F427399

General Info

Members Datasets Scaffolds Average Seq Length
376 227 375 119

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10608192|Ga0307405_106081922
Length 127
Sequence MPELIDTPVRVEAAGEPPKLIDEFVGRASNSEERVSVARMRSPAGWSEPGQRPEFDEYTVVLGGTLHVETEDGGTLAVPAGQAVLVRSDEWVRYSTPEGAEYVAVCLPAFSPDGAPRRGLTQLAQDS

Samples

Sample ID Description Type Environment
1 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 3.46
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000923 3300003373 Bacteria 6327
2 Ga0055530_10019116 3300003791 Unclassified 2084
3 Ga0070658_10625175 3300005327 Bacteria 934
4 Ga0070658_10818248 3300005327 Bacteria 809
5 Ga0070658_10885795 3300005327 Bacteria 776
6 Ga0070683_100023723 3300005329 Bacteria 5490
7 Ga0070683_100551155 3300005329 Bacteria 1102
8 Ga0070683_100946029 3300005329 Bacteria 827
9 Ga0070683_101588106 3300005329 Bacteria 629
10 Ga0070683_101960586 3300005329 Unclassified 563
11 Ga0070683_102056173 3300005329 Bacteria 549
12 Ga0068869_100018634 3300005334 Bacteria 4729
13 Ga0070682_100295706 3300005337 Bacteria 1186
14 Ga0068868_102121159 3300005338 Bacteria 535
15 Ga0070660_100207548 3300005339 Bacteria 1590
16 Ga0070689_100940826 3300005340 Unclassified 766
17 Ga0070661_100498928 3300005344 Bacteria 974
18 Ga0070668_101302890 3300005347 Bacteria 660
19 Ga0070671_100180280 3300005355 Bacteria 1788
20 Ga0070673_100116271 3300005364 Bacteria 2225
21 Ga0070688_100722995 3300005365 Bacteria 773
22 Ga0070659_100041587 3300005366 Bacteria 3594
23 Ga0070709_10004486 3300005434 Bacteria 7532
24 Ga0070709_10128714 3300005434 Bacteria 1726
25 Ga0070709_10304772 3300005434 Unclassified 1164
26 Ga0070714_100022410 3300005435 Bacteria 5180
27 Ga0070714_100089203 3300005435 Bacteria 2699
28 Ga0070713_100684222 3300005436 Bacteria 979
29 Ga0070710_10149142 3300005437 Bacteria 1441
30 Ga0070710_11021223 3300005437 Unclassified 603
31 Ga0070711_100106128 3300005439 Bacteria 2053
32 Ga0070700_100168298 3300005441 Bacteria 1516
33 Ga0070708_101579592 3300005445 Bacteria 611
34 Ga0070663_100616049 3300005455 Bacteria 914
35 Ga0070681_10400513 3300005458 Bacteria 1284
36 Ga0068867_101070865 3300005459 Unclassified 735
37 Ga0070698_100943960 3300005471 Bacteria 809
38 Ga0070679_100754348 3300005530 Bacteria 916
39 Ga0070679_100834833 3300005530 Bacteria 865
40 Ga0070684_100024504 3300005535 Bacteria 5062
41 Ga0070684_100087357 3300005535 Bacteria 2769
42 Ga0070684_100121260 3300005535 Bacteria 2352
43 Ga0070684_100202012 3300005535 Bacteria 1810
44 Ga0070684_100854756 3300005535 Bacteria 852
45 Ga0070697_100372884 3300005536 Bacteria 1235
46 Ga0070697_101571144 3300005536 Unclassified 588
47 Ga0070695_100782472 3300005545 Unclassified 763
48 Ga0070696_100613576 3300005546 Bacteria 878
49 Ga0070693_100657914 3300005547 Unclassified 763
50 Ga0070693_100724100 3300005547 Bacteria 731
51 Ga0070693_100984044 3300005547 Bacteria 637
52 Ga0068855_100016865 3300005563 Bacteria 8783
53 Ga0070664_100416177 3300005564 Bacteria 1230
54 Ga0070664_101954767 3300005564 Bacteria 557
55 Ga0068857_100004453 3300005577 Bacteria 11837
56 Ga0068857_100785649 3300005577 Bacteria 908
57 Ga0068857_100985909 3300005577 Bacteria 811
58 Ga0068857_101128522 3300005577 Bacteria 758
59 Ga0068856_100107626 3300005614 Bacteria 2784
60 Ga0068856_100186021 3300005614 Bacteria 2091
61 Ga0068856_101457536 3300005614 Bacteria 699
62 Ga0068856_101718592 3300005614 Bacteria 640
63 Ga0068852_100292537 3300005616 Bacteria 1574
64 Ga0068852_100407994 3300005616 Bacteria 1338
65 Ga0068861_102401493 3300005719 Unclassified 530
66 Ga0068851_10146129 3300005834 Bacteria 1289
67 Ga0068870_10102011 3300005840 Bacteria 1623
68 Ga0068858_100188940 3300005842 Bacteria 1946
69 Ga0068860_100304208 3300005843 Bacteria 1563
70 Ga0068862_100211165 3300005844 Bacteria 1754
71 Ga0081455_10127315 3300005937 Bacteria 1996
72 Ga0081538_10000009 3300005981 Bacteria 172017
73 Ga0081538_10000024 3300005981 Bacteria 130974
74 Ga0081538_10002284 3300005981 Bacteria 18928
75 Ga0081539_10050064 3300005985 Bacteria 2366
76 Ga0070717_11108179 3300006028 Unclassified 721
77 Ga0075364_10463576 3300006051 Bacteria 866
78 Ga0070712_100751139 3300006175 Bacteria 835
79 Ga0097621_100336951 3300006237 Unclassified 1339
80 Ga0097621_100437202 3300006237 Bacteria 1177
81 Ga0097621_101062164 3300006237 Bacteria 759
82 Ga0097621_102056485 3300006237 Unclassified 546
83 Ga0068871_100009717 3300006358 Bacteria 6984
84 Ga0068871_100517846 3300006358 Bacteria 1077
85 Ga0068871_101005844 3300006358 Unclassified 776
86 Ga0075428_100171835 3300006844 Bacteria 2349
87 Ga0075428_100859034 3300006844 Unclassified 963
88 Ga0075430_100468805 3300006846 Bacteria 1039
89 Ga0075431_101389730 3300006847 Bacteria 662
90 Ga0075434_100496034 3300006871 Unclassified 1242
91 Ga0068865_100064709 3300006881 Bacteria 2574
92 Ga0068865_101019680 3300006881 Unclassified 725
93 Ga0105250_10390175 3300009092 Unclassified 616
94 Ga0105240_10000170 3300009093 Bacteria 133127
95 Ga0105240_10026769 3300009093 Bacteria 7563
96 Ga0105240_10252482 3300009093 Bacteria 2039
97 Ga0105240_10641247 3300009093 Bacteria 1165
98 Ga0105245_10007330 3300009098 Bacteria 9659
99 Ga0105245_10012356 3300009098 Bacteria 7430
100 Ga0105247_10722423 3300009101 Unclassified 752
101 Ga0114129_10116448 3300009147 Bacteria 3683
