F427352

General Info

Members Datasets Scaffolds Average Seq Length
376 227 374 155

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10408955|Ga0105246_104089552
Length 175
Sequence LFATNALRLRGDHARQKESVMAAAPRTRSPQSVLFACGLNSVRSPMAESLLQQMFPKALYVRSAGVRKGELDPFAVAVMAELGQDISRHKPITFDELEDWEGLNFDLIITLAPEAHHKALELTRTLAADVEYWPTHDPTGAEGNREQKLSAYREVCDTLLARIRKRFANVGAASG

Samples

Sample ID Description Type Environment
1 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
2 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
209 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
210 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
211 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
212 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
213 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
214 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
223 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
224 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
225 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
226 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
227 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.27
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.9
Nodule 0.53
Rhizoplane 2.13
Rhizosphere 80.32
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10028543 3300001979 Bacteria 1843
2 JGI24738J21930_10021607 3300002075 Bacteria 1334
3 JGI25405J52794_10026794 3300003911 Bacteria 1185
4 Ga0070680_101286356 3300005336 Bacteria 633
5 Ga0070661_100636068 3300005344 Bacteria 865
6 Ga0070675_100517807 3300005354 Bacteria 1076
7 Ga0070709_10021403 3300005434 Bacteria 3766
8 Ga0070714_100357506 3300005435 Bacteria 1372
9 Ga0070714_101176824 3300005435 Bacteria 748
10 Ga0070713_101355094 3300005436 Bacteria 690
11 Ga0070710_10015263 3300005437 Bacteria 3885
12 Ga0070710_10536673 3300005437 Bacteria 806
13 Ga0070711_100031727 3300005439 Bacteria 3510
14 Ga0070711_100067864 3300005439 Bacteria 2504
15 Ga0070711_101362133 3300005439 Bacteria 617
16 Ga0070708_100523971 3300005445 Bacteria 1118
17 Ga0070663_100008818 3300005455 Bacteria 6222
18 Ga0070662_101458798 3300005457 Bacteria 590
19 Ga0070681_10668182 3300005458 Bacteria 954
20 Ga0070706_100246653 3300005467 Bacteria 1667
21 Ga0070706_101602812 3300005467 Bacteria 594
22 Ga0068853_100065825 3300005539 Bacteria 3145
23 Ga0070696_101544752 3300005546 Bacteria 569
24 Ga0070665_100122485 3300005548 Bacteria 2602
25 Ga0068855_100261442 3300005563 Bacteria 1928
26 Ga0068855_101152586 3300005563 Bacteria 808
27 Ga0068857_100147082 3300005577 Bacteria 2132
28 Ga0068854_100031071 3300005578 Bacteria 3709
29 Ga0068856_100275555 3300005614 Bacteria 1699
30 Ga0068852_100217322 3300005616 Bacteria 1816
31 Ga0068851_10003652 3300005834 Bacteria 6869
32 Ga0068863_101104560 3300005841 Bacteria 798
33 Ga0068860_100000251 3300005843 Bacteria 79943
34 Ga0081455_10025968 3300005937 Bacteria 5397
35 Ga0081540_1052335 3300005983 Bacteria 2011
36 Ga0081539_10002294 3300005985 Bacteria 27712
37 Ga0070717_10018516 3300006028 Bacteria 5439
38 Ga0070717_10947753 3300006028 Bacteria 784
39 Ga0070717_10973270 3300006028 Bacteria 773
40 Ga0075365_10017288 3300006038 Bacteria 4409
41 Ga0075365_10281866 3300006038 Bacteria 1169
42 Ga0075368_10068235 3300006042 Bacteria 1433
43 Ga0075363_100059481 3300006048 Bacteria 2055
44 Ga0070715_10952162 3300006163 Bacteria 532
45 Ga0070716_100041581 3300006173 Bacteria 2562
46 Ga0070712_100118872 3300006175 Bacteria 1986
47 Ga0070712_100249356 3300006175 Bacteria 1418
48 Ga0070712_100271895 3300006175 Bacteria 1362
49 Ga0070712_100514647 3300006175 Bacteria 1005
50 Ga0075362_10089992 3300006177 Bacteria 1424
51 Ga0075367_10022131 3300006178 Bacteria 3561
52 Ga0075369_10003142 3300006186 Bacteria 5986
53 Ga0075434_100013157 3300006871 Bacteria 7861
54 Ga0075434_100013416 3300006871 Bacteria 7797
55 Ga0068865_101133638 3300006881 Bacteria 690
56 Ga0075436_100203074 3300006914 Bacteria 1404
57 Ga0099794_10142975 3300007265 Bacteria 1212
58 Ga0105240_10032407 3300009093 Bacteria 6765
59 Ga0105240_11471990 3300009093 Bacteria 714
60 Ga0111539_10321594 3300009094 Bacteria 1800
61 Ga0105243_10601064 3300009148 Bacteria 1059
62 Ga0105241_10002070 3300009174 Bacteria 15157
63 Ga0105241_11853559 3300009174 Bacteria 590
64 Ga0105237_10286779 3300009545 Bacteria 1649
65 Ga0105237_10677164 3300009545 Bacteria 1038
66 Ga0105237_10831303 3300009545 Bacteria 930
67 Ga0105238_10003705 3300009551 Bacteria 15211
68 Ga0105238_10187370 3300009551 Bacteria 2045
69 Ga0099796_10200913 3300010159 Bacteria 808
70 Ga0105239_10012498 3300010375 Bacteria 9457
71 Ga0105246_10408955 3300011119 Bacteria 1129
72 Ga0157369_10201477 3300013105 Bacteria 2089
73 Ga0163162_10415869 3300013306 Bacteria 1477
74 Ga0213873_10073827 3300021358 Bacteria 944
75 Ga0213876_10164626 3300021384 Bacteria 1180
76 Ga0213875_10240715 3300021388 Bacteria 853
77 Ga0213871_10085726 3300021441 Bacteria 907
78 Ga0207697_10027329 3300025315 Bacteria 2333
79 Ga0207656_10044603 3300025321 Bacteria 1894
80 Ga0207699_10007596 3300025906 Bacteria 5307
81 Ga0207699_10380148 3300025906 Bacteria 1002
82 Ga0207684_10089054 3300025910 Bacteria 2630
83 Ga0207654_10000131 3300025911 Bacteria 48376
84 Ga0207695_10000506 3300025913 Bacteria 82904
85 Ga0207671_10195152 3300025914 Bacteria 1580
86 Ga0207671_10199907 3300025914 Bacteria 1561
87 Ga0207671_10617303 3300025914 Bacteria 864
88 Ga0207693_10079505 3300025915 Bacteria 2566
