F427331

General Info

Members Datasets Scaffolds Average Seq Length
376 257 752 129

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11602711|Ga0105245_116027111
Length 155
Sequence MQGLTSAISHVINALITTKQCSRERDAVPHFSIEYSANLDAKVDMGELCALVLRTVLDTGLFETGAVRVRAFRAEAYAIADNLPENAFLDMSFRVGTGRSAEDRKRTGEAVFKAVSEYLASLFETPHFALSLEIREIDPALSWKKNAIHPRLRGK

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
59 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
110 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
113 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
114 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
115 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
116 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
117 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
201 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
202 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
205 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
206 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
207 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
208 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
209 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
210 2534681786 Brucella suis 92/29 Isolate Unclassified
211 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
212 2643221557 Ensifer sp. Root558 Isolate Unclassified
213 2643221599 Rhizobium sp. Root708 Isolate Unclassified
214 2643221610 Ensifer sp. Root74 Isolate Unclassified
215 2643221618 Ensifer sp. Root231 Isolate Unclassified
216 2643221626 Ensifer sp. Root31 Isolate Unclassified
217 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
218 2643221655 Ensifer sp. Root1252 Isolate Unclassified
219 2643221659 Ensifer sp. Root127 Isolate Unclassified
220 2643221668 Ensifer sp. Root423 Isolate Unclassified
221 2643221675 Ensifer sp. Root1298 Isolate Unclassified
222 2643221680 Ensifer sp. Root1312 Isolate Unclassified
223 2643221698 Ensifer sp. Root142 Isolate Unclassified
224 2643221712 Ensifer sp. Root258 Isolate Unclassified
225 2643221723 Ensifer sp. Root278 Isolate Unclassified
226 2643221726 Ensifer sp. Root954 Isolate Unclassified
227 2791355266 Rhizobium sp. L43 Isolate Nodule
228 2802429634 Rhizobium anhuiense S10 Isolate Nodule
229 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
230 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
231 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
232 2844163670 Ensifer sp. 1H6 Isolate Unclassified
233 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
234 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
235 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
236 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
237 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
238 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
239 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
240 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
241 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
242 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
243 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
244 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
245 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
246 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
247 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
248 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
249 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
250 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
251 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
252 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
253 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
254 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
255 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
256 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
257 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.64