102 Ga0114129_10363848 3300009147 Bacteria 1913
103 Ga0105243_10185096 3300009148 Bacteria 1814
104 Ga0105243_10844104 3300009148 Bacteria 906
105 Ga0105243_10851289 3300009148 Unclassified 903
106 Ga0105243_12154773 3300009148 Bacteria 594
107 Ga0105241_10010351 3300009174 Bacteria 6845
108 Ga0105241_10132197 3300009174 Bacteria 2022
109 Ga0105241_12159247 3300009174 Unclassified 551
110 Ga0105242_11189106 3300009176 Bacteria 781
111 Ga0105242_11672347 3300009176 Unclassified 672
112 Ga0105242_12540730 3300009176 Unclassified 561
113 Ga0105248_10583929 3300009177 Bacteria 1261
114 Ga0105237_10546189 3300009545 Bacteria 1165
115 Ga0105238_10018562 3300009551 Bacteria 7081
116 Ga0105238_10465188 3300009551 Bacteria 1263
117 Ga0105238_11289810 3300009551 Bacteria 756
118 Ga0105249_10231959 3300009553 Bacteria 1821
119 Ga0105249_12387976 3300009553 Unclassified 601
120 Ga0105239_10009062 3300010375 Bacteria 11260
121 Ga0105239_10055036 3300010375 Bacteria 4364
122 Ga0105239_10317786 3300010375 Bacteria 1755
123 Ga0105239_11069094 3300010375 Unclassified 929
124 Ga0105239_11403699 3300010375 Unclassified 806
125 Ga0105239_12471723 3300010375 Unclassified 605
126 Ga0105246_10079034 3300011119 Bacteria 2338
127 Ga0157373_10588729 3300013100 Bacteria 809
128 Ga0157369_11011546 3300013105 Bacteria 851
129 Ga0157374_10052781 3300013296 Bacteria 3788
130 Ga0157374_10283701 3300013296 Bacteria 1635
131 Ga0157378_10083945 3300013297 Bacteria 2883
132 Ga0157378_10724383 3300013297 Unclassified 1016
133 Ga0163162_11276470 3300013306 Unclassified 834
134 Ga0163162_11808447 3300013306 Unclassified 698
135 Ga0157372_10013230 3300013307 Bacteria 8806
136 Ga0157372_10832808 3300013307 Bacteria 1071
137 Ga0163163_10059037 3300014325 Bacteria 3793
138 Ga0163163_10348907 3300014325 Bacteria 1536
139 Ga0163163_10394128 3300014325 Bacteria 1443
140 Ga0163163_11574454 3300014325 Unclassified 718
141 Ga0163163_11753210 3300014325 Bacteria 681
142 Ga0182008_10223462 3300014497 Bacteria 964
143 Ga0157376_10704439 3300014969 Bacteria 1015
144 Ga0163161_11000287 3300017792 Bacteria 714
145 Ga0213876_10078566 3300021384 Bacteria 1744
146 Ga0213875_10063504 3300021388 Bacteria 1726
147 Ga0209050_1000324 3300025298 Bacteria 95696
148 Ga0207656_10097811 3300025321 Bacteria 1342
149 Ga0207692_10834666 3300025898 Unclassified 604
150 Ga0207642_10131163 3300025899 Bacteria 1308
151 Ga0207710_10419636 3300025900 Bacteria 688
152 Ga0207699_10328955 3300025906 Unclassified 1074
153 Ga0207699_10419622 3300025906 Unclassified 955
154 Ga0207654_10017474 3300025911 Bacteria 3750
155 Ga0207654_10638544 3300025911 Unclassified 762
156 Ga0207707_10340885 3300025912 Bacteria 1292
157 Ga0207695_10000208 3300025913 Bacteria 158591
158 Ga0207695_10093913 3300025913 Bacteria 3008
159 Ga0207695_10204906 3300025913 Bacteria 1885
160 Ga0207693_10088374 3300025915 Bacteria 2429
161 Ga0207693_10519513 3300025915 Bacteria 929
162 Ga0207693_10790835 3300025915 Bacteria 731
163 Ga0207663_10396615 3300025916 Unclassified 1054
164 Ga0207663_10664961 3300025916 Bacteria 823
165 Ga0207662_10113731 3300025918 Bacteria 1690
166 Ga0207657_10091567 3300025919 Bacteria 2535
167 Ga0207649_11478397 3300025920 Unclassified 538
168 Ga0207652_10045006 3300025921 Bacteria 3762
169 Ga0207652_10391878 3300025921 Bacteria 1253
170 Ga0207652_10422904 3300025921 Bacteria 1202
171 Ga0207694_10206516 3300025924 Bacteria 1599
172 Ga0207687_10011603 3300025927 Bacteria 5759
173 Ga0207687_10296377 3300025927 Bacteria 1301
174 Ga0207687_10381473 3300025927 Bacteria 1155
175 Ga0207700_11115514 3300025928 Unclassified 705
176 Ga0207664_10391584 3300025929 Unclassified 1235
177 Ga0207644_10278604 3300025931 Bacteria 1342
178 Ga0207690_10023426 3300025932 Bacteria 3852
179 Ga0207690_11800246 3300025932 Bacteria 511
180 Ga0207686_10386786 3300025934 Bacteria 1062
181 Ga0207686_10707213 3300025934 Unclassified 801
182 Ga0207686_11349555 3300025934 Unclassified 586
183 Ga0207670_11120168 3300025936 Unclassified 665
184 Ga0207704_10793299 3300025938 Bacteria 790
185 Ga0207704_10873676 3300025938 Unclassified 755
186 Ga0207711_10344623 3300025941 Bacteria 1379
187 Ga0207689_10062321 3300025942 Bacteria 3066
188 Ga0207661_10132045 3300025944 Bacteria 2140
189 Ga0207661_10407526 3300025944 Bacteria 1233
190 Ga0207679_10209547 3300025945 Bacteria 1633
191 Ga0207679_10599926 3300025945 Bacteria 992
192 Ga0207667_10482009 3300025949 Bacteria 1259
193 Ga0207712_10606000 3300025961 Bacteria 948
194 Ga0207703_10008646 3300026035 Bacteria 8035
195 Ga0207703_12066477 3300026035 Bacteria 546
196 Ga0207702_10146709 3300026078 Bacteria 2142
197 Ga0207702_10429323 3300026078 Unclassified 1279
198 Ga0207702_11347824 3300026078 Unclassified 707
199 Ga0207702_11797295 3300026078 Unclassified 605
200 Ga0207641_10468253 3300026088 Bacteria 1220
201 Ga0207648_10115571 3300026089 Bacteria 2358
202 Ga0207676_10302603 3300026095 Unclassified 1461
203 Ga0207674_10004550 3300026116 Bacteria 16659
204 Ga0207674_10128114 3300026116 Bacteria 2502
205 Ga0207674_10295453 3300026116 Bacteria 1569
206 Ga0207674_10393669 3300026116 Bacteria 1339
207 Ga0207675_100533023 3300026118 Bacteria 1172
208 Ga0207675_100599583 3300026118 Bacteria 1104
209 Ga0207683_10232011 3300026121 Bacteria 1683
210 Ga0207698_10232814 3300026142 Unclassified 1673
