F427437

General Info

Members Datasets Scaffolds Average Seq Length
376 223 365 288

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0003611|Ga0466963_0003611_1928_2896
Length 322
Sequence MALKREEAHGRGHLATRKLTIIVRRVFREIAMPDVRPRRSVLYMPGANTRALEKARTLPADALIFDLEDAVAPDAKEAARANVVAAAKSKSYGKREIAIRCNGLMTPWGKADVAAIAESGADAILVPKVESAGDVAAIVAALEGAGAPKSMAVWAMMETPMGVLRAEEIAAAHKRLRLFVMGTNDLVKDMRARHTPMRLPMITALGIGMLAARAHGLTILDGVYNDIQDTEGFRAVCQQGVEMGFDGKTLIHPSQIEPCNEIFAPSSSELEMAGKIVAAFKAAQAEGKGVVTVDGRMIENLHVEQAERALALAAAIRELQAA

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
3 2619618881 Frankia sp. ACN1ag Isolate Unclassified
4 2619619003 Frankia sp. CpI1-P Isolate Nodule
5 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
6 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
7 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
8 2902330777 Methylobacterium sp. 2A Isolate Unclassified
9 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
10 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
146 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
215 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.97
Nodule 0.53
Rhizoplane 2.13
Rhizosphere 81.91
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10018849 3300003203 Bacteria 2826
2 Ga0070658_10000728 3300005327 Bacteria 28408
3 Ga0070683_100049430 3300005329 Bacteria 3890
4 Ga0070680_100000091 3300005336 Bacteria 50978
5 Ga0070680_100006249 3300005336 Bacteria 9034
6 Ga0068868_100248073 3300005338 Bacteria 1498
7 Ga0070660_100037000 3300005339 Bacteria 3699
8 Ga0070689_100007960 3300005340 Bacteria 7438
9 Ga0070689_100313407 3300005340 Bacteria 1308
10 Ga0070689_100314327 3300005340 Bacteria 1307
11 Ga0070691_10000688 3300005341 Bacteria 13178
12 Ga0070661_100012271 3300005344 Bacteria 5991
13 Ga0070668_100161052 3300005347 Bacteria 1821
14 Ga0070671_100033915 3300005355 Bacteria 4224
15 Ga0070671_100355341 3300005355 Bacteria 1251
16 Ga0070671_100536906 3300005355 Bacteria 1008
17 Ga0070688_100063067 3300005365 Bacteria 2347
18 Ga0070667_100081559 3300005367 Bacteria 2769
19 Ga0070667_100104498 3300005367 Bacteria 2450
20 Ga0070703_10003354 3300005406 Bacteria 4569
21 Ga0070705_100000073 3300005440 Bacteria 54248
22 Ga0070694_100002583 3300005444 Bacteria 10700
23 Ga0070663_100034861 3300005455 Bacteria 3488
24 Ga0070678_100119029 3300005456 Bacteria 2080
25 Ga0070678_100480920 3300005456 Bacteria 1093
26 Ga0068867_100026169 3300005459 Bacteria 4188
27 Ga0070706_100111703 3300005467 Bacteria 2543
28 Ga0070698_100002891 3300005471 Bacteria 18906
29 Ga0070699_100002173 3300005518 Bacteria 17753
30 Ga0070699_100066383 3300005518 Bacteria 3132
31 Ga0070679_100173725 3300005530 Bacteria 2127
32 Ga0070684_100043014 3300005535 Bacteria 3901
33 Ga0068853_100344628 3300005539 Bacteria 1385
34 Ga0070686_100060378 3300005544 Bacteria 2446
35 Ga0070665_100008670 3300005548 Bacteria 10290
36 Ga0070665_100087465 3300005548 Bacteria 3121
37 Ga0070665_100368319 3300005548 Bacteria 1443
38 Ga0070665_100444286 3300005548 Bacteria 1306
39 Ga0070704_100007557 3300005549 Bacteria 6473
40 Ga0068855_100020471 3300005563 Bacteria 7932