Metatranscriptomes 0
Isolates 14.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.21
Nodule 7.98
Rhizoplane 2.39
Rhizosphere 51.06
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_11602711 3300009098 Bacteria 703
2 JGI25156J39149_1000070 3300002705 Bacteria 80840
3 JGI25154J39366_1000092 3300002738 Bacteria 80685
4 JGI25158J39367_1002778 3300002739 Bacteria 2780
5 JGI25157J39369_1000087 3300002741 Bacteria 80840
6 JGI25157J39369_1000175 3300002741 Bacteria 54070
7 JGI25159J45721_1000030 3300002987 Bacteria 102429
8 JGI25151J46595_10012299 3300003187 Bacteria 3899
9 JGI25165J46597_1000237 3300003214 Bacteria 75663
10 JGI25165J46597_1000412 3300003214 Bacteria 44966
11 rootH2_10137668 3300003320 Bacteria 2145
12 rootL2_10029935 3300003322 Bacteria 1046
13 JGI25160J50197_1000075 3300003354 Bacteria 102429
14 JGI25161J50226_1000316 3300003374 Bacteria 26515
15 Ga0055526_1005688 3300003771 Bacteria 7073
16 Ga0055536_1003695 3300003781 Bacteria 8124
17 Ga0055536_1028822 3300003781 Bacteria 1505
18 Ga0055530_10017152 3300003791 Bacteria 2279
19 Ga0055540_1000131 3300003792 Bacteria 75615
20 Ga0055531_10011285 3300003794 Bacteria 4329
21 Ga0055531_10022230 3300003794 Bacteria 2425
22 Ga0055531_10106025 3300003794 Bacteria 569
23 Ga0055543_1000236 3300004625 Bacteria 42942
24 Ga0065165_1000206 3300005262 Bacteria 102467
25 Ga0070670_101707443 3300005331 Bacteria 579
26 Ga0068868_100634465 3300005338 Bacteria 950
27 Ga0068868_102288105 3300005338 Bacteria 515
28 Ga0070660_100832712 3300005339 Bacteria 777
29 Ga0070668_100119749 3300005347 Bacteria 2103
30 Ga0070674_100645431 3300005356 Bacteria 899
31 Ga0070663_100560423 3300005455 Bacteria 956
32 Ga0070663_100841896 3300005455 Bacteria 789
33 Ga0070662_100297648 3300005457 Bacteria 1310
34 Ga0068867_100218169 3300005459 Bacteria 1536
35 Ga0068853_100009540 3300005539 Bacteria 7820
36 Ga0068853_101545572 3300005539 Bacteria 643
37 Ga0068853_102131290 3300005539 Bacteria 544
38 Ga0070665_100014994 3300005548 Bacteria 7779
39 Ga0070665_100118898 3300005548 Bacteria 2645
40 Ga0070665_100119251 3300005548 Bacteria 2640
41 Ga0070665_100236352 3300005548 Bacteria 1828
42 Ga0070665_101025936 3300005548 Bacteria 837
43 Ga0070665_101450906 3300005548 Bacteria 695
44 Ga0068855_101601952 3300005563 Bacteria 666
45 Ga0068854_100222572 3300005578 Bacteria 1494
46 Ga0068856_100003888 3300005614 Bacteria 14981
47 Ga0068852_101112446 3300005616 Bacteria 810
48 Ga0075365_10030839 3300006038 Bacteria 3438
49 Ga0075363_100059954 3300006048 Bacteria 2048
50 Ga0075362_10126496 3300006177 Bacteria 1213
51 Ga0075369_10010853 3300006186 Bacteria 3570
52 Ga0075369_10074281 3300006186 Bacteria 1500
53 Ga0068865_101293507 3300006881 Bacteria 648
54 Ga0105240_10312061 3300009093 Bacteria 1795
55 Ga0105240_10359346 3300009093 Bacteria 1650
56 Ga0105240_10808720 3300009093 Bacteria 1015
57 Ga0105245_10318326 3300009098 Bacteria 1532
58 Ga0105243_10167324 3300009148 Bacteria 1901
59 Ga0105241_10119259 3300009174 Bacteria 2122
60 Ga0105241_10420712 3300009174 Bacteria 1176
61 Ga0105241_10589854 3300009174 Bacteria 1003
62 Ga0105237_10004427 3300009545 Bacteria 16284
63 Ga0105237_10754654 3300009545 Bacteria 979
64 Ga0105237_12344648 3300009545 Bacteria 544
65 Ga0105238_10026614 3300009551 Bacteria 5897
66 Ga0105238_10683000 3300009551 Bacteria 1038
67 Ga0105238_10702525 3300009551 Bacteria 1023
68 Ga0105249_11318577 3300009553 Bacteria 793
69 Ga0105239_10017021 3300010375 Bacteria 8036
70 Ga0105239_10060210 3300010375 Bacteria 4167
71 Ga0105239_10280560 3300010375 Bacteria 1875
72 Ga0105239_10295169 3300010375 Bacteria 1825
73 Ga0105239_10438688 3300010375 Bacteria 1481
74 Ga0157322_1000490 3300012490 Bacteria 1496
75 Ga0157373_10328377 3300013100 Bacteria 1089
76 Ga0157370_10108014 3300013104 Bacteria 2602
77 Ga0157372_10603404 3300013307 Bacteria 1279
78 Ga0182008_10006828 3300014497 Bacteria 6350