89 Ga0207663_10289967 3300025916 Bacteria 1219
90 Ga0207663_11166514 3300025916 Bacteria 620
91 Ga0207649_10426595 3300025920 Bacteria 997
92 Ga0207694_10000086 3300025924 Bacteria 108152
93 Ga0207694_10709369 3300025924 Bacteria 848
94 Ga0207659_10415071 3300025926 Bacteria 1128
95 Ga0207700_10075091 3300025928 Bacteria 2618
96 Ga0207700_10744338 3300025928 Bacteria 876
97 Ga0207664_10301585 3300025929 Bacteria 1409
98 Ga0207644_10576776 3300025931 Bacteria 933
99 Ga0207704_10851916 3300025938 Bacteria 764
100 Ga0207665_10030788 3300025939 Bacteria 3548
101 Ga0207665_11008247 3300025939 Bacteria 662
102 Ga0207689_10072766 3300025942 Bacteria 2824
103 Ga0207667_10013204 3300025949 Bacteria 9469
104 Ga0207667_10309441 3300025949 Bacteria 1614
105 Ga0207667_10615793 3300025949 Bacteria 1094
106 Ga0207658_11473306 3300025986 Bacteria 623
107 Ga0207678_10085370 3300026067 Bacteria 2699
108 Ga0207702_10000098 3300026078 Bacteria 101326
109 Ga0207702_11156135 3300026078 Bacteria 768
110 Ga0207641_10303379 3300026088 Bacteria 1509
111 Ga0207674_10166727 3300026116 Bacteria 2157
112 Ga0209179_1007889 3300027512 Bacteria 1774
113 Ga0209588_1031722 3300027671 Bacteria 1692
114 Ga0209588_1070262 3300027671 Bacteria 1131
115 Ga0209588_1121253 3300027671 Bacteria 837
116 Ga0209813_10006761 3300027866 Bacteria 2841
117 Ga0207428_10768092 3300027907 Bacteria 686
118 Ga0268266_10429355 3300028379 Bacteria 1253
119 Ga0268265_10538877 3300028380 Bacteria 1106
120 Ga0268264_10000051 3300028381 Bacteria 321565
121 Ga0307511_10211746 3300030521 Bacteria 988
122 Ga0265325_10114818 3300031241 Bacteria 1304
123 Ga0265313_10100300 3300031595 Bacteria 1286
124 Ga0307508_10000114 3300031616 Bacteria 95098
125 Ga0307508_10082442 3300031616 Bacteria 2798
126 Ga0307508_10177565 3300031616 Bacteria 1732
127 Ga0307508_10415870 3300031616 Bacteria 936
128 Ga0307516_10001674 3300031730 Bacteria 30538
129 Ga0307516_10260360 3300031730 Bacteria 1425
130 Ga0307507_10012898 3300033179 Bacteria 10247
131 Ga0373926_0158273 3300035083 Bacteria 864
132 Ga0373934_0005514 3300035086 Bacteria 4682
133 Ga0373934_0104823 3300035086 Bacteria 1144
134 Ga0373944_0077732 3300035089 Bacteria 1091
135 Ga0373949_0270576 3300035090 Bacteria 531
136 Ga0373923_0166772 3300035111 Bacteria 1007
137 Ga0373923_0579530 3300035111 Bacteria 551
138 Ga0373923_0600069 3300035111 Bacteria 542
139 Ga0373936_0048732 3300035113 Bacteria 1710
140 Ga0373936_0050746 3300035113 Bacteria 1678
141 Ga0373936_0072044 3300035113 Bacteria 1426
142 Ga0373945_0004300 3300035116 Bacteria 4523
143 Ga0373945_0005945 3300035116 Bacteria 3919
144 Ga0373945_0029865 3300035116 Bacteria 1918
145 Ga0373953_0002803 3300035117 Bacteria 5299
146 Ga0373953_0038438 3300035117 Bacteria 1893
147 Ga0373954_0005204 3300035118 Bacteria 5621
148 Ga0373954_0114592 3300035118 Bacteria 1305
149 Ga0373956_0008461 3300035119 Bacteria 4166
150 Ga0373956_0178464 3300035119 Bacteria 1003
151 Ga0373957_0040043 3300035120 Bacteria 1760
152 Ga0373960_0327535 3300035121 Bacteria 576
153 Ga0373943_0001745 3300035170 Bacteria 9866
154 Ga0373946_0002595 3300035171 Bacteria 6388
155 Ga0373946_0003559 3300035171 Bacteria 5528
156 Ga0373955_0001254 3300035172 Bacteria 10791
157 Ga0373955_0078324 3300035172 Bacteria 1862
158 Ga0373924_0001548 3300035410 Bacteria 7503
159 Ga0373924_0076116 3300035410 Bacteria 1421
160 Ga0373931_0329196 3300035691 Bacteria 951
161 Ga0373935_0000328 3300035692 Bacteria 23872
162 Ga0373935_0004624 3300035692 Bacteria 8085
163 Ga0373935_0010091 3300035692 Bacteria 5657
164 Ga0373935_0032240 3300035692 Bacteria 3255
165 Ga0373935_0171250 3300035692 Bacteria 1485
166 Ga0373927_0006202 3300035695 Bacteria 8162
167 Ga0373927_0067977 3300035695 Bacteria 2305
168 Ga0373927_0102581 3300035695 Bacteria 1861
169 Ga0373927_0282170 3300035695 Bacteria 1092
170 Ga0373927_0404303 3300035695 Bacteria 901
171 Ga0373933_0000290 3300035724 Bacteria 32568
172 Ga0373933_0029643 3300035724 Bacteria 3166
173 Ga0373933_0102458 3300035724 Bacteria 1777
174 Ga0373933_0461387 3300035724 Bacteria 831
175 Ga0373933_0509191 3300035724 Bacteria 789
176 Ga0373947_0009098 3300035725 Bacteria 5708
177 Ga0373947_0010847 3300035725 Bacteria 5228
178 Ga0373947_0128748 3300035725 Bacteria 1614
179 Ga0373947_0378739 3300035725 Bacteria 952
180 Ga0373947_0427314 3300035725 Bacteria 896
181 Ga0373947_0538810 3300035725 Bacteria 794
182 Ga0373937_0000365 3300036401 Bacteria 42154
183 Ga0373937_0534453 3300036401 Bacteria 1114
184 Ga0373937_0881708 3300036401 Bacteria 843
185 Ga0372808_001084 3300036459 Bacteria 2655
186 Ga0373925_0000038 3300037068 Bacteria 142088
187 Ga0373925_0003269 3300037068 Bacteria 12616
188 Ga0373925_0056491 3300037068 Bacteria 2940
189 Ga0373925_0149516 3300037068 Bacteria 1833
190 Ga0373925_0285478 3300037068 Bacteria 1330
191 Ga0395899_0085567 3300037312 Bacteria 2291
192 Ga0395900_0810985 3300037418 Bacteria 863
193 Ga0436364_1350268 3300037853 Bacteria 2639
194 Ga0436364_1385829 3300037853 Bacteria 3651
195 Ga0395901_0509178 3300038443 Bacteria 1225
196 Ga0436365_1841604 3300039437 Bacteria 2145
197 Ga0436361_0722528 3300039447 Bacteria 3289
198 Ga0436361_0801319 3300039447 Bacteria 920
199 Ga0436363_1451784 3300039450 Bacteria 1310
200 Ga0436362_0807531 3300039453 Bacteria 1790
201 Ga0451804_0317326 3300041463 Bacteria 776
202 Ga0451843_1010641 3300041509 Bacteria 1260
203 Ga0451843_1388868 3300041509 Bacteria 857
204 Ga0439435_0287430 3300042436 Bacteria 561
205 Ga0466963_0182099 3300044694 Bacteria 1467