41 Ga0070664_100021927 3300005564 Bacteria 5266
42 Ga0068857_100025122 3300005577 Bacteria 5247
43 Ga0068857_100025571 3300005577 Bacteria 5198
44 Ga0068857_100085409 3300005577 Bacteria 2821
45 Ga0068856_100030337 3300005614 Bacteria 5285
46 Ga0068856_100466255 3300005614 Bacteria 1284
47 Ga0068852_100010363 3300005616 Bacteria 6963
48 Ga0068859_100354799 3300005617 Bacteria 1561
49 Ga0068864_100030240 3300005618 Bacteria 4590
50 Ga0068866_10022214 3300005718 Bacteria 2934
51 Ga0068861_100236515 3300005719 Bacteria 1552
52 Ga0068858_100000002 3300005842 Bacteria 351633
53 Ga0068860_100078470 3300005843 Bacteria 3140
54 Ga0068860_100083297 3300005843 Bacteria 3042
55 Ga0068860_100092677 3300005843 Bacteria 2879
56 Ga0068860_100099059 3300005843 Bacteria 2780
57 Ga0068862_100035199 3300005844 Bacteria 4238
58 Ga0068862_100072218 3300005844 Bacteria 2981
59 Ga0068862_100144396 3300005844 Bacteria 2114
60 Ga0081455_10000113 3300005937 Bacteria 92043
61 Ga0081455_10000366 3300005937 Bacteria 59625
62 Ga0081455_10001078 3300005937 Bacteria 34350
63 Ga0081455_10001606 3300005937 Bacteria 27604
64 Ga0081538_10000383 3300005981 Bacteria 50305
65 Ga0081538_10002120 3300005981 Bacteria 19776
66 Ga0081538_10060230 3300005981 Bacteria 2186
67 Ga0081539_10000797 3300005985 Bacteria 61227
68 Ga0081539_10041354 3300005985 Bacteria 2695
69 Ga0081539_10059738 3300005985 Bacteria 2097
70 Ga0075365_10000350 3300006038 Bacteria 16540
71 Ga0075365_10039799 3300006038 Bacteria 3063
72 Ga0075365_10083684 3300006038 Bacteria 2164
73 Ga0075363_100177587 3300006048 Bacteria 1210
74 Ga0075363_100204154 3300006048 Bacteria 1130
75 Ga0075364_10006622 3300006051 Bacteria 6824
76 Ga0075364_10046475 3300006051 Bacteria 2827
77 Ga0075364_10163413 3300006051 Bacteria 1503
78 Ga0075364_10248715 3300006051 Bacteria 1208
79 Ga0075362_10011970 3300006177 Bacteria 3431
80 Ga0075362_10019497 3300006177 Bacteria 2822
81 Ga0075362_10025047 3300006177 Bacteria 2535
82 Ga0075367_10011125 3300006178 Bacteria 4747
83 Ga0075367_10017128 3300006178 Bacteria 3972
84 Ga0075367_10088805 3300006178 Bacteria 1879
85 Ga0075367_10116653 3300006178 Bacteria 1642
86 Ga0075367_10132770 3300006178 Bacteria 1539
87 Ga0075369_10064866 3300006186 Bacteria 1600
88 Ga0075366_10023944 3300006195 Bacteria 3558
89 Ga0075366_10101130 3300006195 Bacteria 1730
90 Ga0068871_100061647 3300006358 Bacteria 3064
91 Ga0075428_100587807 3300006844 Bacteria 1189
92 Ga0075430_100002545 3300006846 Bacteria 15206
93 Ga0075430_100010379 3300006846 Bacteria 7888
94 Ga0075431_100000604 3300006847 Bacteria 30340
95 Ga0075431_100008036 3300006847 Bacteria 10526
96 Ga0075429_100004337 3300006880 Bacteria 12182
97 Ga0075429_100020110 3300006880 Bacteria 5790
98 Ga0097620_100354795 3300006931 Bacteria 1561
99 Ga0099794_10019581 3300007265 Bacteria 3052
100 Ga0099794_10177139 3300007265 Bacteria 1088
101 Ga0105251_10014909 3300009011 Bacteria 4269
102 Ga0111539_10001574 3300009094 Bacteria 30375
103 Ga0111539_10151991 3300009094 Bacteria 2710
104 Ga0105245_10364811 3300009098 Bacteria 1434
105 Ga0105245_10434580 3300009098 Bacteria 1318