79 Ga0157379_11365468 3300014968 Bacteria 686
80 Ga0157376_10375834 3300014969 Bacteria 1367
81 Ga0182007_10023123 3300015262 Bacteria 2188
82 Ga0163161_10331025 3300017792 Bacteria 1206
83 Ga0209435_100059 3300025206 Bacteria 80744
84 Ga0209436_100823 3300025208 Bacteria 12589
85 Ga0209437_100042 3300025233 Bacteria 444095
86 Ga0209437_100062 3300025233 Bacteria 336900
87 Ga0209646_1000179 3300025246 Bacteria 80892
88 Ga0209646_1014321 3300025246 Bacteria 1195
89 Ga0209646_1021016 3300025246 Bacteria 939
90 Ga0209026_1000005 3300025250 Bacteria 731387
91 Ga0209026_1000212 3300025250 Bacteria 80892
92 Ga0209759_1000111 3300025256 Bacteria 143545
93 Ga0209759_1000246 3300025256 Bacteria 80892
94 Ga0209759_1059461 3300025256 Bacteria 543
95 Ga0209233_1000047 3300025261 Bacteria 459614
96 Ga0209233_1000054 3300025261 Bacteria 439669
97 Ga0209233_1000082 3300025261 Bacteria 336320
98 Ga0209233_1012438 3300025261 Bacteria 2470
99 Ga0209565_1018549 3300025263 Bacteria 1502
100 Ga0209455_1011805 3300025272 Bacteria 2130
101 Ga0209673_1000642 3300025273 Bacteria 52672
102 Ga0209130_1000154 3300025284 Bacteria 102645
103 Ga0209676_1004026 3300025292 Bacteria 8461
104 Ga0209676_1010679 3300025292 Bacteria 3788
105 Ga0209676_1059337 3300025292 Bacteria 961
106 Ga0209025_1000032 3300025294 Bacteria 416141
107 Ga0209025_1134349 3300025294 Bacteria 712
108 Ga0209564_1000025 3300025295 Bacteria 520535
109 Ga0209564_1055630 3300025295 Bacteria 925
110 Ga0209050_1004283 3300025298 Bacteria 9773
111 Ga0209050_1005957 3300025298 Bacteria 7411
112 Ga0209256_1000073 3300025299 Bacteria 237553
113 Ga0209256_1000907 3300025299 Bacteria 36321
114 Ga0207426_1000286 3300025302 Bacteria 102853
115 Ga0209051_1000038 3300025303 Bacteria 320926
116 Ga0209051_1002477 3300025303 Bacteria 13187
117 Ga0209257_1009764 3300025304 Bacteria 5037
118 Ga0209257_1010063 3300025304 Bacteria 4892
119 Ga0209257_1071145 3300025304 Bacteria 916
120 Ga0209257_1103235 3300025304 Bacteria 691
121 Ga0207680_10586373 3300025903 Bacteria 797
122 Ga0207705_10211123 3300025909 Bacteria 1472
123 Ga0207654_10224643 3300025911 Bacteria 1247
124 Ga0207654_10287311 3300025911 Bacteria 1114
125 Ga0207695_10287049 3300025913 Bacteria 1538
126 Ga0207695_10318687 3300025913 Bacteria 1444
127 Ga0207671_10015179 3300025914 Bacteria 6049
128 Ga0207671_10518970 3300025914 Bacteria 950
129 Ga0207657_10037123 3300025919 Bacteria 4356
130 Ga0207694_10007331 3300025924 Bacteria 8368
131 Ga0207694_11615222 3300025924 Bacteria 546
132 Ga0207687_10177818 3300025927 Bacteria 1646
133 Ga0207687_11314300 3300025927 Bacteria 622
134 Ga0207706_11051948 3300025933 Bacteria 682
135 Ga0207709_10166974 3300025935 Bacteria 1541
136 Ga0207669_10604542 3300025937 Bacteria 892
137 Ga0207669_10612034 3300025937 Bacteria 887
138 Ga0207691_10341414 3300025940 Bacteria 1282
139 Ga0207640_10371277 3300025981 Bacteria 1156
140 Ga0207677_10502401 3300026023 Bacteria 1049
141 Ga0207639_10006277 3300026041 Bacteria 8071
142 Ga0207678_10172749 3300026067 Bacteria 1845
143 Ga0207678_10288565 3300026067 Bacteria 1409
144 Ga0207678_10600460 3300026067 Bacteria 965
145 Ga0207702_10019097 3300026078 Bacteria 5673
146 Ga0207648_10847885 3300026089 Bacteria 852
147 Ga0207674_10673650 3300026116 Bacteria 999
148 Ga0207698_10401779 3300026142 Bacteria 1309
149 Ga0268266_10011262 3300028379 Bacteria 7784
150 Ga0268266_10063276 3300028379 Bacteria 3194
151 Ga0268266_10811219 3300028379 Bacteria 904
152 Ga0268266_10889864 3300028379 Bacteria 861
153 Ga0307515_10000130 3300028794 Bacteria 179263
154 Ga0307515_10011208 3300028794 Bacteria 17036
155 Ga0265325_10053345 3300031241 Bacteria 2073
156 Ga0307513_10000335 3300031456 Bacteria 67961
157 Ga0307513_10020103 3300031456 Bacteria 7925
158 Ga0307513_10223629 3300031456 Bacteria 1701
159 Ga0307513_10563807 3300031456 Bacteria 850
160 Ga0307408_101395869 3300031548 Bacteria 659
161 Ga0307516_10105747 3300031730 Bacteria 2626
