 Ga0209436_109209
446 Ga0209437_100023
447 Ga0207425_1001234
448 Ga0207425_1002908
449 Ga0209677_102943
450 Ga0209129_1000167
451 Ga0209129_1002720
452 Ga0209129_1006603
453 Ga0209129_1013161
454 Ga0209233_1000219
455 Ga0209233_1000345
456 Ga0209673_1000013
457 Ga0209673_1000341
458 Ga0209673_1001119
459 Ga0209673_1003671
460 Ga0209673_1009269
461 Ga0209673_1027066
462 Ga0209130_1000003
463 Ga0209130_1000004
464 Ga0209675_1060276
465 Ga0209676_1095692
466 Ga0209025_1000695
467 Ga0209025_1002595
468 Ga0209025_1005846
469 Ga0209025_1006552
470 Ga0209025_1015638
471 Ga0209564_1000807
472 Ga0209564_1001512
473 Ga0209564_1001590
474 Ga0209564_1040410
475 Ga0209758_1000598
476 Ga0209758_1038265
477 Ga0209758_1081891
478 Ga0209758_1083580
479 Ga0209256_1000308
480 Ga0209256_1000769
481 Ga0209256_1001491
482 Ga0209256_1049305
483 Ga0207426_1000003
484 Ga0207426_1000011
485 Ga0207426_1000039
486 Ga0207426_1021139
487 Ga0209051_1001029
488 Ga0209257_1020425
489 Ga0207655_1095736
490 Ga0207655_1237308
491 Ga0207647_10402005
492 Ga0207695_10000842
493 Ga0207671_10000903
494 Ga0207694_10134245
495 Ga0207709_11197397
496 Ga0207667_10018672
497 Ga0207667_10900041
498 Ga0207668_11218928
499 Ga0207658_10076220
500 Ga0207702_10106234
501 Ga0207698_10037118
502 Ga0209371_1000280
503 Ga0209371_1001094
504 Ga0209371_1002832
505 Ga0209371_1003589
506 Ga0209371_1018359
507 Ga0209813_10033934
508 Ga0209813_10274925
509 Ga0268266_10093869
510 Ga0268266_10211619
511 Ga0268265_10957254
512 Ga0307515_10022261
513 Ga0268256_1000234
514 Ga0268256_1001474
515 Ga0268256_1002532
516 Ga0268256_1015358
517 Ga0268256_1015498
518 Ga0307405_10000430
519 Ga0307412_10160625
520 Ga0307416_101513047
521 Ga0439436_0162432
522 Ga0439465_0041712
523 Ga0451802_0705652
524 Ga0451833_0512897
525 Ga0451837_0890765
526 Ga0451839_1006201
527 Ga0451845_0414771
528 Ga0451845_0736367
529 Ga0451847_0140940
530 Ga0451849_0948916
531 Ga0451851_0205427
532 Ga0451851_1211284
533 Ga0451843_0599589
534 Ga0451855_0267958
535 Ga0451853_0264502
536 Ga0439431_0085232
537 Ga0495638_0000323
538 Ga0495638_0109797
539 Ga0495585_0022058
540 Ga0495585_0027310
541 Ga0495607_0116384
542 Ga0495583_0049520
543 Ga0495606_0000485
544 Ga0495606_0011182
545 Ga0495606_0094546
546 Ga0495606_0239484
547 Ga0495610_0041427
548 Ga0495631_0081500
549 Ga0495631_0093432
550 Ga0495663_0043405
551 Ga0495597_0118766
552 Ga0495633_0013899
553 Ga0495633_0163344
554 Ga0495668_0041009
555 Ga0495625_0005963
556 Ga0495625_0019590
557 Ga0495625_0633914
558 Ga0495625_0668884
559 Ga0495661_0039051
560 Ga0495670_0045562
561 Ga0495649_0217446
562 Ga0495636_0595718
563 Ga0495672_0010083
564 Ga0495687_001125
565 Ga0495679_074302
566 Ga0495673_0134277
567 Ga0495686_0072228
568 Ga0495686_0198724
569 Ga0495686_0404024
570 Ga0495686_0463655
571 Ga0496100_0017328
572 Ga0496101_0790291
573 Ga0496102_0342606
574 Ga0496103_0001155
575 Ga0496105_0466035
576 Ga0496106_0000038
577 Ga0496108_0215487
578 Ga0496110_0009481
579 Ga0496111_0117993
580 Ga0496113_0477825
581 Ga0496116_0065742
582 Ga0496116_0065867
583 Ga0496116_0078313
584 Ga0496116_0099052
585 Ga0496116_0364011
586 Ga0496117_0006094
587 Ga0496117_0065712
588 Ga0496118_0015803
589 Ga0496118_0113916
590 Ga0496119_0047648
591 Ga0496120_0017520
592 Ga0496120_0131865
593 Ga0496121_0003855
594 Ga0496121_0006197
595 Ga0496121_0007782
596 Ga0496121_0023389
597 Ga0496121_0101002
598 Ga0496122_0000462
599 Ga0496122_0011645
600 Ga0496122_0092096
601 Ga0496123_0000048
602 Ga0496123_0013941
603 Ga0496123_0062559
604 Ga0496124_0021877
605 Ga0496124_0394186
606 Ga0496124_0732771
607 Ga0496125_0009162
608 Ga0496125_0047511