206 Ga0466968_0210613 3300044735 Bacteria 913
207 Ga0466970_0047235 3300044765 Bacteria 2294
208 Ga0466959_0102781 3300045049 Bacteria 2045
209 Ga0466967_0600877 3300045976 Bacteria 1086
210 Ga0495592_0000062 3300046454 Bacteria 99207
211 Ga0495592_0036174 3300046454 Bacteria 3719
212 Ga0495603_0063724 3300046455 Bacteria 2174
213 Ga0495629_0007057 3300046459 Bacteria 8278
214 Ga0495629_0098265 3300046459 Bacteria 2042
215 Ga0495641_0442334 3300046461 Bacteria 591
216 Ga0495651_0000935 3300046462 Bacteria 22624
217 Ga0495651_0033717 3300046462 Bacteria 3993
218 Ga0495653_0000075 3300046463 Bacteria 82856
219 Ga0495653_0076069 3300046463 Bacteria 2497
220 Ga0495580_0282352 3300046472 Bacteria 1132
221 Ga0495582_0088016 3300046473 Bacteria 1730
222 Ga0495662_0009191 3300046476 Bacteria 4849
223 Ga0495662_0228406 3300046476 Bacteria 917
224 Ga0495662_0261503 3300046476 Bacteria 852
225 Ga0495662_0331074 3300046476 Bacteria 749
226 Ga0495664_0000009 3300046477 Bacteria 289534
227 Ga0495664_0770462 3300046477 Bacteria 566
228 Ga0495584_0032972 3300046491 Bacteria 2620
229 Ga0495594_0308337 3300046499 Bacteria 902
230 Ga0495606_0113628 3300046507 Bacteria 1630
231 Ga0495608_0000061 3300046511 Bacteria 86891
232 Ga0495618_0000016 3300046514 Bacteria 151770
233 Ga0495618_0017687 3300046514 Bacteria 4375
234 Ga0495618_0099163 3300046514 Bacteria 1864
235 Ga0495628_0000012 3300046516 Bacteria 224162
236 Ga0495628_0157928 3300046516 Bacteria 1724
237 Ga0495628_0358000 3300046516 Bacteria 1072
238 Ga0495630_0002768 3300046517 Bacteria 12173
239 Ga0495630_0010617 3300046517 Bacteria 6650
240 Ga0495630_0177406 3300046517 Bacteria 1624
241 Ga0495630_0383838 3300046517 Bacteria 1076
242 Ga0495648_0001338 3300046524 Bacteria 24368
243 Ga0495666_0156981 3300046526 Bacteria 1056
244 Ga0495652_0000021 3300046529 Bacteria 181454
245 Ga0495652_0145602 3300046529 Bacteria 1857
246 Ga0495652_0759919 3300046529 Bacteria 648
247 Ga0495665_0039700 3300046531 Bacteria 2506
248 Ga0495665_0104526 3300046531 Bacteria 1486
249 Ga0495640_0000031 3300046533 Bacteria 77381
250 Ga0495640_0013952 3300046533 Bacteria 6096
251 Ga0495640_0031937 3300046533 Bacteria 3754
252 Ga0495640_0104949 3300046533 Bacteria 1851
253 Ga0495586_0564329 3300046535 Bacteria 657
254 Ga0495587_0000052 3300046536 Bacteria 100154
255 Ga0495587_0148417 3300046536 Bacteria 1336
256 Ga0495645_0000254 3300046543 Bacteria 39053
257 Ga0495622_0036790 3300046557 Bacteria 2281
258 Ga0495667_0000011 3300046559 Bacteria 222545
259 Ga0495667_0054128 3300046559 Bacteria 2641
260 Ga0495634_0000080 3300046642 Bacteria 76133
261 Ga0495634_0062595 3300046642 Bacteria 2470
262 Ga0495634_0244870 3300046642 Bacteria 1098
263 Ga0495635_0000018 3300046663 Bacteria 193591
264 Ga0495635_0105783 3300046663 Bacteria 1922
265 Ga0495635_0107309 3300046663 Bacteria 1907
266 Ga0495657_0000308 3300046675 Bacteria 44743
267 Ga0495657_0323866 3300046675 Bacteria 915
268 Ga0495599_0000128 3300046678 Bacteria 48691
269 Ga0495599_0237693 3300046678 Bacteria 1111
270 Ga0495623_0001080 3300046679 Bacteria 18452
271 Ga0495646_0000038 3300046680 Bacteria 75050
272 Ga0495646_0132186 3300046680 Bacteria 1404
273 Ga0495647_0054121 3300046681 Bacteria 1567
274 Ga0495658_0097493 3300046683 Bacteria 1750
275 Ga0495658_0111715 3300046683 Bacteria 1644
276 Ga0495613_0024336 3300046689 Bacteria 4511
277 Ga0495613_0072226 3300046689 Bacteria 2515
278 Ga0495613_0082227 3300046689 Bacteria 2339
279 Ga0495624_0171941 3300046690 Bacteria 1322
280 Ga0495624_0657952 3300046690 Bacteria 623
281 Ga0495600_0000822 3300046809 Bacteria 16495
282 Ga0495581_0012282 3300047315 Bacteria 4960
283 Ga0495581_0089317 3300047315 Bacteria 1787
284 Ga0495581_0158076 3300047315 Bacteria 1325
285 Ga0495581_0318380 3300047315 Bacteria 909
286 Ga0495581_0586656 3300047315 Bacteria 646
287 Ga0495604_0000011 3300047317 Bacteria 292024
288 Ga0495604_0172865 3300047317 Bacteria 1517
289 Ga0495674_0000015 3300047319 Bacteria 224071
290 Ga0495674_0013032 3300047319 Bacteria 7826
291 Ga0495674_0097152 3300047319 Bacteria 2509
292 Ga0495674_0140011 3300047319 Bacteria 2034
293 Ga0495674_0255623 3300047319 Bacteria 1440
294 Ga0495672_0170053 3300047320 Bacteria 1112
295 Ga0495672_0437609 3300047320 Bacteria 592
296 Ga0495676_0017130 3300047321 Bacteria 6412
297 Ga0495676_0262465 3300047321 Bacteria 1174
298 Ga0495680_0080214 3300047322 Bacteria 2466
299 Ga0495675_0000424 3300047444 Bacteria 28500
300 Ga0495675_0020845 3300047444 Bacteria 4171
301 Ga0495673_0085882 3300047469 Bacteria 1294
302 Ga0495684_0000012 3300047471 Bacteria 187118
303 Ga0495684_0000987 3300047471 Bacteria 23140
304 Ga0495684_0080412 3300047471 Bacteria 2474
305 Ga0495593_0000789 3300047673 Bacteria 18348
306 Ga0495593_0040992 3300047673 Bacteria 2491
307 Ga0495593_0654437 3300047673 Bacteria 527
308 Ga0495602_0000018 3300048088 Bacteria 183837
309 Ga0496100_1374827 3300048903 Bacteria 557
310 Ga0496106_0493189 3300048909 Bacteria 984
311 Ga0496110_1582704 3300048913 Bacteria 565
312 Ga0496114_0254843 3300048917 Bacteria 1544
313 Ga0496114_0583077 3300048917 Bacteria 987
314 Ga0496115_0517470 3300048918 Bacteria 957
315 Ga0496115_0808719 3300048918 Bacteria 729
316 Ga0496121_0001674 3300048924 Bacteria 36437
317 Ga0496121_0197356 3300048924 Bacteria 1437
318 Ga0496126_0028469 3300048929 Bacteria 5324
319 Ga0496126_0177289 3300048929 Bacteria 1812
320 Ga0496126_0312219 3300048929 Bacteria 1294
321 Ga0496126_0647465 3300048929 Bacteria 827