162 Ga0307412_10647357 3300031911 Bacteria 901
163 Ga0307411_10663644 3300032005 Bacteria 904
164 Ga0373927_0000177 3300035695 Bacteria 50406
165 Ga0373925_0000912 3300037068 Bacteria 26965
166 Ga0373925_1437652 3300037068 Bacteria 565
167 Ga0395900_0004780 3300037418 Bacteria 14275
168 Ga0395900_0095933 3300037418 Bacteria 3047
169 Ga0395900_0454062 3300037418 Bacteria 1237
170 Ga0395905_0002254 3300037471 Bacteria 21651
171 Ga0395905_0007474 3300037471 Bacteria 10868
172 Ga0395905_0176551 3300037471 Bacteria 2005
173 Ga0395905_0705334 3300037471 Bacteria 911
174 Ga0395905_0725110 3300037471 Bacteria 896
175 Ga0395905_0878737 3300037471 Bacteria 799
176 Ga0395901_0014425 3300038443 Bacteria 8041
177 Ga0395901_0734766 3300038443 Bacteria 981
178 Ga0439447_067327 3300041407 Bacteria 836
179 Ga0439465_0023387 3300041413 Bacteria 1944
180 Ga0451800_1534650 3300041459 Bacteria 674
181 Ga0451833_0369965 3300041491 Bacteria 43703
182 Ga0451837_0270537 3300041494 Bacteria 1509
183 Ga0451839_0063950 3300041496 Bacteria 43670
184 Ga0451839_0099676 3300041496 Bacteria 620
185 Ga0451841_0741888 3300041498 Bacteria 9298
186 Ga0451845_0249129 3300041501 Bacteria 20670
187 Ga0451847_0341155 3300041503 Bacteria 20211
188 Ga0451849_1508595 3300041505 Bacteria 810
189 Ga0451851_1180298 3300041507 Bacteria 43516
190 Ga0451843_0458898 3300041509 Bacteria 536
191 Ga0451843_1179278 3300041509 Bacteria 694
192 Ga0451855_1003632 3300041511 Bacteria 2746
193 Ga0451853_2474193 3300041512 Bacteria 23134
194 Ga0451853_3486518 3300041512 Bacteria 501
195 Ga0466963_0118145 3300044694 Bacteria 1823
196 Ga0466964_0033175 3300044706 Bacteria 2056
197 Ga0466970_0000134 3300044765 Bacteria 33918
198 Ga0466970_0399715 3300044765 Bacteria 784
199 Ga0466957_0023170 3300044842 Bacteria 3669
200 Ga0466958_0057997 3300045836 Bacteria 2354
201 Ga0466967_0385585 3300045976 Bacteria 1361
202 Ga0495638_0248486 3300046460 Bacteria 981
203 Ga0495583_0037579 3300046506 Bacteria 2294
204 Ga0495610_0040911 3300046512 Bacteria 2331
205 Ga0495620_0156113 3300046515 Bacteria 888
206 Ga0495631_0005680 3300046518 Bacteria 6509
207 Ga0495632_0151058 3300046519 Bacteria 1073
208 Ga0495648_0016603 3300046524 Bacteria 5301
209 Ga0495633_0060470 3300046558 Bacteria 1775
210 Ga0495633_0297827 3300046558 Bacteria 733
211 Ga0495611_0057457 3300046648 Bacteria 1763
212 Ga0495625_0068155 3300046660 Bacteria 2502
213 Ga0495625_0123196 3300046660 Bacteria 1762
214 Ga0495625_0278925 3300046660 Bacteria 1076
215 Ga0495588_0219388 3300046674 Bacteria 1004
216 Ga0495657_0037895 3300046675 Bacteria 3320
217 Ga0495600_0034731 3300046809 Bacteria 3274
218 Ga0495660_0041006 3300046810 Bacteria 2565
219 Ga0495681_0001771 3300047470 Bacteria 15902
220 Ga0495681_0193793 3300047470 Bacteria 828
221 Ga0495686_0021447 3300047472 Bacteria 4290
222 Ga0496102_0595396 3300048905 Bacteria 1029
223 Ga0496102_0689919 3300048905 Bacteria 944
224 Ga0496102_1163186 3300048905 Bacteria 691
225 Ga0496103_0087163 3300048906 Bacteria 1968
226 Ga0496108_0351980 3300048911 Bacteria 1285
227 Ga0496108_0355976 3300048911 Bacteria 1277
228 Ga0496115_0691951 3300048918 Bacteria 802
229 Ga0496116_0263872 3300048919 Bacteria 847
230 Ga0496119_0008841 3300048922 Bacteria 8759
231 Ga0496119_0225274 3300048922 Bacteria 957
232 Ga0496120_0001458 3300048923 Bacteria 28286
233 Ga0496120_0009210 3300048923 Bacteria 7032
234 Ga0496120_0047615 3300048923 Bacteria 2471
235 Ga0496121_0041666 3300048924 Bacteria 4010
236 Ga0496122_0060753 3300048925 Bacteria 2780
237 Ga0496123_0043835 3300048926 Bacteria 3067
238 Ga0496124_0172836 3300048927 Bacteria 1671
239 Ga0496125_0198444 3300048928 Bacteria 1316
240 Ga0496125_0217848 3300048928 Bacteria 1233
241 Ga0496126_0024496 3300048929 Bacteria 5826
242 Ga0501031_0000007 3300049568 Bacteria 166008
243 Ga0501031_0888706 3300049568 Bacteria 570
244 Ga0501032_0000007 3300049569 Bacteria 253881