106 Ga0105247_10000255 3300009101 Bacteria 49266
107 Ga0114129_10027792 3300009147 Bacteria 8010
108 Ga0114129_10617005 3300009147 Bacteria 1403
109 Ga0105243_10004690 3300009148 Bacteria 10760
110 Ga0105248_10000437 3300009177 Bacteria 47405
111 Ga0105248_10044317 3300009177 Bacteria 4990
112 Ga0105237_10151653 3300009545 Bacteria 2314
113 Ga0105238_10047499 3300009551 Bacteria 4327
114 Ga0105238_10452995 3300009551 Bacteria 1280
115 Ga0105238_10505201 3300009551 Bacteria 1210
116 Ga0105249_10109506 3300009553 Bacteria 2609
117 Ga0105249_10159144 3300009553 Bacteria 2181
118 Ga0105249_10849297 3300009553 Bacteria 978
119 Ga0105035_104042 3300009988 Bacteria 1153
120 Ga0105239_10194391 3300010375 Bacteria 2272
121 Ga0157370_10351313 3300013104 Bacteria 1359
122 Ga0157369_10058197 3300013105 Bacteria 4169
123 Ga0157378_10008639 3300013297 Bacteria 8865
124 Ga0163162_10253830 3300013306 Bacteria 1890
125 Ga0157372_10156171 3300013307 Bacteria 2635
126 Ga0157375_10534680 3300013308 Bacteria 1335
127 Ga0157375_10935932 3300013308 Bacteria 1009
128 Ga0163163_10044785 3300014325 Bacteria 4341
129 Ga0157380_10314660 3300014326 Bacteria 1449
130 Ga0157379_10000003 3300014968 Bacteria 174612
131 Ga0157379_10093440 3300014968 Bacteria 2699
132 Ga0157376_10476472 3300014969 Bacteria 1222
133 Ga0207653_10000357 3300025885 Bacteria 22222
134 Ga0207692_10021848 3300025898 Bacteria 2935
135 Ga0207710_10000130 3300025900 Bacteria 90509
136 Ga0207647_10056243 3300025904 Bacteria 2414
137 Ga0207705_10007497 3300025909 Bacteria 8017
138 Ga0207707_10003240 3300025912 Bacteria 14452
139 Ga0207695_10016537 3300025913 Bacteria 8625
140 Ga0207693_10133081 3300025915 Bacteria 1954
141 Ga0207660_10000899 3300025917 Bacteria 19552
142 Ga0207660_10046651 3300025917 Bacteria 3058
143 Ga0207662_10029574 3300025918 Bacteria 3175
144 Ga0207657_10045244 3300025919 Bacteria 3864
145 Ga0207657_10148087 3300025919 Bacteria 1914
146 Ga0207652_10001862 3300025921 Bacteria 18331
147 Ga0207652_10041685 3300025921 Bacteria 3904
148 Ga0207694_10104395 3300025924 Bacteria 2248
149 Ga0207706_10136256 3300025933 Bacteria 2160
150 Ga0207686_10038965 3300025934 Bacteria 2880
151 Ga0207670_10022293 3300025936 Bacteria 3923
152 Ga0207670_10116243 3300025936 Bacteria 1936
153 Ga0207691_10189449 3300025940 Bacteria 1794
154 Ga0207691_10281686 3300025940 Bacteria 1430
155 Ga0207711_10000630 3300025941 Bacteria 35360
156 Ga0207679_10019267 3300025945 Bacteria 4582
157 Ga0207667_10033369 3300025949 Bacteria 5534
158 Ga0207667_10097344 3300025949 Bacteria 3037
159 Ga0207667_10515135 3300025949 Bacteria 1212
160 Ga0207712_10008410 3300025961 Bacteria 6521
161 Ga0207712_10186583 3300025961 Bacteria 1633
162 Ga0207668_10179039 3300025972 Bacteria 1670
163 Ga0207640_10104856 3300025981 Bacteria 1991
164 Ga0207658_10087017 3300025986 Bacteria 2412
165 Ga0207703_10000001 3300026035 Bacteria 822925
166 Ga0207639_10345696 3300026041 Bacteria 1327
167 Ga0207678_10030706 3300026067 Bacteria 4692
168 Ga0207702_10033708 3300026078 Bacteria 4278
169 Ga0207702_10334357 3300026078 Bacteria 1446