322 Ga0501067_0635104 3300049583 Bacteria 599
323 nmdc:mga03683_84246_c1 3300050489 Bacteria 1377
324 nmdc:mga00v17_195320_c1 3300050491 Bacteria 1308
325 nmdc:mga06z11_28766_c1 3300050494 Bacteria 2670
326 nmdc:mga06z11_74100_c1 3300050494 Bacteria 1494
327 nmdc:mga04h51_171177_c1 3300050495 Bacteria 841
328 nmdc:mga05p37_264846_c1 3300050507 Bacteria 2055
329 nmdc:mga08y16_258590_c1 3300050511 Bacteria 1798
330 nmdc:mga08y16_421017_c1 3300050511 Bacteria 1365
331 nmdc:mga0n895_14101_c1 3300050512 Bacteria 7245
332 nmdc:mga0n895_39037_c1 3300050512 Bacteria 4603
333 nmdc:mga0n895_42531_c1 3300050512 Bacteria 4420
334 Ga0495601_0000015 3300053077 Bacteria 213851
335 Ga0495601_0003928 3300053077 Bacteria 8553
336 Ga0495601_0344540 3300053077 Bacteria 969
337 Ga0495612_0000016 3300053078 Bacteria 158947
338 Ga0495612_0026181 3300053078 Bacteria 2344
339 Ga0495612_0099658 3300053078 Bacteria 1236
340 Ga0495612_0107787 3300053078 Bacteria 1190
341 Ga0495612_0227873 3300053078 Bacteria 826
342 Ga0500635_0004538 3300053080 Bacteria 3582
343 Ga0500635_0127933 3300053080 Bacteria 955
344 Ga0495595_0000037 3300053084 Bacteria 78496
345 Ga0495595_0163095 3300053084 Bacteria 1100
346 Ga0495619_0000066 3300053085 Bacteria 83667
347 Ga0495619_0051606 3300053085 Bacteria 2718
348 Ga0495619_0281243 3300053085 Bacteria 1153
349 Ga0500647_0423607 3300053091 Bacteria 533
350 Ga0500566_0000056 3300053094 Bacteria 53974
351 Ga0500566_0065236 3300053094 Bacteria 2054
352 Ga0500640_005083 3300053095 Bacteria 4861
353 Ga0500554_016949 3300053102 Bacteria 1937
354 Ga0500572_000724 3300053111 Bacteria 10668
355 Ga0500591_017742 3300053115 Bacteria 3440
356 Ga0500593_125307 3300053117 Bacteria 1035
357 Ga0500595_001347 3300053119 Bacteria 13271
358 Ga0500595_019483 3300053119 Bacteria 2461
359 Ga0500608_058462 3300053122 Bacteria 1846
360 Ga0500614_000963 3300053123 Bacteria 7160
361 Ga0500658_0116077 3300053134 Bacteria 1183
362 Ga0500559_0004908 3300053136 Bacteria 6230
363 Ga0500564_325670 3300053138 Bacteria 580
364 Ga0500568_0045540 3300053139 Bacteria 1745
365 Ga0500590_232280 3300053148 Bacteria 750
366 Ga0500603_000723 3300053150 Bacteria 8044
367 Ga0500603_101547 3300053150 Bacteria 855
368 Ga0500630_033209 3300053159 Bacteria 2531
369 Ga0500639_000622 3300053163 Bacteria 17806
370 Ga0500639_107433 3300053163 Bacteria 1363
371 Ga0500637_0000243 3300053178 Bacteria 20274
372 Ga0500637_0046673 3300053178 Bacteria 2459
373 Ga0500637_0062572 3300053178 Bacteria 2132
374 Ga0500596_004005 3300053735 Bacteria 2741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0635104 Ga0501067_0635104_19_462 147
2 3300005344 Ga0070661_100636068 Ga0070661_1006360681 148
3 3300005354 Ga0070675_100517807 Ga0070675_1005178071 148
4 3300005457 Ga0070662_101458798 Ga0070662_1014587981 148
5 3300005458 Ga0070681_10668182 Ga0070681_106681821 148
6 3300005546 Ga0070696_101544752 Ga0070696_1015447521 148
7 3300025920 Ga0207649_10426595 Ga0207649_104265952 148
8 3300025926 Ga0207659_10415071 Ga0207659_104150711 148
9 3300027907 Ga0207428_10768092 Ga0207428_107680921 148
10 3300039450 Ga0436363_1451784 Ga0436363_1451784_709_1161 148
11 3300003911 JGI25405J52794_10026794 JGI25405J52794_100267942 149
12 3300005614 Ga0068856_100275555 Ga0068856_1002755551 149
13 3300005937 Ga0081455_10025968 Ga0081455_100259683 149
14 3300025928 Ga0207700_10744338 Ga0207700_107443381 149
15 3300027671 Ga0209588_1070262 Ga0209588_10702622 149
16 3300031616 Ga0307508_10082442 Ga0307508_100824424 149
17 3300047320 Ga0495672_0437609 Ga0495672_0437609_11_460 149
18 3300006028 Ga0070717_10973270 Ga0070717_109732702 150
19 3300006038 Ga0075365_10017288 Ga0075365_100172882 150
20 3300006048 Ga0075363_100059481 Ga0075363_1000594812 150
21 3300006175 Ga0070712_100271895 Ga0070712_1002718952 150
22 3300006177 Ga0075362_10089992 Ga0075362_100899923 150
23 3300006178 Ga0075367_10022131 Ga0075367_100221313 150
24 3300006186 Ga0075369_10003142 Ga0075369_100031422 150
25 3300006881 Ga0068865_101133638 Ga0068865_1011336382 150
26 3300021384 Ga0213876_10164626 Ga0213876_101646263 150
27 3300025938 Ga0207704_10851916 Ga0207704_108519162 150
28 3300035116 Ga0373945_0004300 Ga0373945_0004300_2259_2765 150
29 3300035170 Ga0373943_0001745 Ga0373943_0001745_7097_7603 150
30 3300035171 Ga0373946_0003559 Ga0373946_0003559_2824_3330 150
31 3300035692 Ga0373935_0004624 Ga0373935_0004624_4750_5256 150
32 3300035695 Ga0373927_0006202 Ga0373927_0006202_5393_5899 150
33 3300035725 Ga0373947_0010847 Ga0373947_0010847_2459_2965 150
34 3300035725 Ga0373947_0378739 Ga0373947_0378739_157_609 150
35 3300037068 Ga0373925_0003269 Ga0373925_0003269_7736_8242 150
36 3300037068 Ga0373925_0285478 Ga0373925_0285478_125_577 150
37 3300037853 Ga0436364_1350268 Ga0436364_1350268_1041_1502 150
38 3300039437 Ga0436365_1841604 Ga0436365_1841604_491_952 150
39 3300039447 Ga0436361_0722528 Ga0436361_0722528_65_520 150
40 3300046459 Ga0495629_0098265 Ga0495629_0098265_179_685 150
41 3300046476 Ga0495662_0228406 Ga0495662_0228406_364_870 150
42 3300046491 Ga0495584_0032972 Ga0495584_0032972_1129_1602 150
43 3300046514 Ga0495618_0099163 Ga0495618_0099163_904_1410 150
44 3300046517 Ga0495630_0010617 Ga0495630_0010617_2247_2753 150
45 3300046531 Ga0495665_0039700 Ga0495665_0039700_1574_2080 150
46 3300046642 Ga0495634_0244870 Ga0495634_0244870_210_716 150
47 3300046663 Ga0495635_0105783 Ga0495635_0105783_1034_1540 150
48 3300046681 Ga0495647_0054121 Ga0495647_0054121_500_1006 150
49 3300046683 Ga0495658_0097493 Ga0495658_0097493_87_593 150