245 Ga0501032_0003811 3300049569 Bacteria 11447
246 Ga0501033_0000040 3300049570 Bacteria 142586
247 Ga0501033_0000377 3300049570 Bacteria 42799
248 Ga0501033_0024192 3300049570 Bacteria 4582
249 Ga0501034_0000029 3300049571 Bacteria 253881
250 Ga0501034_0092769 3300049571 Bacteria 3016
251 Ga0501034_0182006 3300049571 Bacteria 2066
252 Ga0501034_0352790 3300049571 Bacteria 1399
253 Ga0501034_0531112 3300049571 Bacteria 1087
254 Ga0501036_0000004 3300049572 Bacteria 253881
255 Ga0501036_1109868 3300049572 Bacteria 646
256 Ga0501037_0000004 3300049573 Bacteria 253989
257 Ga0501037_0000198 3300049573 Bacteria 54028
258 Ga0501037_0925568 3300049573 Bacteria 570
259 Ga0501038_0000005 3300049574 Bacteria 253881
260 Ga0501038_0091769 3300049574 Bacteria 2544
261 Ga0501038_0345348 3300049574 Bacteria 1160
262 Ga0501039_0000009 3300049575 Bacteria 253881
263 Ga0501039_0661951 3300049575 Bacteria 817
264 Ga0501040_0000754 3300049576 Bacteria 20093
265 Ga0501043_0000100 3300049579 Bacteria 79167
266 Ga0501043_0000836 3300049579 Bacteria 27366
267 Ga0501043_0084612 3300049579 Bacteria 2493
268 Ga0501043_0984466 3300049579 Bacteria 601
269 Ga0501046_0014599 3300049580 Bacteria 6619
270 Ga0501047_0000895 3300049581 Bacteria 30440
271 Ga0501048_1246606 3300049582 Bacteria 535
272 Ga0501067_0546543 3300049583 Bacteria 649
273 Ga0501069_0000020 3300049585 Bacteria 122595
274 Ga0501070_0000174 3300049586 Bacteria 59663
275 Ga0501070_0011186 3300049586 Bacteria 7576
276 Ga0501070_0533728 3300049586 Bacteria 940
277 Ga0501072_1092685 3300049588 Bacteria 621
278 Ga0501074_0000015 3300049590 Bacteria 79939
279 Ga0501242_048663 3300049674 Bacteria 617
280 Ga0501080_0015259 3300049742 Bacteria 7081
281 Ga0501083_0001041 3300049744 Bacteria 18494
282 Ga0501280_004569 3300049776 Bacteria 2024
283 Ga0501035_0000014 3300049822 Bacteria 253874
284 Ga0501035_0000070 3300049822 Bacteria 127442
285 Ga0501035_0166764 3300049822 Bacteria 1904
286 Ga0501035_0255763 3300049822 Bacteria 1486
287 Ga0501044_0000012 3300049823 Bacteria 253881
288 Ga0501044_0000037 3300049823 Bacteria 161924
289 Ga0501044_0102592 3300049823 Bacteria 2876
290 Ga0501044_0134631 3300049823 Bacteria 2463
291 Ga0501044_0777720 3300049823 Bacteria 838
292 Ga0501044_1395507 3300049823 Bacteria 566
293 Ga0501044_1453584 3300049823 Unclassified 551
294 nmdc:mga03n38_147311_c1 3300050490 Bacteria 1181
295 nmdc:mga0yw44_153537_c1 3300050492 Bacteria 1503
296 nmdc:mga0yw44_34731_c1 3300050492 Bacteria 2957
297 nmdc:mga0yw44_913867_c1 3300050492 Bacteria 595
298 nmdc:mga0k408_706050_c1 3300050493 Bacteria 591
299 nmdc:mga07m45_355808_c1 3300050496 Bacteria 851
300 nmdc:mga0sz30_1713_c1 3300050516 Bacteria 7785
301 Ga0495601_0893068 3300053077 Bacteria 562
302 Ga0495655_0039798 3300053083 Bacteria 1194
303 Ga0500578_0672558 3300053086 Bacteria 560
304 Ga0500646_0096823 3300053090 Bacteria 921
305 Ga0500651_0382918 3300053093 Bacteria 793
306 Ga0500556_0151414 3300053104 Bacteria 914
307 Ga0500594_0142001 3300053118 Bacteria 767
308 Ga0500608_010188 3300053122 Bacteria 4026
309 Ga0500618_000334 3300053125 Bacteria 33962
310 Ga0500618_014708 3300053125 Bacteria 1993
311 Ga0500658_0062003 3300053134 Bacteria 1557
312 Ga0500590_000050 3300053148 Bacteria 28213
313 Ga0500604_0174989 3300053151 Bacteria 734
314 Ga0500616_0000210 3300053153 Bacteria 94120
315 Ga0500620_000042 3300053155 Bacteria 23446
316 Ga0500627_0099457 3300053158 Bacteria 1305
317 Ga0500634_0007978 3300053161 Bacteria 5263
318 Ga0500636_0046425 3300053177 Bacteria 2560
319 Ga0500636_0090064 3300053177 Bacteria 1758
320 Ga0500596_036142 3300053735 Bacteria 778
321 Ga0501082_0128523 3300060353 Bacteria 2198
322 Ga0501082_0184198 3300060353 Bacteria 1816
323 2511197975 2510917030 Bacteria 7460662
324 2514024324 2513237162 Bacteria 7468464
325 2515646150 2515154114 Bacteria 7848616
326 2515654732 2515154116 Bacteria 7552979
327 2517040515 2516653077 Bacteria 7555578