211 Ga0207698_11381656 3300026142 Unclassified 719
212 Ga0268265_10426523 3300028380 Bacteria 1233
213 Ga0268265_10729154 3300028380 Bacteria 960
214 Ga0268264_10384454 3300028381 Bacteria 1345
215 Ga0265322_10020043 3300028654 Unclassified 1917
216 Ga0265330_10201820 3300031235 Unclassified 841
217 Ga0265332_10000492 3300031238 Bacteria 27326
218 Ga0265339_10001332 3300031249 Bacteria 18470
219 Ga0265316_10002445 3300031344 Bacteria 19268
220 Ga0265342_10000013 3300031712 Bacteria 202181
221 Ga0265342_10165353 3300031712 Bacteria 1221
222 Ga0316576_10981893 3300031727 Unclassified 602
223 Ga0307405_10400441 3300031731 Bacteria 1074
224 Ga0307405_10608192 3300031731 Bacteria 893
225 Ga0307413_12180750 3300031824 Bacteria 502
226 Ga0307410_10189676 3300031852 Bacteria 1562
227 Ga0307410_11857098 3300031852 Bacteria 536
228 Ga0307406_10044061 3300031901 Bacteria 2795
229 Ga0307412_10445428 3300031911 Bacteria 1065
230 Ga0307409_100280013 3300031995 Bacteria 1541
231 Ga0307409_100826451 3300031995 Bacteria 936
232 Ga0307409_101005013 3300031995 Bacteria 852
233 Ga0307409_101039485 3300031995 Bacteria 838
234 Ga0307409_101409928 3300031995 Bacteria 723
235 Ga0307416_101117860 3300032002 Bacteria 893
236 Ga0307414_10061311 3300032004 Unclassified 2664
237 Ga0307415_100255536 3300032126 Bacteria 1426
238 Ga0307415_100267757 3300032126 Bacteria 1398
239 Ga0316583_10114988 3300032133 Bacteria 938
240 Ga0373944_0094748 3300035089 Bacteria 1002
241 Ga0373945_0091388 3300035116 Unclassified 1179
242 Ga0373945_0314858 3300035116 Bacteria 673
243 Ga0373943_0029386 3300035170 Bacteria 2597
244 Ga0373943_0125019 3300035170 Bacteria 1370
245 Ga0373924_0219657 3300035410 Bacteria 840
246 Ga0373935_0455647 3300035692 Unclassified 924
247 Ga0373947_0101051 3300035725 Bacteria 1813
248 Ga0373925_1288367 3300037068 Bacteria 600
249 Ga0439448_0019009 3300042005 Bacteria 2112
250 Ga0466972_0269177 3300044658 Bacteria 796
251 Ga0466963_0034753 3300044694 Bacteria 3281
252 Ga0466963_0062195 3300044694 Bacteria 2497
253 Ga0466963_0458883 3300044694 Bacteria 899
254 Ga0466963_1264399 3300044694 Bacteria 518
255 Ga0466964_0586570 3300044706 Bacteria 610
256 Ga0453684_0358172 3300044712 Bacteria 1643
257 Ga0453684_0672184 3300044712 Unclassified 1128
258 Ga0453684_1165823 3300044712 Bacteria 811
259 Ga0466968_0042282 3300044735 Bacteria 1927
260 Ga0466957_1116336 3300044842 Bacteria 569
261 Ga0466960_0205864 3300044901 Bacteria 1077
262 Ga0466960_0708976 3300044901 Bacteria 604
263 Ga0466960_0791356 3300044901 Bacteria 574
264 Ga0451576_0071967 3300045051 Unclassified 3598
265 Ga0451576_0220967 3300045051 Bacteria 1978
266 Ga0451576_0288788 3300045051 Bacteria 1715
267 Ga0451576_0381792 3300045051 Bacteria 1477
268 Ga0451576_2470228 3300045051 Unclassified 531
269 Ga0466958_0160339 3300045836 Bacteria 1421
270 Ga0466967_0009386 3300045976 Bacteria 7255
271 Ga0466967_0165508 3300045976 Bacteria 2078
272 Ga0466967_0275773 3300045976 Bacteria 1612
273 Ga0466967_0460018 3300045976 Bacteria 1244
274 Ga0466967_0865426 3300045976 Bacteria 898
275 Ga0466967_0868843 3300045976 Bacteria 896
276 Ga0466967_1168461 3300045976 Bacteria 767
277 Ga0466967_1280908 3300045976 Bacteria 730
278 Ga0466967_1703638 3300045976 Bacteria 628
279 Ga0495629_0615942 3300046459 Bacteria 725
280 Ga0495662_0681033 3300046476 Bacteria 501
281 Ga0495664_0023052 3300046477 Bacteria 3610
282 Ga0495664_0323278 3300046477 Bacteria 930
283 Ga0495628_1209137 3300046516 Bacteria 512
284 Ga0495630_0117336 3300046517 Bacteria 2018
285 Ga0495652_0141052 3300046529 Bacteria 1895
286 Ga0495652_0788576 3300046529 Unclassified 633
287 Ga0495640_0173972 3300046533 Bacteria 1375
288 Ga0495586_0033103 3300046535 Bacteria 2773
289 Ga0495645_0066072 3300046543 Bacteria 2615
290 Ga0495645_0602965 3300046543 Bacteria 675
291 Ga0495656_0686239 3300046615 Bacteria 551
292 Ga0495634_0245027 3300046642 Bacteria 1098
293 Ga0495635_0082534 3300046663 Bacteria 2200
294 Ga0495657_0360566 3300046675 Bacteria 859
295 Ga0495599_0002532 3300046678 Bacteria 10640
296 Ga0495624_0315645 3300046690 Bacteria 942
297 Ga0495600_0554723 3300046809 Unclassified 702
298 Ga0495674_0011546 3300047319 Bacteria 8335
299 Ga0495674_0276530 3300047319 Bacteria 1377
300 Ga0495674_0749722 3300047319 Unclassified 763
301 Ga0495684_0086038 3300047471 Bacteria 2383
302 Ga0495684_0350014 3300047471 Bacteria 1049
303 Ga0496101_1307584 3300048904 Bacteria 567
304 Ga0496104_0938594 3300048907 Bacteria 770
305 Ga0496110_0704994 3300048913 Bacteria 911
306 Ga0496110_1521011 3300048913 Bacteria 579
307 Ga0496110_1712924 3300048913 Bacteria 539
308 Ga0496111_0873231 3300048914 Bacteria 649
309 Ga0496112_0200414 3300048915 Bacteria 1955
310 Ga0496112_0609848 3300048915 Bacteria 1023
311 Ga0496112_0669275 3300048915 Bacteria 967
312 Ga0496112_1439082 3300048915 Bacteria 603
313 Ga0496113_0378083 3300048916 Bacteria 1137
314 Ga0496113_1171929 3300048916 Bacteria 601
315 Ga0496115_0218811 3300048918 Bacteria 1572
316 Ga0501031_0015586 3300049568 Bacteria 4934
317 Ga0501032_0034275 3300049569 Bacteria 3476
318 Ga0501032_0215722 3300049569 Bacteria 1250
319 Ga0501033_0008447 3300049570 Bacteria 7975
320 Ga0501033_0170306 3300049570 Bacteria 1564
321 Ga0501034_0100575 3300049571 Bacteria 2885
322 Ga0501034_1251182 3300049571 Bacteria 620