50 3300046689 Ga0495613_0024336 Ga0495613_0024336_2870_3376 150
51 3300047315 Ga0495581_0012282 Ga0495581_0012282_406_912 150
52 3300047319 Ga0495674_0140011 Ga0495674_0140011_26_532 150
53 3300047321 Ga0495676_0017130 Ga0495676_0017130_368_874 150
54 3300047471 Ga0495684_0000987 Ga0495684_0000987_21235_21741 150
55 3300047673 Ga0495593_0040992 Ga0495593_0040992_1347_1853 150
56 3300048903 Ga0496100_1374827 Ga0496100_1374827_14_469 150
57 3300048909 Ga0496106_0493189 Ga0496106_0493189_266_721 150
58 3300048913 Ga0496110_1582704 Ga0496110_1582704_64_519 150
59 3300048917 Ga0496114_0254843 Ga0496114_0254843_26_481 150
60 3300048918 Ga0496115_0517470 Ga0496115_0517470_234_689 150
61 3300050494 nmdc:mga06z11_74100_c1 nmdc:mga06z11_74100_c1_994_1461 150
62 3300053085 Ga0495619_0051606 Ga0495619_0051606_2142_2648 150
63 iso_pu_bacteria 2904690495 2904695608 150
64 iso_pu_bacteria 2908756301 2908764137 150
65 3300005435 Ga0070714_100357506 Ga0070714_1003575063 151
66 3300005437 Ga0070710_10536673 Ga0070710_105366731 151
67 3300005445 Ga0070708_100523971 Ga0070708_1005239712 151
68 3300005467 Ga0070706_101602812 Ga0070706_1016028121 151
69 3300006175 Ga0070712_100249356 Ga0070712_1002493563 151
70 3300006175 Ga0070712_100514647 Ga0070712_1005146472 151
71 3300006871 Ga0075434_100013416 Ga0075434_10001341610 151
72 3300009093 Ga0105240_11471990 Ga0105240_114719902 151
73 3300021388 Ga0213875_10240715 Ga0213875_102407152 151
74 3300025315 Ga0207697_10027329 Ga0207697_100273292 151
75 3300025906 Ga0207699_10380148 Ga0207699_103801482 151
76 3300025915 Ga0207693_10079505 Ga0207693_100795052 151
77 3300025929 Ga0207664_10301585 Ga0207664_103015852 151
78 3300025939 Ga0207665_11008247 Ga0207665_110082471 151
79 3300025942 Ga0207689_10072766 Ga0207689_100727663 151
80 3300026078 Ga0207702_11156135 Ga0207702_111561351 151
81 3300031241 Ga0265325_10114818 Ga0265325_101148181 151
82 3300031595 Ga0265313_10100300 Ga0265313_101003001 151
83 3300035083 Ga0373926_0158273 Ga0373926_0158273_32_490 151
84 3300035086 Ga0373934_0005514 Ga0373934_0005514_4201_4662 151
85 3300035111 Ga0373923_0600069 Ga0373923_0600069_70_528 151
86 3300035116 Ga0373945_0029865 Ga0373945_0029865_1137_1595 151
87 3300035692 Ga0373935_0032240 Ga0373935_0032240_1671_2129 151
88 3300035695 Ga0373927_0102581 Ga0373927_0102581_963_1421 151
89 3300035695 Ga0373927_0404303 Ga0373927_0404303_71_529 151
90 3300035725 Ga0373947_0128748 Ga0373947_0128748_281_739 151
91 3300037853 Ga0436364_1385829 Ga0436364_1385829_1938_2399 151
92 3300039447 Ga0436361_0801319 Ga0436361_0801319_54_515 151
93 3300046472 Ga0495580_0282352 Ga0495580_0282352_442_900 151
94 3300046476 Ga0495662_0261503 Ga0495662_0261503_203_661 151
95 3300046477 Ga0495664_0770462 Ga0495664_0770462_26_484 151
96 3300046499 Ga0495594_0308337 Ga0495594_0308337_199_657 151
97 3300046517 Ga0495630_0383838 Ga0495630_0383838_45_503 151
98 3300046533 Ga0495640_0013952 Ga0495640_0013952_3960_4418 151
99 3300046533 Ga0495640_0031937 Ga0495640_0031937_1276_1734 151
100 3300046642 Ga0495634_0062595 Ga0495634_0062595_1709_2167 151
101 3300046680 Ga0495646_0132186 Ga0495646_0132186_153_611 151
102 3300046683 Ga0495658_0111715 Ga0495658_0111715_462_920 151
103 3300046689 Ga0495613_0082227 Ga0495613_0082227_1024_1482 151
104 3300047315 Ga0495581_0318380 Ga0495581_0318380_76_534 151
105 3300047319 Ga0495674_0013032 Ga0495674_0013032_5691_6149 151
106 3300047319 Ga0495674_0097152 Ga0495674_0097152_295_753 151
107 3300048917 Ga0496114_0583077 Ga0496114_0583077_260_724 151
108 3300048918 Ga0496115_0808719 Ga0496115_0808719_244_708 151
109 3300050511 nmdc:mga08y16_421017_c1 nmdc:mga08y16_421017_c1_153_617 151
110 3300050512 nmdc:mga0n895_14101_c1 nmdc:mga0n895_14101_c1_6372_6845 151
111 3300053077 Ga0495601_0003928 Ga0495601_0003928_6363_6821 151
112 3300053078 Ga0495612_0099658 Ga0495612_0099658_258_716 151
113 3300053085 Ga0495619_0281243 Ga0495619_0281243_332_790 151
114 3300005336 Ga0070680_101286356 Ga0070680_1012863561 152
115 3300005434 Ga0070709_10021403 Ga0070709_100214032 152
116 3300005435 Ga0070714_101176824 Ga0070714_1011768241 152
117 3300005439 Ga0070711_100067864 Ga0070711_1000678643 152
118 3300005439 Ga0070711_101362133 Ga0070711_1013621331 152
119 3300005548 Ga0070665_100122485 Ga0070665_1001224853 152
120 3300005563 Ga0068855_101152586 Ga0068855_1011525861 152
121 3300006042 Ga0075368_10068235 Ga0075368_100682352 152
122 3300006175 Ga0070712_100118872 Ga0070712_1001188723 152
123 3300009174 Ga0105241_11853559 Ga0105241_118535591 152
124 3300009545 Ga0105237_10831303 Ga0105237_108313032 152
125 3300009551 Ga0105238_10187370 Ga0105238_101873702 152
126 3300013306 Ga0163162_10415869 Ga0163162_104158692 152
127 3300025914 Ga0207671_10617303 Ga0207671_106173032 152
128 3300025916 Ga0207663_10289967 Ga0207663_102899672 152
129 3300025916 Ga0207663_11166514 Ga0207663_111665141 152
130 3300025924 Ga0207694_10709369 Ga0207694_107093692 152
131 3300025949 Ga0207667_10309441 Ga0207667_103094412 152
132 3300025949 Ga0207667_10615793 Ga0207667_106157932 152
133 3300027866 Ga0209813_10006761 Ga0209813_100067612 152
134 3300028379 Ga0268266_10429355 Ga0268266_104293553 152
135 3300031616 Ga0307508_10000114 Ga0307508_1000011485 152
136 3300035086 Ga0373934_0104823 Ga0373934_0104823_23_487 152
137 3300035089 Ga0373944_0077732 Ga0373944_0077732_539_1003 152
138 3300035111 Ga0373923_0166772 Ga0373923_0166772_16_480 152
139 3300035111 Ga0373923_0579530 Ga0373923_0579530_48_512 152