328 2517411263 2517287029 Bacteria 6905599
329 2535485962 2534681786 Bacteria 3308809
330 2600193848 2599185352 Bacteria 7228948
331 2643805293 2643221557 Bacteria 7184309
332 2644005372 2643221599 Bacteria 6292121
333 2644064137 2643221610 Bacteria 7480339
334 2644105328 2643221618 Bacteria 7717186
335 2644147295 2643221626 Bacteria 8069654
336 2644200668 2643221636 Bacteria 6583769
337 2644309815 2643221655 Bacteria 7722067
338 2644333330 2643221659 Bacteria 7890716
339 2644375743 2643221668 Bacteria 7306521
340 2644415969 2643221675 Bacteria 7473456
341 2644449010 2643221680 Bacteria 7473610
342 2644543473 2643221698 Bacteria 7756764
343 2644614388 2643221712 Bacteria 7729434
344 2644674212 2643221723 Bacteria 7095460
345 2644686466 2643221726 Bacteria 7455827
346 2793360055 2791355266 Bacteria 7116587
347 2806055856 2802429634 Bacteria 7083200
348 2806061304 2802429635 Bacteria 7650140
349 2806065767 2802429636 Bacteria 7597525
350 2844008705 2844002411 Bacteria 7168230
351 2844166535 2844163670 Bacteria 7266046
352 2857523885 2857516855 Bacteria 7787325
353 2869287018 2869285874 Bacteria 6901219
354 2871434324 2871429161 Bacteria 6547891
355 2874147459 2874146452 Bacteria 7533118
356 2874156465 2874155637 Bacteria 6724144
357 2876414653 2876413966 Bacteria 6831344
358 2878745846 2878738818 Bacteria 7136951
359 2878747199 2878745973 Bacteria 6867388
360 2906309371 2906308376 Bacteria 6841989
361 2906327021 2906321335 Bacteria 6579571
362 2924784245 2924776078 Bacteria 7492003
363 2937813730 2937813078 Bacteria 7783518
364 2937845033 2937843397 Bacteria 5256375
365 2941502594 2941499720 Bacteria 7599444
366 2958042002 2958041894 Bacteria 13082850
367 2958131417 2958130278 Bacteria 6897202
368 2958146974 2958144490 Bacteria 6677056
369 2958181242 2958179912 Bacteria 6874908
370 2961079080 2961077736 Bacteria 7079850
371 2970599353 2970593180 Bacteria 7073582
372 2977843878 2977843712 Bacteria 6753583
373 3005457601 3005452660 Bacteria 5889319
374 8003574889 8003570095 Bacteria 5747666
375 8004390436 8004387939 Bacteria 7049250
376 8004715629 8004714634 Bacteria 6776161
377 Ga0105245_11602711
378 JGI25156J39149_1000070
379 JGI25154J39366_1000092
380 JGI25158J39367_1002778
381 JGI25157J39369_1000087
382 JGI25157J39369_1000175
383 JGI25159J45721_1000030
384 JGI25151J46595_10012299
385 JGI25165J46597_1000237
386 JGI25165J46597_1000412
387 rootH2_10137668
388 rootL2_10029935
389 JGI25160J50197_1000075
390 JGI25161J50226_1000316
391 Ga0055526_1005688
392 Ga0055536_1003695
393 Ga0055536_1028822
394 Ga0055530_10017152
395 Ga0055540_1000131
396 Ga0055531_10011285
397 Ga0055531_10022230
398 Ga0055531_10106025
399 Ga0055543_1000236
400 Ga0065165_1000206
401 Ga0070670_101707443
402 Ga0068868_100634465
403 Ga0068868_102288105
404 Ga0070660_100832712
405 Ga0070668_100119749
406 Ga0070674_100645431
407 Ga0070663_100560423
408 Ga0070663_100841896
409 Ga0070662_100297648
410 Ga0068867_100218169
411 Ga0068853_100009540
412 Ga0068853_101545572
413 Ga0068853_102131290
414 Ga0070665_100014994
415 Ga0070665_100118898
416 Ga0070665_100119251
417 Ga0070665_100236352
418 Ga0070665_101025936
419 Ga0070665_101450906
420 Ga0068855_101601952
421 Ga0068854_100222572
422 Ga0068856_100003888
423 Ga0068852_101112446
424 Ga0075365_10030839
425 Ga0075363_100059954
426 Ga0075362_10126496
427 Ga0075369_10010853
428 Ga0075369_10074281
429 Ga0068865_101293507
430 Ga0105240_10312061
431 Ga0105240_10359346
432 Ga0105240_10808720
433 Ga0105245_10318326
434 Ga0105243_10167324
435 Ga0105241_10119259
436 Ga0105241_10420712
437 Ga0105241_10589854
438 Ga0105237_10004427
439 Ga0105237_10754654
440 Ga0105237_12344648
441 Ga0105238_10026614
442 Ga0105238_10683000
443 Ga0105238_10702525
444 Ga0105249_11318577
445 Ga0105239_10017021
446 Ga0105239_10060210
447 Ga0105239_10280560
448 Ga0105239_10295169
449 Ga0105239_10438688
450 Ga0157322_1000490
451 Ga0157373_10328377
452 Ga0157370_10108014
453 Ga0157372_10603404