323 Ga0501036_0011819 3300049572 Bacteria 7236
324 Ga0501036_1705419 3300049572 Bacteria 508
325 Ga0501037_0055749 3300049573 Bacteria 2889
326 Ga0501037_0127046 3300049573 Bacteria 1830
327 Ga0501038_0008589 3300049574 Bacteria 9375
328 Ga0501039_0004911 3300049575 Bacteria 10129
329 Ga0501039_0027585 3300049575 Bacteria 4366
330 Ga0501041_0054257 3300049577 Bacteria 2445
331 Ga0501042_0102631 3300049578 Bacteria 2057
332 Ga0501042_0343672 3300049578 Bacteria 1079
333 Ga0501043_0007732 3300049579 Bacteria 8505
334 Ga0501046_0009004 3300049580 Bacteria 8659
335 Ga0501046_0132636 3300049580 Bacteria 1889
336 Ga0501047_0018584 3300049581 Bacteria 6662
337 Ga0501048_0010956 3300049582 Bacteria 6764
338 Ga0501067_0003802 3300049583 Bacteria 8327
339 Ga0501068_0053439 3300049584 Bacteria 2445
340 Ga0501069_0013050 3300049585 Bacteria 4427
341 Ga0501070_0465996 3300049586 Bacteria 1017
342 Ga0501071_0473673 3300049587 Bacteria 959
343 Ga0501071_0782444 3300049587 Bacteria 735
344 Ga0501072_0210304 3300049588 Bacteria 1550
345 Ga0501072_0603219 3300049588 Bacteria 865
346 Ga0501073_0067329 3300049589 Bacteria 2496
347 Ga0501074_0008665 3300049590 Bacteria 7366
348 Ga0501075_0171175 3300049591 Bacteria 1657
349 Ga0501079_0696688 3300049741 Bacteria 799
350 Ga0501079_1125856 3300049741 Bacteria 618
351 Ga0501080_0023090 3300049742 Bacteria 5767
352 Ga0501083_0017808 3300049744 Bacteria 4956
353 Ga0501035_0017999 3300049822 Bacteria 6514
354 Ga0501044_0015930 3300049823 Bacteria 8089
355 Ga0501045_0033936 3300049824 Bacteria 3703
356 Ga0501045_0057059 3300049824 Bacteria 2857
357 nmdc:mga05p37_129414_c2 3300050507 Bacteria 2743
358 nmdc:mga05p37_293315_c1 3300050507 Bacteria 1281
359 nmdc:mga05p37_557883_c1 3300050507 Bacteria 1302
360 nmdc:mga0qj67_1338682_c1 3300050509 Bacteria 554
361 nmdc:mga06r32_561738_c1 3300050510 Bacteria 1114
362 nmdc:mga06r32_68253_c1 3300050510 Bacteria 3434
363 nmdc:mga0n895_576087_c1 3300050512 Unclassified 1130
364 nmdc:mga0a205_1229698_c1 3300050515 Bacteria 597
365 Ga0495601_0072990 3300053077 Bacteria 2193
366 Ga0495601_0502610 3300053077 Bacteria 782
367 Ga0495612_0098001 3300053078 Bacteria 1246
368 Ga0495619_0150085 3300053085 Bacteria 1608
369 Ga0500556_0000464 3300053104 Bacteria 28558
370 Ga0500616_0002023 3300053153 Bacteria 17895
371 Ga0500599_000602 3300053736 Bacteria 3810
372 Ga0501084_0062264 3300054114 Bacteria 3123
373 Ga0501082_0193163 3300060353 Bacteria 1770
374 Ga0501082_1086772 3300060353 Bacteria 699
375 Ga0466962_0526965 3300061719 Unclassified 599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032133 Ga0316583_10114988 Ga0316583_101149882 105
2 3300046476 Ga0495662_0681033 Ga0495662_0681033_154_486 108
3 iso_pu_bacteria 2675903060 2676494642 110
4 3300005327 Ga0070658_10818248 Ga0070658_108182481 115
5 3300005327 Ga0070658_10885795 Ga0070658_108857952 115
6 3300005329 Ga0070683_100023723 Ga0070683_1000237233 115
7 3300005329 Ga0070683_100946029 Ga0070683_1009460292 115
8 3300005329 Ga0070683_101960586 Ga0070683_1019605862 115
9 3300005334 Ga0068869_100018634 Ga0068869_1000186343 115
10 3300005337 Ga0070682_100295706 Ga0070682_1002957062 115
11 3300005338 Ga0068868_102121159 Ga0068868_1021211591 115
12 3300005339 Ga0070660_100207548 Ga0070660_1002075482 115
13 3300005340 Ga0070689_100940826 Ga0070689_1009408262 115
14 3300005344 Ga0070661_100498928 Ga0070661_1004989281 115
15 3300005347 Ga0070668_101302890 Ga0070668_1013028901 115
16 3300005355 Ga0070671_100180280 Ga0070671_1001802802 115
17 3300005364 Ga0070673_100116271 Ga0070673_1001162711 115
18 3300005365 Ga0070688_100722995 Ga0070688_1007229951 115
19 3300005366 Ga0070659_100041587 Ga0070659_1000415872 115
20 3300005434 Ga0070709_10304772 Ga0070709_103047721 115
21 3300005435 Ga0070714_100089203 Ga0070714_1000892033 115
22 3300005437 Ga0070710_10149142 Ga0070710_101491423 115
23 3300005437 Ga0070710_11021223 Ga0070710_110212231 115
24 3300005439 Ga0070711_100106128 Ga0070711_1001061282 115
25 3300005441 Ga0070700_100168298 Ga0070700_1001682982 115
26 3300005445 Ga0070708_101579592 Ga0070708_1015795921 115
27 3300005458 Ga0070681_10400513 Ga0070681_104005132 115
28 3300005459 Ga0068867_101070865 Ga0068867_1010708651 115
29 3300005535 Ga0070684_100087357 Ga0070684_1000873573 115
30 3300005535 Ga0070684_100854756 Ga0070684_1008547561 115
31 3300005536 Ga0070697_100372884 Ga0070697_1003728842 115
32 3300005545 Ga0070695_100782472 Ga0070695_1007824721 115
33 3300005547 Ga0070693_100657914 Ga0070693_1006579141 115
34 3300005563 Ga0068855_100016865 Ga0068855_1000168653 115
35 3300005564 Ga0070664_100416177 Ga0070664_1004161772 115
36 3300005577 Ga0068857_100004453 Ga0068857_10000445311 115
37 3300005577 Ga0068857_101128522 Ga0068857_1011285222 115
38 3300005614 Ga0068856_100107626 Ga0068856_1001076264 115
39 3300005614 Ga0068856_100186021 Ga0068856_1001860211 115
40 3300005614 Ga0068856_101457536 Ga0068856_1014575362 115
41 3300005616 Ga0068852_100407994 Ga0068852_1004079942 115
42 3300005719 Ga0068861_102401493 Ga0068861_1024014931 115
43 3300005840 Ga0068870_10102011 Ga0068870_101020112 115
44 3300005843 Ga0068860_100304208 Ga0068860_1003042082 115
45 3300006237 Ga0097621_100336951 Ga0097621_1003369512 115
46 3300006237 Ga0097621_100437202 Ga0097621_1004372022 115
47 3300006237 Ga0097621_101062164 Ga0097621_1010621642 115