140 3300035113 Ga0373936_0048732 Ga0373936_0048732_1167_1631 152
141 3300035113 Ga0373936_0072044 Ga0373936_0072044_172_636 152
142 3300035116 Ga0373945_0005945 Ga0373945_0005945_2920_3384 152
143 3300035117 Ga0373953_0002803 Ga0373953_0002803_43_507 152
144 3300035117 Ga0373953_0038438 Ga0373953_0038438_205_669 152
145 3300035118 Ga0373954_0005204 Ga0373954_0005204_3386_3850 152
146 3300035118 Ga0373954_0114592 Ga0373954_0114592_527_991 152
147 3300035119 Ga0373956_0008461 Ga0373956_0008461_3609_4073 152
148 3300035119 Ga0373956_0178464 Ga0373956_0178464_32_496 152
149 3300035120 Ga0373957_0040043 Ga0373957_0040043_770_1234 152
150 3300035121 Ga0373960_0327535 Ga0373960_0327535_40_504 152
151 3300035171 Ga0373946_0002595 Ga0373946_0002595_2892_3356 152
152 3300035172 Ga0373955_0001254 Ga0373955_0001254_7285_7749 152
153 3300035172 Ga0373955_0078324 Ga0373955_0078324_660_1124 152
154 3300035410 Ga0373924_0001548 Ga0373924_0001548_3489_3953 152
155 3300035410 Ga0373924_0076116 Ga0373924_0076116_196_660 152
156 3300035691 Ga0373931_0329196 Ga0373931_0329196_218_682 152
157 3300035692 Ga0373935_0000328 Ga0373935_0000328_9046_9510 152
158 3300035692 Ga0373935_0171250 Ga0373935_0171250_957_1421 152
159 3300035695 Ga0373927_0067977 Ga0373927_0067977_1414_1878 152
160 3300035724 Ga0373933_0029643 Ga0373933_0029643_167_631 152
161 3300035724 Ga0373933_0102458 Ga0373933_0102458_303_767 152
162 3300035724 Ga0373933_0509191 Ga0373933_0509191_62_526 152
163 3300035725 Ga0373947_0009098 Ga0373947_0009098_2355_2819 152
164 3300035725 Ga0373947_0427314 Ga0373947_0427314_225_689 152
165 3300036401 Ga0373937_0000365 Ga0373937_0000365_17733_18197 152
166 3300036401 Ga0373937_0534453 Ga0373937_0534453_443_907 152
167 3300036401 Ga0373937_0881708 Ga0373937_0881708_136_600 152
168 3300037068 Ga0373925_0000038 Ga0373925_0000038_10488_10952 152
169 3300037068 Ga0373925_0149516 Ga0373925_0149516_47_511 152
170 3300037312 Ga0395899_0085567 Ga0395899_0085567_132_596 152
171 3300041509 Ga0451843_1010641 Ga0451843_1010641_681_1148 152
172 3300041509 Ga0451843_1388868 Ga0451843_1388868_305_769 152
173 3300042436 Ga0439435_0287430 Ga0439435_0287430_26_490 152
174 3300044694 Ga0466963_0182099 Ga0466963_0182099_870_1334 152
175 3300046454 Ga0495592_0000062 Ga0495592_0000062_78289_78753 152
176 3300046454 Ga0495592_0036174 Ga0495592_0036174_2418_2882 152
177 3300046459 Ga0495629_0007057 Ga0495629_0007057_4763_5227 152
178 3300046461 Ga0495641_0442334 Ga0495641_0442334_17_481 152
179 3300046462 Ga0495651_0000935 Ga0495651_0000935_14107_14571 152
180 3300046462 Ga0495651_0033717 Ga0495651_0033717_3189_3653 152
181 3300046463 Ga0495653_0000075 Ga0495653_0000075_17642_18106 152
182 3300046463 Ga0495653_0076069 Ga0495653_0076069_1934_2398 152
183 3300046476 Ga0495662_0009191 Ga0495662_0009191_2385_2849 152
184 3300046476 Ga0495662_0331074 Ga0495662_0331074_15_479 152
185 3300046477 Ga0495664_0000009 Ga0495664_0000009_130264_130728 152
186 3300046511 Ga0495608_0000061 Ga0495608_0000061_73916_74380 152
187 3300046514 Ga0495618_0000016 Ga0495618_0000016_16848_17312 152
188 3300046514 Ga0495618_0017687 Ga0495618_0017687_2828_3292 152
189 3300046516 Ga0495628_0000012 Ga0495628_0000012_158920_159384 152
190 3300046516 Ga0495628_0157928 Ga0495628_0157928_1151_1615 152
191 3300046517 Ga0495630_0002768 Ga0495630_0002768_6555_7019 152
192 3300046517 Ga0495630_0177406 Ga0495630_0177406_1045_1509 152
193 3300046529 Ga0495652_0000021 Ga0495652_0000021_64745_65209 152
194 3300046529 Ga0495652_0145602 Ga0495652_0145602_243_707 152
195 3300046533 Ga0495640_0000031 Ga0495640_0000031_9746_10210 152
196 3300046533 Ga0495640_0104949 Ga0495640_0104949_1158_1622 152
197 3300046535 Ga0495586_0564329 Ga0495586_0564329_122_586 152
198 3300046536 Ga0495587_0000052 Ga0495587_0000052_64751_65215 152
199 3300046536 Ga0495587_0148417 Ga0495587_0148417_828_1292 152
200 3300046543 Ga0495645_0000254 Ga0495645_0000254_35529_35993 152
201 3300046559 Ga0495667_0000011 Ga0495667_0000011_91608_92072 152
202 3300046559 Ga0495667_0054128 Ga0495667_0054128_1237_1701 152
203 3300046642 Ga0495634_0000080 Ga0495634_0000080_10862_11326 152
204 3300046663 Ga0495635_0000018 Ga0495635_0000018_17773_18237 152
205 3300046663 Ga0495635_0107309 Ga0495635_0107309_339_803 152
206 3300046675 Ga0495657_0000308 Ga0495657_0000308_35520_35984 152
207 3300046675 Ga0495657_0323866 Ga0495657_0323866_257_721 152
208 3300046678 Ga0495599_0000128 Ga0495599_0000128_14276_14740 152
209 3300046678 Ga0495599_0237693 Ga0495599_0237693_170_634 152
210 3300046679 Ga0495623_0001080 Ga0495623_0001080_10924_11388 152
211 3300046680 Ga0495646_0000038 Ga0495646_0000038_7415_7879 152
212 3300046689 Ga0495613_0072226 Ga0495613_0072226_18_482 152
213 3300046690 Ga0495624_0171941 Ga0495624_0171941_24_488 152
214 3300046690 Ga0495624_0657952 Ga0495624_0657952_93_557 152
215 3300046809 Ga0495600_0000822 Ga0495600_0000822_7015_7479 152
216 3300047315 Ga0495581_0158076 Ga0495581_0158076_811_1275 152
217 3300047317 Ga0495604_0000011 Ga0495604_0000011_175355_175819 152
218 3300047317 Ga0495604_0172865 Ga0495604_0172865_10_474 152
219 3300047319 Ga0495674_0000015 Ga0495674_0000015_158927_159391 152
220 3300047319 Ga0495674_0255623 Ga0495674_0255623_244_708 152
221 3300047321 Ga0495676_0262465 Ga0495676_0262465_15_479 152
222 3300047322 Ga0495680_0080214 Ga0495680_0080214_19_483 152
223 3300047444 Ga0495675_0000424 Ga0495675_0000424_14817_15281 152
224 3300047444 Ga0495675_0020845 Ga0495675_0020845_2880_3344 152