454 Ga0182008_10006828
455 Ga0157379_11365468
456 Ga0157376_10375834
457 Ga0182007_10023123
458 Ga0163161_10331025
459 Ga0209435_100059
460 Ga0209436_100823
461 Ga0209437_100042
462 Ga0209437_100062
463 Ga0209646_1000179
464 Ga0209646_1014321
465 Ga0209646_1021016
466 Ga0209026_1000005
467 Ga0209026_1000212
468 Ga0209759_1000111
469 Ga0209759_1000246
470 Ga0209759_1059461
471 Ga0209233_1000047
472 Ga0209233_1000054
473 Ga0209233_1000082
474 Ga0209233_1012438
475 Ga0209565_1018549
476 Ga0209455_1011805
477 Ga0209673_1000642
478 Ga0209130_1000154
479 Ga0209676_1004026
480 Ga0209676_1010679
481 Ga0209676_1059337
482 Ga0209025_1000032
483 Ga0209025_1134349
484 Ga0209564_1000025
485 Ga0209564_1055630
486 Ga0209050_1004283
487 Ga0209050_1005957
488 Ga0209256_1000073
489 Ga0209256_1000907
490 Ga0207426_1000286
491 Ga0209051_1000038
492 Ga0209051_1002477
493 Ga0209257_1009764
494 Ga0209257_1010063
495 Ga0209257_1071145
496 Ga0209257_1103235
497 Ga0207680_10586373
498 Ga0207705_10211123
499 Ga0207654_10224643
500 Ga0207654_10287311
501 Ga0207695_10287049
502 Ga0207695_10318687
503 Ga0207671_10015179
504 Ga0207671_10518970
505 Ga0207657_10037123
506 Ga0207694_10007331
507 Ga0207694_11615222
508 Ga0207687_10177818
509 Ga0207687_11314300
510 Ga0207706_11051948
511 Ga0207709_10166974
512 Ga0207669_10604542
513 Ga0207669_10612034
514 Ga0207691_10341414
515 Ga0207640_10371277
516 Ga0207677_10502401
517 Ga0207639_10006277
518 Ga0207678_10172749
519 Ga0207678_10288565
520 Ga0207678_10600460
521 Ga0207702_10019097
522 Ga0207648_10847885
523 Ga0207674_10673650
524 Ga0207698_10401779
525 Ga0268266_10011262
526 Ga0268266_10063276
527 Ga0268266_10811219
528 Ga0268266_10889864
529 Ga0307515_10000130
530 Ga0307515_10011208
531 Ga0265325_10053345
532 Ga0307513_10000335
533 Ga0307513_10020103
534 Ga0307513_10223629
535 Ga0307513_10563807
536 Ga0307408_101395869
537 Ga0307516_10105747
538 Ga0307412_10647357
539 Ga0307411_10663644
540 Ga0373927_0000177
541 Ga0373925_0000912
542 Ga0373925_1437652
543 Ga0395900_0004780
544 Ga0395900_0095933
545 Ga0395900_0454062
546 Ga0395905_0002254
547 Ga0395905_0007474
548 Ga0395905_0176551
549 Ga0395905_0705334
550 Ga0395905_0725110
551 Ga0395905_0878737
552 Ga0395901_0014425
553 Ga0395901_0734766
554 Ga0439447_067327
555 Ga0439465_0023387
556 Ga0451800_1534650
557 Ga0451833_0369965
558 Ga0451837_0270537
559 Ga0451839_0063950
560 Ga0451839_0099676
561 Ga0451841_0741888
562 Ga0451845_0249129
563 Ga0451847_0341155
564 Ga0451849_1508595
565 Ga0451851_1180298
566 Ga0451843_0458898
567 Ga0451843_1179278
568 Ga0451855_1003632
569 Ga0451853_2474193
570 Ga0451853_3486518
571 Ga0466963_0118145
572 Ga0466964_0033175
573 Ga0466970_0000134
574 Ga0466970_0399715
575 Ga0466957_0023170
576 Ga0466958_0057997
577 Ga0466967_0385585
578 Ga0495638_0248486
579 Ga0495583_0037579
580 Ga0495610_0040911
581 Ga0495620_0156113
582 Ga0495631_0005680
583 Ga0495632_0151058
584 Ga0495648_0016603
585 Ga0495633_0060470
586 Ga0495633_0297827
587 Ga0495611_0057457
588 Ga0495625_0068155
589 Ga0495625_0123196
590 Ga0495625_0278925
591 Ga0495588_0219388
592 Ga0495657_0037895
593 Ga0495600_0034731
594 Ga0495660_0041006
595 Ga0495681_0001771
596 Ga0495681_0193793
597 Ga0495686_0021447
598 Ga0496102_0595396
599 Ga0496102_0689919
600 Ga0496102_1163186
601 Ga0496103_0087163
602 Ga0496108_0351980
603 Ga0496108_0355976
604 Ga0496115_0691951
605 Ga0496116_0263872
606 Ga0496119_0008841
607 Ga0496119_0225274
608 Ga0496120_0001458
609 Ga0496120_0009210
610 Ga0496120_0047615
611 Ga0496121_0041666
612 Ga0496122_0060753
613 Ga0496123_0043835
614 Ga0496124_0172836
615 Ga0496125_0198444
616 Ga0496125_0217848
617 Ga0496126_0024496
618 Ga0501031_0000007
619 Ga0501031_0888706
620 Ga0501032_0000007
621 Ga0501032_0003811
622 Ga0501033_0000040
623 Ga0501033_0000377
624 Ga0501033_0024192
625 Ga0501034_0000029
626 Ga0501034_0092769
627 Ga0501034_0182006
628 Ga0501034_0352790
629 Ga0501034_0531112