48 3300006237 Ga0097621_102056485 Ga0097621_1020564851 115
49 3300006358 Ga0068871_100009717 Ga0068871_1000097174 115
50 3300006358 Ga0068871_100517846 Ga0068871_1005178462 115
51 3300006358 Ga0068871_101005844 Ga0068871_1010058442 115
52 3300006881 Ga0068865_100064709 Ga0068865_1000647091 115
53 3300006881 Ga0068865_101019680 Ga0068865_1010196801 115
54 3300009092 Ga0105250_10390175 Ga0105250_103901752 115
55 3300009093 Ga0105240_10026769 Ga0105240_100267694 115
56 3300009093 Ga0105240_10252482 Ga0105240_102524821 115
57 3300009093 Ga0105240_10641247 Ga0105240_106412471 115
58 3300009098 Ga0105245_10007330 Ga0105245_100073307 115
59 3300009098 Ga0105245_10012356 Ga0105245_100123567 115
60 3300009101 Ga0105247_10722423 Ga0105247_107224232 115
61 3300009148 Ga0105243_10185096 Ga0105243_101850962 115
62 3300009148 Ga0105243_10844104 Ga0105243_108441042 115
63 3300009148 Ga0105243_10851289 Ga0105243_108512891 115
64 3300009174 Ga0105241_10010351 Ga0105241_100103512 115
65 3300009174 Ga0105241_10132197 Ga0105241_101321971 115
66 3300009176 Ga0105242_11189106 Ga0105242_111891062 115
67 3300009176 Ga0105242_11672347 Ga0105242_116723472 115
68 3300009176 Ga0105242_12540730 Ga0105242_125407301 115
69 3300009177 Ga0105248_10583929 Ga0105248_105839292 115
70 3300009545 Ga0105237_10546189 Ga0105237_105461892 115
71 3300009551 Ga0105238_10018562 Ga0105238_100185623 115
72 3300009551 Ga0105238_11289810 Ga0105238_112898101 115
73 3300009553 Ga0105249_12387976 Ga0105249_123879761 115
74 3300010375 Ga0105239_10009062 Ga0105239_100090622 115
75 3300010375 Ga0105239_12471723 Ga0105239_124717231 115
76 3300011119 Ga0105246_10079034 Ga0105246_100790343 115
77 3300013100 Ga0157373_10588729 Ga0157373_105887292 115
78 3300013296 Ga0157374_10052781 Ga0157374_100527812 115
79 3300013296 Ga0157374_10283701 Ga0157374_102837012 115
80 3300013297 Ga0157378_10083945 Ga0157378_100839453 115
81 3300013297 Ga0157378_10724383 Ga0157378_107243832 115
82 3300013306 Ga0163162_11276470 Ga0163162_112764702 115
83 3300013307 Ga0157372_10013230 Ga0157372_100132301 115
84 3300014325 Ga0163163_10059037 Ga0163163_100590373 115
85 3300014325 Ga0163163_11574454 Ga0163163_115744541 115
86 3300014969 Ga0157376_10704439 Ga0157376_107044392 115
87 3300017792 Ga0163161_11000287 Ga0163161_110002871 115
88 3300025898 Ga0207692_10834666 Ga0207692_108346662 115
89 3300025899 Ga0207642_10131163 Ga0207642_101311632 115
90 3300025900 Ga0207710_10419636 Ga0207710_104196361 115
91 3300025906 Ga0207699_10328955 Ga0207699_103289552 115
92 3300025911 Ga0207654_10017474 Ga0207654_100174744 115
93 3300025911 Ga0207654_10638544 Ga0207654_106385442 115
94 3300025912 Ga0207707_10340885 Ga0207707_103408852 115
95 3300025913 Ga0207695_10093913 Ga0207695_100939133 115
96 3300025913 Ga0207695_10204906 Ga0207695_102049063 115
97 3300025916 Ga0207663_10396615 Ga0207663_103966152 115
98 3300025919 Ga0207657_10091567 Ga0207657_100915672 115
99 3300025921 Ga0207652_10391878 Ga0207652_103918782 115
100 3300025924 Ga0207694_10206516 Ga0207694_102065162 115
101 3300025927 Ga0207687_10011603 Ga0207687_100116032 115
102 3300025927 Ga0207687_10296377 Ga0207687_102963772 115
103 3300025927 Ga0207687_10381473 Ga0207687_103814731 115
104 3300025928 Ga0207700_11115514 Ga0207700_111155142 115
105 3300025929 Ga0207664_10391584 Ga0207664_103915842 115
106 3300025931 Ga0207644_10278604 Ga0207644_102786042 115
107 3300025932 Ga0207690_10023426 Ga0207690_100234264 115
108 3300025934 Ga0207686_10386786 Ga0207686_103867861 115
109 3300025934 Ga0207686_10707213 Ga0207686_107072132 115
110 3300025941 Ga0207711_10344623 Ga0207711_103446231 115
111 3300025942 Ga0207689_10062321 Ga0207689_100623212 115
112 3300025944 Ga0207661_10407526 Ga0207661_104075262 115
113 3300025945 Ga0207679_10209547 Ga0207679_102095472 115
114 3300025949 Ga0207667_10482009 Ga0207667_104820092 115
115 3300025961 Ga0207712_10606000 Ga0207712_106060002 115
116 3300026035 Ga0207703_12066477 Ga0207703_120664772 115
117 3300026078 Ga0207702_10146709 Ga0207702_101467091 115
118 3300026078 Ga0207702_10429323 Ga0207702_104293232 115
119 3300026078 Ga0207702_11347824 Ga0207702_113478242 115
120 3300026088 Ga0207641_10468253 Ga0207641_104682532 115
121 3300026089 Ga0207648_10115571 Ga0207648_101155712 115
122 3300026116 Ga0207674_10004550 Ga0207674_1000455011 115
123 3300026116 Ga0207674_10295453 Ga0207674_102954532 115
124 3300026118 Ga0207675_100599583 Ga0207675_1005995831 115
125 3300026121 Ga0207683_10232011 Ga0207683_102320112 115
126 3300026142 Ga0207698_11381656 Ga0207698_113816561 115
127 3300028380 Ga0268265_10426523 Ga0268265_104265232 115
128 3300028381 Ga0268264_10384454 Ga0268264_103844542 115
129 3300031712 Ga0265342_10165353 Ga0265342_101653532 115
130 3300045051 Ga0451576_2470228 Ga0451576_2470228_124_474 115
131 3300046529 Ga0495652_0788576 Ga0495652_0788576_218_568 115
132 3300046678 Ga0495599_0002532 Ga0495599_0002532_671_1021 115
133 3300046809 Ga0495600_0554723 Ga0495600_0554723_212_562 115
134 3300047471 Ga0495684_0086038 Ga0495684_0086038_322_672 115
135 3300048915 Ga0496112_0609848 Ga0496112_0609848_109_459 115
136 3300053077 Ga0495601_0502610 Ga0495601_0502610_177_527 115
137 3300005530 Ga0070679_100754348 Ga0070679_1007543482 116
138 3300006844 Ga0075428_100859034 Ga0075428_1008590342 116