609 Ga0496125_0070486
610 Ga0496126_0308867
611 Ga0495682_0293428
612 Ga0501033_0700540
613 Ga0501034_0297730
614 Ga0501036_0140203
615 Ga0501038_0086706
616 Ga0501039_0034120
617 Ga0501068_0330057
618 Ga0501073_0089250
619 Ga0501074_0119843
620 Ga0501035_0118163
621 nmdc:mga03683_12148_c1
622 nmdc:mga03n38_182566_c1
623 nmdc:mga0yw44_103865_c1
624 nmdc:mga0yw44_11627_c1
625 nmdc:mga0k408_42482_c1
626 nmdc:mga06z11_130508_c1
627 nmdc:mga06z11_694092_c1
628 nmdc:mga04h51_307110_c1
629 nmdc:mga07m45_552485_c1
630 Ga0500610_0229379
631 Ga0500658_0026682
632 Ga0500568_0000280
633 Ga0500568_0000424
634 Ga0500573_0000575
635 Ga0500604_0133656
636 Ga0500606_085435
637 Ga0500616_0001884
638 Ga0500622_0000170
639 Ga0500622_0349880
640 Ga0500633_0000432
641 Ga0500638_000485
642 Ga0500636_0120936
643 2509392438
644 2510133544
645 2510894925
646 2511195871
647 2513599441
648 2513629855
649 2513708489
650 2513865395
651 2513914505
652 2513928246
653 2514022049
654 2515112524
655 2515632864
656 2515640009
657 2515655795
658 2517036250
659 2517095387
660 2517406987
661 2520378589
662 2585226613
663 2585228617
664 2585281291
665 2585282729
666 2585325164
667 2585336419
668 2585535513
669 2585537734
670 2585549687
671 2585556127
672 2585835684
673 2599331671
674 2599335633
675 2599416861
676 2599602701
677 2599723361
678 2616310403
679 2644005706
680 2644005749
681 2644109410
682 2644145095
683 2644307675
684 2644332451
685 2644544198
686 2644613764
687 2644672968
688 2721158999
689 2723027786
690 2723561415
691 2725950486
692 2730108722
693 2730298631
694 2739032391
695 2766066911
696 2793294877
697 2793335857
698 2793341718
699 2793352870
700 2806043366
701 2806050700
702 2806057517
703 2806064899
704 2806072165
705 2819641525
706 2838022800
707 2838041809
708 2838044443
709 2841864340
710 2842114181
711 2842201373
712 2842205838
713 2842217481
714 2842279295
715 2842345312
716 2842398875
717 2844170285
718 2852390002
719 2857519928
720 2919106116
721 2923556208
722 2933019854
723 2933590277
724 2936372487
725 2936376522
726 2936387298
727 2979103090
728 2984513870
729 2984523417
730 2984542562
731 2984606508
732 2989772250
733 3005411968
734 3005415009
735 3005423018
736 3005447806
737 639648765
738 8005293278
739 8005315345
740 8005379436
741 8005463197
742 8005557481
743 8005568658
744 8005574447
745 8005685323
746 8005694772
747 8018166568
748 8024486766
749 8024488358
750 8056879120
751 8057580471
752 8057874820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

6

114

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9686 3 139
1j9b-assembly1.cif.gz_A arsenate reductase+0.4m arsenite from e. coli 0.9683 3 139
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9677 3 139
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9674 3 139
1sk0-assembly1.cif.gz_A arsenate reductase r60a mutant +0.4m arsenite from e. coli 0.9674 3 139
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9683 3 139 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9546 3 139 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9531 2 114 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9371 2 114 3.40.30.10
af_Q4D776_60_147_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8755 2 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1B3Z4G7-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.002 15 112 GO:0008794
GO:0046685
AF-A0A2Z2GTY5-F1-model_v4 Arsenate reductase 1.001 26 116 GO:0046685
AF-A0A4P7BI12-F1-model_v4 deleted 0.995 1 115
AF-A0A2W4YC61-F1-model_v4 deleted 0.9948 2 92
AF-A0A6M5JE52-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9941 2 114 GO:0008794
GO:0046685

Map