630 Ga0501036_0000004
631 Ga0501036_1109868
632 Ga0501037_0000004
633 Ga0501037_0000198
634 Ga0501037_0925568
635 Ga0501038_0000005
636 Ga0501038_0091769
637 Ga0501038_0345348
638 Ga0501039_0000009
639 Ga0501039_0661951
640 Ga0501040_0000754
641 Ga0501043_0000100
642 Ga0501043_0000836
643 Ga0501043_0084612
644 Ga0501043_0984466
645 Ga0501046_0014599
646 Ga0501047_0000895
647 Ga0501048_1246606
648 Ga0501067_0546543
649 Ga0501069_0000020
650 Ga0501070_0000174
651 Ga0501070_0011186
652 Ga0501070_0533728
653 Ga0501072_1092685
654 Ga0501074_0000015
655 Ga0501242_048663
656 Ga0501080_0015259
657 Ga0501083_0001041
658 Ga0501280_004569
659 Ga0501035_0000014
660 Ga0501035_0000070
661 Ga0501035_0166764
662 Ga0501035_0255763
663 Ga0501044_0000012
664 Ga0501044_0000037
665 Ga0501044_0102592
666 Ga0501044_0134631
667 Ga0501044_0777720
668 Ga0501044_1395507
669 Ga0501044_1453584
670 nmdc:mga03n38_147311_c1
671 nmdc:mga0yw44_153537_c1
672 nmdc:mga0yw44_34731_c1
673 nmdc:mga0yw44_913867_c1
674 nmdc:mga0k408_706050_c1
675 nmdc:mga07m45_355808_c1
676 nmdc:mga0sz30_1713_c1
677 Ga0495601_0893068
678 Ga0495655_0039798
679 Ga0500578_0672558
680 Ga0500646_0096823
681 Ga0500651_0382918
682 Ga0500556_0151414
683 Ga0500594_0142001
684 Ga0500608_010188
685 Ga0500618_000334
686 Ga0500618_014708
687 Ga0500658_0062003
688 Ga0500590_000050
689 Ga0500604_0174989
690 Ga0500616_0000210
691 Ga0500620_000042
692 Ga0500627_0099457
693 Ga0500634_0007978
694 Ga0500636_0046425
695 Ga0500636_0090064
696 Ga0500596_036142
697 Ga0501082_0128523
698 Ga0501082_0184198
699 2511197975
700 2514024324
701 2515646150
702 2515654732
703 2517040515
704 2517411263
705 2535485962
706 2600193848
707 2643805293
708 2644005372
709 2644064137
710 2644105328
711 2644147295
712 2644200668
713 2644309815
714 2644333330
715 2644375743
716 2644415969
717 2644449010
718 2644543473
719 2644614388
720 2644674212
721 2644686466
722 2793360055
723 2806055856
724 2806061304
725 2806065767
726 2844008705
727 2844166535
728 2857523885
729 2869287018
730 2871434324
731 2874147459
732 2874156465
733 2876414653
734 2878745846
735 2878747199
736 2906309371
737 2906327021
738 2924784245
739 2937813730
740 2937845033
741 2941502594
742 2958042002
743 2958131417
744 2958146974
745 2958181242
746 2961079080
747 2970599353
748 2977843878
749 3005457601
750 8003574889
751 8004390436
752 8004715629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02962

CHMI

5-carboxymethyl-2-hydroxymuconate isomerase

29

152

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.9179 3 119
4jcu-assembly1.cif.gz_A crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from deinococcus radiodurans r1 0.8989 2 126
4jj9-assembly1.cif.gz_B crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase 0.8931 1 120
4jcu-assembly1.cif.gz_A crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from deinococcus radiodurans r1 0.8728 2 126
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.8562 3 119
ID Description Score Start End Superfamily
1otgC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9179 3 119 3.30.429.10
4jcuB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8971 2 121 3.30.429.10
4jj9C00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8656 2 120 3.30.429.10
1otgC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8562 3 119 3.30.429.10
4nwpH00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.811 3 120 3.30.429.10
ID Description Score Start End GO Terms
AF-K0WHQ6-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9871 1 78 GO:0008704
GO:0009056
AF-A0A529P083-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9765 1 109 GO:0008704
GO:0009056
AF-A0A3S1ELA3-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9757 1 66 GO:0008704
GO:0009056
AF-A0A529P083-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9678 1 109 GO:0008704
GO:0009056
AF-A0A357LUY5-F1-model_v4 Uncharacterized protein 0.9632 1 83 GO:0008704
GO:0009056

Map