139 3300009147 Ga0114129_10116448 Ga0114129_101164482 116
140 3300025920 Ga0207649_11478397 Ga0207649_114783971 116
141 3300042005 Ga0439448_0019009 Ga0439448_0019009_854_1210 116
142 3300050507 nmdc:mga05p37_557883_c1 nmdc:mga05p37_557883_c1_625_981 116
143 3300005536 Ga0070697_101571144 Ga0070697_1015711441 117
144 3300047319 Ga0495674_0749722 Ga0495674_0749722_242_595 117
145 3300003373 JGI25407J50210_10000923 JGI25407J50210_100009232 118
146 3300003791 Ga0055530_10019116 Ga0055530_100191162 118
147 3300005327 Ga0070658_10625175 Ga0070658_106251752 118
148 3300005329 Ga0070683_100551155 Ga0070683_1005511552 118
149 3300005329 Ga0070683_101588106 Ga0070683_1015881061 118
150 3300005329 Ga0070683_102056173 Ga0070683_1020561731 118
151 3300005434 Ga0070709_10004486 Ga0070709_100044866 118
152 3300005434 Ga0070709_10128714 Ga0070709_101287142 118
153 3300005435 Ga0070714_100022410 Ga0070714_1000224104 118
154 3300005436 Ga0070713_100684222 Ga0070713_1006842221 118
155 3300005455 Ga0070663_100616049 Ga0070663_1006160492 118
156 3300005471 Ga0070698_100943960 Ga0070698_1009439601 118
157 3300005530 Ga0070679_100834833 Ga0070679_1008348332 118
158 3300005535 Ga0070684_100024504 Ga0070684_1000245042 118
159 3300005535 Ga0070684_100121260 Ga0070684_1001212604 118
160 3300005535 Ga0070684_100202012 Ga0070684_1002020122 118
161 3300005546 Ga0070696_100613576 Ga0070696_1006135762 118
162 3300005547 Ga0070693_100724100 Ga0070693_1007241001 118
163 3300005547 Ga0070693_100984044 Ga0070693_1009840441 118
164 3300005564 Ga0070664_101954767 Ga0070664_1019547672 118
165 3300005577 Ga0068857_100785649 Ga0068857_1007856491 118
166 3300005577 Ga0068857_100985909 Ga0068857_1009859092 118
167 3300005614 Ga0068856_101718592 Ga0068856_1017185922 118
168 3300005616 Ga0068852_100292537 Ga0068852_1002925372 118
169 3300005834 Ga0068851_10146129 Ga0068851_101461292 118
170 3300005842 Ga0068858_100188940 Ga0068858_1001889402 118
171 3300005844 Ga0068862_100211165 Ga0068862_1002111652 118
172 3300005937 Ga0081455_10127315 Ga0081455_101273153 118
173 3300005981 Ga0081538_10000009 Ga0081538_1000000939 118
174 3300005981 Ga0081538_10000024 Ga0081538_10000024114 118
175 3300005981 Ga0081538_10002284 Ga0081538_100022847 118
176 3300005985 Ga0081539_10050064 Ga0081539_100500642 118
177 3300006028 Ga0070717_11108179 Ga0070717_111081792 118
178 3300006051 Ga0075364_10463576 Ga0075364_104635761 118
179 3300006175 Ga0070712_100751139 Ga0070712_1007511392 118
180 3300006844 Ga0075428_100171835 Ga0075428_1001718354 118
181 3300006846 Ga0075430_100468805 Ga0075430_1004688051 118
182 3300006847 Ga0075431_101389730 Ga0075431_1013897302 118
183 3300006871 Ga0075434_100496034 Ga0075434_1004960342 118
184 3300009093 Ga0105240_10000170 Ga0105240_1000017074 118
185 3300009147 Ga0114129_10363848 Ga0114129_103638483 118
186 3300009148 Ga0105243_12154773 Ga0105243_121547731 118
187 3300009174 Ga0105241_12159247 Ga0105241_121592471 118
188 3300009551 Ga0105238_10465188 Ga0105238_104651882 118
189 3300009553 Ga0105249_10231959 Ga0105249_102319592 118
190 3300010375 Ga0105239_10055036 Ga0105239_100550364 118
191 3300010375 Ga0105239_10317786 Ga0105239_103177862 118
192 3300010375 Ga0105239_11069094 Ga0105239_110690942 118
193 3300010375 Ga0105239_11403699 Ga0105239_114036992 118
194 3300013105 Ga0157369_11011546 Ga0157369_110115461 118
195 3300013306 Ga0163162_11808447 Ga0163162_118084472 118
196 3300013307 Ga0157372_10832808 Ga0157372_108328083 118
197 3300014325 Ga0163163_10348907 Ga0163163_103489072 118
198 3300014325 Ga0163163_10394128 Ga0163163_103941281 118
199 3300014325 Ga0163163_11753210 Ga0163163_117532102 118
200 3300014497 Ga0182008_10223462 Ga0182008_102234621 118
201 3300021384 Ga0213876_10078566 Ga0213876_100785663 118
202 3300021388 Ga0213875_10063504 Ga0213875_100635041 118
203 3300025298 Ga0209050_1000324 Ga0209050_100032428 118
204 3300025321 Ga0207656_10097811 Ga0207656_100978112 118
205 3300025906 Ga0207699_10419622 Ga0207699_104196222 118
206 3300025913 Ga0207695_10000208 Ga0207695_1000020864 118
207 3300025915 Ga0207693_10088374 Ga0207693_100883744 118
208 3300025915 Ga0207693_10519513 Ga0207693_105195131 118
209 3300025915 Ga0207693_10790835 Ga0207693_107908352 118
210 3300025916 Ga0207663_10664961 Ga0207663_106649612 118
211 3300025918 Ga0207662_10113731 Ga0207662_101137313 118
212 3300025921 Ga0207652_10045006 Ga0207652_100450063 118
213 3300025921 Ga0207652_10422904 Ga0207652_104229042 118
214 3300025932 Ga0207690_11800246 Ga0207690_118002461 118
215 3300025934 Ga0207686_11349555 Ga0207686_113495552 118
216 3300025936 Ga0207670_11120168 Ga0207670_111201682 118
217 3300025938 Ga0207704_10793299 Ga0207704_107932992 118
218 3300025938 Ga0207704_10873676 Ga0207704_108736762 118
219 3300025944 Ga0207661_10132045 Ga0207661_101320453 118
220 3300025945 Ga0207679_10599926 Ga0207679_105999262 118
221 3300026035 Ga0207703_10008646 Ga0207703_100086469 118
222 3300026078 Ga0207702_11797295 Ga0207702_117972952 118
223 3300026095 Ga0207676_10302603 Ga0207676_103026032 118
224 3300026116 Ga0207674_10128114 Ga0207674_101281143 118
225 3300026116 Ga0207674_10393669 Ga0207674_103936692 118
226 3300026118 Ga0207675_100533023 Ga0207675_1005330232 118
227 3300026142 Ga0207698_10232814 Ga0207698_102328142 118
228 3300028380 Ga0268265_10729154 Ga0268265_107291542 118