225 3300047471 Ga0495684_0000012 Ga0495684_0000012_9142_9606 152
226 3300047471 Ga0495684_0080412 Ga0495684_0080412_725_1189 152
227 3300047673 Ga0495593_0000789 Ga0495593_0000789_2004_2468 152
228 3300047673 Ga0495593_0654437 Ga0495593_0654437_30_494 152
229 3300048088 Ga0495602_0000018 Ga0495602_0000018_116202_116666 152
230 3300050489 nmdc:mga03683_84246_c1 nmdc:mga03683_84246_c1_734_1198 152
231 3300050491 nmdc:mga00v17_195320_c1 nmdc:mga00v17_195320_c1_522_986 152
232 3300050494 nmdc:mga06z11_28766_c1 nmdc:mga06z11_28766_c1_2178_2642 152
233 3300050495 nmdc:mga04h51_171177_c1 nmdc:mga04h51_171177_c1_278_742 152
234 3300050512 nmdc:mga0n895_42531_c1 nmdc:mga0n895_42531_c1_2914_3387 152
235 3300053077 Ga0495601_0000015 Ga0495601_0000015_175355_175819 152
236 3300053078 Ga0495612_0000016 Ga0495612_0000016_135196_135660 152
237 3300053078 Ga0495612_0026181 Ga0495612_0026181_924_1388 152
238 3300053084 Ga0495595_0000037 Ga0495595_0000037_7480_7944 152
239 3300053084 Ga0495595_0163095 Ga0495595_0163095_592_1056 152
240 3300053085 Ga0495619_0000066 Ga0495619_0000066_67144_67608 152
241 3300053117 Ga0500593_125307 Ga0500593_125307_546_1010 152
242 3300053134 Ga0500658_0116077 Ga0500658_0116077_402_866 152
243 3300001979 JGI24740J21852_10028543 JGI24740J21852_100285433 153
244 3300002075 JGI24738J21930_10021607 JGI24738J21930_100216073 153
245 3300005436 Ga0070713_101355094 Ga0070713_1013550941 153
246 3300005437 Ga0070710_10015263 Ga0070710_100152634 153
247 3300005439 Ga0070711_100031727 Ga0070711_1000317274 153
248 3300005455 Ga0070663_100008818 Ga0070663_1000088185 153
249 3300005467 Ga0070706_100246653 Ga0070706_1002466532 153
250 3300005539 Ga0068853_100065825 Ga0068853_1000658253 153
251 3300005563 Ga0068855_100261442 Ga0068855_1002614423 153
252 3300005577 Ga0068857_100147082 Ga0068857_1001470823 153
253 3300005578 Ga0068854_100031071 Ga0068854_1000310714 153
254 3300005616 Ga0068852_100217322 Ga0068852_1002173223 153
255 3300005834 Ga0068851_10003652 Ga0068851_100036522 153
256 3300005841 Ga0068863_101104560 Ga0068863_1011045601 153
257 3300005843 Ga0068860_100000251 Ga0068860_10000025133 153
258 3300005983 Ga0081540_1052335 Ga0081540_10523354 153
259 3300005985 Ga0081539_10002294 Ga0081539_1000229419 153
260 3300006028 Ga0070717_10018516 Ga0070717_100185168 153
261 3300006028 Ga0070717_10947753 Ga0070717_109477531 153
262 3300006038 Ga0075365_10281866 Ga0075365_102818663 153
263 3300006163 Ga0070715_10952162 Ga0070715_109521621 153
264 3300006173 Ga0070716_100041581 Ga0070716_1000415812 153
265 3300006871 Ga0075434_100013157 Ga0075434_10001315710 153
266 3300006914 Ga0075436_100203074 Ga0075436_1002030742 153
267 3300007265 Ga0099794_10142975 Ga0099794_101429752 153
268 3300009093 Ga0105240_10032407 Ga0105240_100324074 153
269 3300009094 Ga0111539_10321594 Ga0111539_103215943 153
270 3300009148 Ga0105243_10601064 Ga0105243_106010642 153
271 3300009174 Ga0105241_10002070 Ga0105241_1000207014 153
272 3300009545 Ga0105237_10286779 Ga0105237_102867793 153
273 3300009545 Ga0105237_10677164 Ga0105237_106771641 153
274 3300009551 Ga0105238_10003705 Ga0105238_100037054 153
275 3300010159 Ga0099796_10200913 Ga0099796_102009131 153
276 3300010375 Ga0105239_10012498 Ga0105239_100124984 153
277 3300011119 Ga0105246_10408955 Ga0105246_104089552 153
278 3300013105 Ga0157369_10201477 Ga0157369_102014772 153
279 3300021358 Ga0213873_10073827 Ga0213873_100738271 153
280 3300021441 Ga0213871_10085726 Ga0213871_100857261 153
281 3300025321 Ga0207656_10044603 Ga0207656_100446033 153
282 3300025906 Ga0207699_10007596 Ga0207699_100075961 153
283 3300025910 Ga0207684_10089054 Ga0207684_100890542 153
284 3300025911 Ga0207654_10000131 Ga0207654_1000013139 153
285 3300025913 Ga0207695_10000506 Ga0207695_100005065 153
286 3300025914 Ga0207671_10195152 Ga0207671_101951522 153
287 3300025914 Ga0207671_10199907 Ga0207671_101999071 153
288 3300025924 Ga0207694_10000086 Ga0207694_1000008667 153
289 3300025928 Ga0207700_10075091 Ga0207700_100750912 153
290 3300025931 Ga0207644_10576776 Ga0207644_105767763 153
291 3300025939 Ga0207665_10030788 Ga0207665_100307884 153
292 3300025949 Ga0207667_10013204 Ga0207667_100132041 153
293 3300025986 Ga0207658_11473306 Ga0207658_114733062 153
294 3300026067 Ga0207678_10085370 Ga0207678_100853702 153
295 3300026078 Ga0207702_10000098 Ga0207702_1000009820 153
296 3300026088 Ga0207641_10303379 Ga0207641_103033792 153
297 3300026116 Ga0207674_10166727 Ga0207674_101667274 153
298 3300027512 Ga0209179_1007889 Ga0209179_10078893 153
299 3300027671 Ga0209588_1031722 Ga0209588_10317222 153
300 3300027671 Ga0209588_1121253 Ga0209588_11212532 153
301 3300028380 Ga0268265_10538877 Ga0268265_105388771 153
302 3300028381 Ga0268264_10000051 Ga0268264_1000005149 153
303 3300030521 Ga0307511_10211746 Ga0307511_102117463 153
304 3300031616 Ga0307508_10177565 Ga0307508_101775653 153
305 3300031616 Ga0307508_10415870 Ga0307508_104158701 153
306 3300031730 Ga0307516_10001674 Ga0307516_1000167438 153
307 3300031730 Ga0307516_10260360 Ga0307516_102603603 153
308 3300033179 Ga0307507_10012898 Ga0307507_100128983 153
309 3300035090 Ga0373949_0270576 Ga0373949_0270576_12_488 153
310 3300035113 Ga0373936_0050746 Ga0373936_0050746_950_1417 153
311 3300035692 Ga0373935_0010091 Ga0373935_0010091_2123_2590 153
312 3300035695 Ga0373927_0282170 Ga0373927_0282170_324_791 153
313 3300035724 Ga0373933_0000290 Ga0373933_0000290_781_1248 153
314 3300035724 Ga0373933_0461387 Ga0373933_0461387_292_759 153