170 Ga0207641_10491494 3300026088 Bacteria 1191
171 Ga0207676_10031420 3300026095 Bacteria 3994
172 Ga0207674_10030070 3300026116 Bacteria 5714
173 Ga0207674_10031769 3300026116 Bacteria 5543
174 Ga0207674_10168093 3300026116 Bacteria 2147
175 Ga0207675_100091086 3300026118 Bacteria 2867
176 Ga0207675_100454984 3300026118 Bacteria 1269
177 Ga0207683_10024224 3300026121 Bacteria 5225
178 Ga0207698_10267398 3300026142 Bacteria 1574
179 Ga0209813_10013121 3300027866 Bacteria 2205
180 Ga0207428_10087925 3300027907 Bacteria 2417
181 Ga0268266_10003146 3300028379 Bacteria 16766
182 Ga0268266_10075267 3300028379 Bacteria 2933
183 Ga0268266_10203861 3300028379 Bacteria 1811
184 Ga0268266_10272982 3300028379 Bacteria 1570
185 Ga0268265_10007918 3300028380 Bacteria 7172
186 Ga0268265_10032026 3300028380 Bacteria 3804
187 Ga0268264_10019138 3300028381 Bacteria 5598
188 Ga0268264_10061702 3300028381 Bacteria 3146
189 Ga0268264_10379706 3300028381 Bacteria 1353
190 Ga0265334_10029159 3300028573 Bacteria 2213
191 Ga0265338_10102373 3300028800 Bacteria 2329
192 Ga0265327_10000940 3300031251 Bacteria 42631
193 Ga0265327_10047870 3300031251 Bacteria 2252
194 Ga0307408_100542082 3300031548 Bacteria 1025
195 Ga0307508_10090298 3300031616 Bacteria 2650
196 Ga0316576_10048872 3300031727 Bacteria 3070
197 Ga0316576_10170355 3300031727 Bacteria 1643
198 Ga0373943_0038715 3300035170 Bacteria 2294
199 Ga0316574_0011828 3300035398 Bacteria 4972
200 Ga0316574_0045500 3300035398 Bacteria 2718
201 Ga0316574_0062633 3300035398 Bacteria 2338
202 Ga0373931_0133451 3300035691 Bacteria 1431
203 Ga0373927_0323277 3300035695 Bacteria 1016
204 Ga0316584_0301937 3300036712 Bacteria 1159
205 Ga0373925_0048898 3300037068 Bacteria 3152
206 Ga0373925_0160792 3300037068 Bacteria 1769
207 Ga0395899_0004593 3300037312 Bacteria 10764
208 Ga0395899_0052745 3300037312 Bacteria 3013
209 Ga0395899_0070083 3300037312 Bacteria 2566
210 Ga0395900_0021022 3300037418 Bacteria 6669
211 Ga0395900_0049326 3300037418 Bacteria 4337
212 Ga0395898_0016486 3300037466 Bacteria 7557
213 Ga0395901_0011815 3300038443 Bacteria 8853
214 Ga0395901_0098073 3300038443 Bacteria 3072
215 Ga0395901_0193009 3300038443 Bacteria 2135
216 Ga0400485_05646 3300038735 Bacteria 3779
217 Ga0400483_131890 3300039062 Bacteria 3294
218 Ga0400483_234363 3300039062 Bacteria 16271
219 Ga0436360_0681478 3300039438 Bacteria 11585
220 Ga0436361_0046963 3300039447 Bacteria 1938
221 Ga0439460_0004791 3300042461 Bacteria 3303
222 Ga0451577_0008487 3300042876 Bacteria 10000
223 Ga0466963_0003611 3300044694 Bacteria 8890
224 Ga0453684_0002246 3300044712 Bacteria 47929
225 Ga0466957_0095987 3300044842 Bacteria 1862
226 Ga0466958_0363904 3300045836 Bacteria 932
227 Ga0466967_0032140 3300045976 Bacteria 4427
228 Ga0495585_0195531 3300046492 Bacteria 1032
229 Ga0495640_0069692 3300046533 Bacteria 2365
230 Ga0495686_0000065 3300047472 Bacteria 225907
231 Ga0496100_0328492 3300048903 Bacteria 1151
232 Ga0496102_0016781 3300048905 Bacteria 6404
233 Ga0496104_0380718 3300048907 Bacteria 1324
234 Ga0496105_0035340 3300048908 Bacteria 4113
235 Ga0496106_0001324 3300048909 Bacteria 18564