229 3300028654 Ga0265322_10020043 Ga0265322_100200432 118
230 3300031235 Ga0265330_10201820 Ga0265330_102018202 118
231 3300031238 Ga0265332_10000492 Ga0265332_1000049232 118
232 3300031249 Ga0265339_10001332 Ga0265339_100013326 118
233 3300031344 Ga0265316_10002445 Ga0265316_1000244521 118
234 3300031712 Ga0265342_10000013 Ga0265342_10000013151 118
235 3300031727 Ga0316576_10981893 Ga0316576_109818932 118
236 3300031731 Ga0307405_10400441 Ga0307405_104004412 118
237 3300031731 Ga0307405_10608192 Ga0307405_106081922 118
238 3300031824 Ga0307413_12180750 Ga0307413_121807501 118
239 3300031852 Ga0307410_10189676 Ga0307410_101896762 118
240 3300031852 Ga0307410_11857098 Ga0307410_118570981 118
241 3300031901 Ga0307406_10044061 Ga0307406_100440613 118
242 3300031911 Ga0307412_10445428 Ga0307412_104454282 118
243 3300031995 Ga0307409_100280013 Ga0307409_1002800133 118
244 3300031995 Ga0307409_100826451 Ga0307409_1008264512 118
245 3300031995 Ga0307409_101005013 Ga0307409_1010050132 118
246 3300031995 Ga0307409_101039485 Ga0307409_1010394851 118
247 3300031995 Ga0307409_101409928 Ga0307409_1014099282 118
248 3300032002 Ga0307416_101117860 Ga0307416_1011178601 118
249 3300032004 Ga0307414_10061311 Ga0307414_100613111 118
250 3300032126 Ga0307415_100255536 Ga0307415_1002555362 118
251 3300032126 Ga0307415_100267757 Ga0307415_1002677572 118
252 3300035089 Ga0373944_0094748 Ga0373944_0094748_300_665 118
253 3300035116 Ga0373945_0091388 Ga0373945_0091388_367_729 118
254 3300035116 Ga0373945_0314858 Ga0373945_0314858_203_565 118
255 3300035170 Ga0373943_0029386 Ga0373943_0029386_74_436 118
256 3300035170 Ga0373943_0125019 Ga0373943_0125019_90_452 118
257 3300035410 Ga0373924_0219657 Ga0373924_0219657_261_626 118
258 3300035692 Ga0373935_0455647 Ga0373935_0455647_67_429 118
259 3300035725 Ga0373947_0101051 Ga0373947_0101051_484_846 118
260 3300037068 Ga0373925_1288367 Ga0373925_1288367_58_423 118
261 3300044658 Ga0466972_0269177 Ga0466972_0269177_236_598 118
262 3300044694 Ga0466963_0034753 Ga0466963_0034753_114_476 118
263 3300044694 Ga0466963_0062195 Ga0466963_0062195_1559_1918 118
264 3300044694 Ga0466963_0458883 Ga0466963_0458883_311_670 118
265 3300044694 Ga0466963_1264399 Ga0466963_1264399_135_494 118
266 3300044706 Ga0466964_0586570 Ga0466964_0586570_109_468 118
267 3300044712 Ga0453684_0358172 Ga0453684_0358172_51_419 118
268 3300044712 Ga0453684_0672184 Ga0453684_0672184_472_834 118
269 3300044712 Ga0453684_1165823 Ga0453684_1165823_190_552 118
270 3300044735 Ga0466968_0042282 Ga0466968_0042282_1001_1363 118
271 3300044842 Ga0466957_1116336 Ga0466957_1116336_102_464 118
272 3300044901 Ga0466960_0205864 Ga0466960_0205864_434_793 118
273 3300044901 Ga0466960_0708976 Ga0466960_0708976_15_374 118
274 3300044901 Ga0466960_0791356 Ga0466960_0791356_34_399 118
275 3300045051 Ga0451576_0071967 Ga0451576_0071967_2001_2363 118
276 3300045051 Ga0451576_0220967 Ga0451576_0220967_444_806 118
277 3300045051 Ga0451576_0288788 Ga0451576_0288788_471_833 118
278 3300045051 Ga0451576_0381792 Ga0451576_0381792_700_1062 118
279 3300045836 Ga0466958_0160339 Ga0466958_0160339_750_1112 118
280 3300045976 Ga0466967_0009386 Ga0466967_0009386_3161_3520 118
281 3300045976 Ga0466967_0165508 Ga0466967_0165508_1631_1987 118
282 3300045976 Ga0466967_0275773 Ga0466967_0275773_825_1187 118
283 3300045976 Ga0466967_0460018 Ga0466967_0460018_277_639 118
284 3300045976 Ga0466967_0865426 Ga0466967_0865426_416_778 118
285 3300045976 Ga0466967_0868843 Ga0466967_0868843_170_532 118
286 3300045976 Ga0466967_1168461 Ga0466967_1168461_29_388 118
287 3300045976 Ga0466967_1280908 Ga0466967_1280908_171_533 118
288 3300045976 Ga0466967_1703638 Ga0466967_1703638_254_616 118
289 3300046459 Ga0495629_0615942 Ga0495629_0615942_169_534 118
290 3300046477 Ga0495664_0023052 Ga0495664_0023052_1593_1955 118
291 3300046477 Ga0495664_0323278 Ga0495664_0323278_493_855 118
292 3300046516 Ga0495628_1209137 Ga0495628_1209137_18_380 118
293 3300046517 Ga0495630_0117336 Ga0495630_0117336_290_652 118
294 3300046529 Ga0495652_0141052 Ga0495652_0141052_1337_1699 118
295 3300046533 Ga0495640_0173972 Ga0495640_0173972_647_1009 118
296 3300046535 Ga0495586_0033103 Ga0495586_0033103_351_713 118
297 3300046543 Ga0495645_0066072 Ga0495645_0066072_2178_2540 118
298 3300046543 Ga0495645_0602965 Ga0495645_0602965_142_504 118
299 3300046615 Ga0495656_0686239 Ga0495656_0686239_50_406 118
300 3300046642 Ga0495634_0245027 Ga0495634_0245027_107_469 118
301 3300046663 Ga0495635_0082534 Ga0495635_0082534_1799_2164 118
302 3300046675 Ga0495657_0360566 Ga0495657_0360566_449_814 118
303 3300046690 Ga0495624_0315645 Ga0495624_0315645_187_552 118
304 3300047319 Ga0495674_0011546 Ga0495674_0011546_3739_4101 118
305 3300047319 Ga0495674_0276530 Ga0495674_0276530_413_778 118
306 3300047471 Ga0495684_0350014 Ga0495684_0350014_366_731 118
307 3300048904 Ga0496101_1307584 Ga0496101_1307584_76_435 118
308 3300048907 Ga0496104_0938594 Ga0496104_0938594_45_401 118
309 3300048913 Ga0496110_0704994 Ga0496110_0704994_354_710 118
310 3300048913 Ga0496110_1521011 Ga0496110_1521011_177_533 118
311 3300048913 Ga0496110_1712924 Ga0496110_1712924_22_384 118
312 3300048914 Ga0496111_0873231 Ga0496111_0873231_227_583 118
313 3300048915 Ga0496112_0200414 Ga0496112_0200414_1172_1531 118
314 3300048915 Ga0496112_0669275 Ga0496112_0669275_523_879 118