315 3300035725 Ga0373947_0538810 Ga0373947_0538810_317_784 153
316 3300036459 Ga0372808_001084 Ga0372808_001084_907_1374 153
317 3300037068 Ga0373925_0056491 Ga0373925_0056491_287_754 153
318 3300037418 Ga0395900_0810985 Ga0395900_0810985_131_598 153
319 3300038443 Ga0395901_0509178 Ga0395901_0509178_170_637 153
320 3300039453 Ga0436362_0807531 Ga0436362_0807531_863_1324 153
321 3300041463 Ga0451804_0317326 Ga0451804_0317326_173_640 153
322 3300044735 Ga0466968_0210613 Ga0466968_0210613_172_639 153
323 3300044765 Ga0466970_0047235 Ga0466970_0047235_525_992 153
324 3300045049 Ga0466959_0102781 Ga0466959_0102781_797_1264 153
325 3300045976 Ga0466967_0600877 Ga0466967_0600877_178_645 153
326 3300046455 Ga0495603_0063724 Ga0495603_0063724_240_719 153
327 3300046473 Ga0495582_0088016 Ga0495582_0088016_564_1031 153
328 3300046507 Ga0495606_0113628 Ga0495606_0113628_793_1260 153
329 3300046516 Ga0495628_0358000 Ga0495628_0358000_152_619 153
330 3300046524 Ga0495648_0001338 Ga0495648_0001338_14263_14730 153
331 3300046526 Ga0495666_0156981 Ga0495666_0156981_212_691 153
332 3300046529 Ga0495652_0759919 Ga0495652_0759919_128_595 153
333 3300046531 Ga0495665_0104526 Ga0495665_0104526_364_831 153
334 3300046557 Ga0495622_0036790 Ga0495622_0036790_243_710 153
335 3300047315 Ga0495581_0089317 Ga0495581_0089317_788_1255 153
336 3300047315 Ga0495581_0586656 Ga0495581_0586656_86_553 153
337 3300047320 Ga0495672_0170053 Ga0495672_0170053_391_858 153
338 3300047469 Ga0495673_0085882 Ga0495673_0085882_787_1254 153
339 3300048924 Ga0496121_0001674 Ga0496121_0001674_12819_13286 153
340 3300048924 Ga0496121_0197356 Ga0496121_0197356_200_667 153
341 3300048929 Ga0496126_0028469 Ga0496126_0028469_1111_1581 153
342 3300048929 Ga0496126_0177289 Ga0496126_0177289_719_1186 153
343 3300048929 Ga0496126_0312219 Ga0496126_0312219_726_1193 153
344 3300048929 Ga0496126_0647465 Ga0496126_0647465_340_807 153
345 3300050507 nmdc:mga05p37_264846_c1 nmdc:mga05p37_264846_c1_1247_1714 153
346 3300050511 nmdc:mga08y16_258590_c1 nmdc:mga08y16_258590_c1_208_675 153
347 3300050512 nmdc:mga0n895_39037_c1 nmdc:mga0n895_39037_c1_1868_2335 153
348 3300053077 Ga0495601_0344540 Ga0495601_0344540_201_668 153
349 3300053078 Ga0495612_0107787 Ga0495612_0107787_178_645 153
350 3300053078 Ga0495612_0227873 Ga0495612_0227873_279_746 153
351 3300053080 Ga0500635_0004538 Ga0500635_0004538_2727_3194 153
352 3300053080 Ga0500635_0127933 Ga0500635_0127933_346_825 153
353 3300053091 Ga0500647_0423607 Ga0500647_0423607_26_493 153
354 3300053094 Ga0500566_0000056 Ga0500566_0000056_51951_52418 153
355 3300053094 Ga0500566_0065236 Ga0500566_0065236_914_1381 153
356 3300053095 Ga0500640_005083 Ga0500640_005083_1558_2025 153
357 3300053102 Ga0500554_016949 Ga0500554_016949_1447_1926 153
358 3300053111 Ga0500572_000724 Ga0500572_000724_8645_9112 153
359 3300053115 Ga0500591_017742 Ga0500591_017742_2257_2724 153
360 3300053119 Ga0500595_001347 Ga0500595_001347_11440_11907 153
361 3300053119 Ga0500595_019483 Ga0500595_019483_749_1216 153
362 3300053122 Ga0500608_058462 Ga0500608_058462_1325_1792 153
363 3300053123 Ga0500614_000963 Ga0500614_000963_1299_1766 153
364 3300053136 Ga0500559_0004908 Ga0500559_0004908_1587_2054 153
365 3300053138 Ga0500564_325670 Ga0500564_325670_61_528 153
366 3300053139 Ga0500568_0045540 Ga0500568_0045540_1122_1589 153
367 3300053148 Ga0500590_232280 Ga0500590_232280_263_730 153
368 3300053150 Ga0500603_000723 Ga0500603_000723_1144_1623 153
369 3300053150 Ga0500603_101547 Ga0500603_101547_336_803 153
370 3300053159 Ga0500630_033209 Ga0500630_033209_1938_2405 153
371 3300053163 Ga0500639_000622 Ga0500639_000622_1585_2052 153
372 3300053163 Ga0500639_107433 Ga0500639_107433_393_860 153
373 3300053178 Ga0500637_0000243 Ga0500637_0000243_8106_8585 153
374 3300053178 Ga0500637_0046673 Ga0500637_0046673_481_948 153
375 3300053178 Ga0500637_0062572 Ga0500637_0062572_1002_1469 153
376 3300053735 Ga0500596_004005 Ga0500596_004005_2176_2643 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

33

167

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9049 9 143
2fxi-assembly1.cif.gz_A arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site 0.9041 7 143
1ljl-assembly1.cif.gz_A wild type pi258 s. aureus arsenate reductase 0.8902 8 143
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.8848 7 143
1jl3-assembly1.cif.gz_A crystal structure of b. subtilis arsc 0.8838 9 149
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8699 9 149 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8645 9 149 3.40.50.2300
3rh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8616 8 143 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8564 9 149 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8469 9 149 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A848JZK5-F1-model_v4 Protein-tyrosine-phosphatase 0.9941 15 145 GO:0046685
AF-A0A4Q3FGG8-F1-model_v4 Low molecular weight phosphatase family protein 0.9935 15 133 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A7C5KTW2-F1-model_v4 Low molecular weight phosphatase family protein 0.9891 12 145 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A0Q6KUI4-F1-model_v4 ArsC family transcriptional regulator 0.9889 8 146 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A6M1M6F0-F1-model_v4 Low molecular weight phosphatase family protein 0.9888 8 144 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
90.38 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map