315 3300048915 Ga0496112_1439082 Ga0496112_1439082_66_428 118
316 3300048916 Ga0496113_0378083 Ga0496113_0378083_625_981 118
317 3300048916 Ga0496113_1171929 Ga0496113_1171929_70_432 118
318 3300048918 Ga0496115_0218811 Ga0496115_0218811_194_559 118
319 3300049568 Ga0501031_0015586 Ga0501031_0015586_316_678 118
320 3300049569 Ga0501032_0034275 Ga0501032_0034275_2197_2559 118
321 3300049569 Ga0501032_0215722 Ga0501032_0215722_721_1083 118
322 3300049570 Ga0501033_0008447 Ga0501033_0008447_4682_5044 118
323 3300049570 Ga0501033_0170306 Ga0501033_0170306_1021_1383 118
324 3300049571 Ga0501034_0100575 Ga0501034_0100575_2422_2784 118
325 3300049571 Ga0501034_1251182 Ga0501034_1251182_23_385 118
326 3300049572 Ga0501036_0011819 Ga0501036_0011819_317_679 118
327 3300049572 Ga0501036_1705419 Ga0501036_1705419_27_386 118
328 3300049573 Ga0501037_0055749 Ga0501037_0055749_2422_2784 118
329 3300049573 Ga0501037_0127046 Ga0501037_0127046_317_679 118
330 3300049574 Ga0501038_0008589 Ga0501038_0008589_8698_9060 118
331 3300049575 Ga0501039_0004911 Ga0501039_0004911_3926_4288 118
332 3300049575 Ga0501039_0027585 Ga0501039_0027585_338_700 118
333 3300049577 Ga0501041_0054257 Ga0501041_0054257_947_1309 118
334 3300049578 Ga0501042_0102631 Ga0501042_0102631_327_689 118
335 3300049578 Ga0501042_0343672 Ga0501042_0343672_384_743 118
336 3300049579 Ga0501043_0007732 Ga0501043_0007732_1679_2041 118
337 3300049580 Ga0501046_0009004 Ga0501046_0009004_3616_3978 118
338 3300049580 Ga0501046_0132636 Ga0501046_0132636_73_435 118
339 3300049581 Ga0501047_0018584 Ga0501047_0018584_685_1047 118
340 3300049582 Ga0501048_0010956 Ga0501048_0010956_317_679 118
341 3300049583 Ga0501067_0003802 Ga0501067_0003802_4536_4898 118
342 3300049584 Ga0501068_0053439 Ga0501068_0053439_1542_1904 118
343 3300049585 Ga0501069_0013050 Ga0501069_0013050_174_536 118
344 3300049586 Ga0501070_0465996 Ga0501070_0465996_312_674 118
345 3300049587 Ga0501071_0473673 Ga0501071_0473673_230_592 118
346 3300049587 Ga0501071_0782444 Ga0501071_0782444_191_553 118
347 3300049588 Ga0501072_0210304 Ga0501072_0210304_677_1039 118
348 3300049588 Ga0501072_0603219 Ga0501072_0603219_371_733 118
349 3300049589 Ga0501073_0067329 Ga0501073_0067329_642_1004 118
350 3300049590 Ga0501074_0008665 Ga0501074_0008665_2110_2472 118
351 3300049591 Ga0501075_0171175 Ga0501075_0171175_827_1189 118
352 3300049741 Ga0501079_0696688 Ga0501079_0696688_318_680 118
353 3300049741 Ga0501079_1125856 Ga0501079_1125856_38_400 118
354 3300049742 Ga0501080_0023090 Ga0501080_0023090_1402_1764 118
355 3300049744 Ga0501083_0017808 Ga0501083_0017808_1038_1400 118
356 3300049822 Ga0501035_0017999 Ga0501035_0017999_3651_4013 118
357 3300049823 Ga0501044_0015930 Ga0501044_0015930_6817_7179 118
358 3300049824 Ga0501045_0033936 Ga0501045_0033936_891_1247 118
359 3300049824 Ga0501045_0057059 Ga0501045_0057059_2168_2530 118
360 3300050507 nmdc:mga05p37_129414_c2 nmdc:mga05p37_129414_c2_1008_1370 118
361 3300050507 nmdc:mga05p37_293315_c1 nmdc:mga05p37_293315_c1_837_1196 118
362 3300050509 nmdc:mga0qj67_1338682_c1 nmdc:mga0qj67_1338682_c1_111_473 118
363 3300050510 nmdc:mga06r32_561738_c1 nmdc:mga06r32_561738_c1_78_440 118
364 3300050510 nmdc:mga06r32_68253_c1 nmdc:mga06r32_68253_c1_2969_3328 118
365 3300050512 nmdc:mga0n895_576087_c1 nmdc:mga0n895_576087_c1_421_783 118
366 3300050515 nmdc:mga0a205_1229698_c1 nmdc:mga0a205_1229698_c1_180_542 118
367 3300053077 Ga0495601_0072990 Ga0495601_0072990_59_421 118
368 3300053078 Ga0495612_0098001 Ga0495612_0098001_570_932 118
369 3300053085 Ga0495619_0150085 Ga0495619_0150085_546_911 118
370 3300053104 Ga0500556_0000464 Ga0500556_0000464_6157_6567 118
371 3300053153 Ga0500616_0002023 Ga0500616_0002023_6157_6519 118
372 3300053736 Ga0500599_000602 Ga0500599_000602_3341_3703 118
373 3300054114 Ga0501084_0062264 Ga0501084_0062264_676_1038 118
374 3300060353 Ga0501082_0193163 Ga0501082_0193163_120_482 118
375 3300060353 Ga0501082_1086772 Ga0501082_1086772_38_400 118
376 3300061719 Ga0466962_0526965 Ga0466962_0526965_87_449 118

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.921 32 106
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8978 35 105
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8975 33 107
7uv9-assembly1.cif.gz_K kdm2a-nucleosome structure stabilized by h3k36c-unc8015 covalent conjugate 0.8974 33 108
7uva-assembly2.cif.gz_D crystal structure of kdm2a histone demethylase catalytic domain in complex with an h3c36 peptide modified by unc8015 0.8941 35 109
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9416 32 106 2.60.120.10
af_O06194_5_109_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9073 19 108 2.60.120.10
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9063 52 101 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9037 33 112 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9006 36 118 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7C3JX00-F1-model_v4 Cupin domain-containing protein 0.9984 1 118
AF-A0A2V8UH96-F1-model_v4 Cupin 0.9935 11 118
AF-Q2IDL1-F1-model_v4 Cupin domain protein 0.9925 1 118
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.9924 1 118
AF-A0A812XGP2-F1-model_v4 deleted 0.9921 1 116

Feature Viewer

pLDDT pTM Quality
95.84 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map