236 Ga0496107_0022529 3300048910 Bacteria 4451
237 Ga0496110_0565456 3300048913 Bacteria 1033
238 Ga0496112_0130715 3300048915 Bacteria 2482
239 Ga0496119_0002250 3300048922 Bacteria 21471
240 Ga0496120_0000779 3300048923 Bacteria 46103
241 Ga0496125_0012847 3300048928 Bacteria 8274
242 Ga0501032_0001190 3300049569 Bacteria 20854
243 Ga0501032_0120605 3300049569 Bacteria 1734
244 Ga0501033_0036461 3300049570 Bacteria 3685
245 Ga0501033_0042524 3300049570 Bacteria 3388
246 Ga0501034_0009446 3300049571 Bacteria 10206
247 Ga0501034_0030291 3300049571 Bacteria 5500
248 Ga0501034_0145271 3300049571 Bacteria 2349
249 Ga0501036_0010076 3300049572 Bacteria 7788
250 Ga0501038_0007253 3300049574 Bacteria 10235
251 Ga0501038_0063979 3300049574 Bacteria 3138
252 Ga0501038_0112818 3300049574 Bacteria 2250
253 Ga0501039_0001475 3300049575 Bacteria 17280
254 Ga0501039_0005016 3300049575 Bacteria 10048
255 Ga0501039_0042080 3300049575 Bacteria 3530
256 Ga0501039_0167069 3300049575 Bacteria 1730
257 Ga0501040_0026921 3300049576 Bacteria 3869
258 Ga0501040_0055261 3300049576 Bacteria 2722
259 Ga0501040_0069480 3300049576 Bacteria 2429
260 Ga0501041_0003397 3300049577 Bacteria 9164
261 Ga0501041_0004555 3300049577 Bacteria 8043
262 Ga0501041_0076688 3300049577 Bacteria 2056
263 Ga0501041_0138710 3300049577 Bacteria 1516
264 Ga0501042_0104280 3300049578 Bacteria 2040
265 Ga0501043_0133110 3300049579 Bacteria 1948
266 Ga0501046_0035655 3300049580 Bacteria 4008
267 Ga0501046_0047197 3300049580 Bacteria 3415
268 Ga0501047_0000029 3300049581 Bacteria 218396
269 Ga0501047_0006210 3300049581 Bacteria 11232
270 Ga0501047_0367681 3300049581 Bacteria 1273
271 Ga0501047_0492870 3300049581 Bacteria 1052
272 Ga0501048_0029675 3300049582 Bacteria 3965
273 Ga0501048_0157732 3300049582 Bacteria 1605
274 Ga0501048_0165556 3300049582 Bacteria 1565
275 Ga0501067_0013327 3300049583 Bacteria 4552
276 Ga0501068_0000179 3300049584 Bacteria 29767
277 Ga0501068_0009002 3300049584 Bacteria 5571
278 Ga0501069_0000887 3300049585 Bacteria 14268
279 Ga0501069_0001553 3300049585 Bacteria 11349
280 Ga0501069_0317006 3300049585 Bacteria 916
281 Ga0501070_0001336 3300049586 Bacteria 22017
282 Ga0501070_0109718 3300049586 Bacteria 2280
283 Ga0501071_0031737 3300049587 Bacteria 3747
284 Ga0501071_0051166 3300049587 Bacteria 2976
285 Ga0501071_0116213 3300049587 Bacteria 1980
286 Ga0501071_0211677 3300049587 Bacteria 1458
287 Ga0501071_0385994 3300049587 Bacteria 1068
288 Ga0501072_0000018 3300049588 Bacteria 158735
289 Ga0501072_0011262 3300049588 Bacteria 6829
290 Ga0501072_0014473 3300049588 Bacteria 6045
291 Ga0501072_0027086 3300049588 Bacteria 4472
292 Ga0501072_0052970 3300049588 Bacteria 3195
293 Ga0501073_0024313 3300049589 Bacteria 4349
294 Ga0501074_0007564 3300049590 Bacteria 7858
295 Ga0501074_0011011 3300049590 Bacteria 6565
296 Ga0501075_0013053 3300049591 Bacteria 5921
297 Ga0501075_0019634 3300049591 Bacteria 4905
298 Ga0501076_0009946 3300049592 Bacteria 7032
299 Ga0501076_0047923 3300049592 Bacteria 3378
300 Ga0501077_0002505 3300049593 Bacteria 10997
301 Ga0501077_0007243 3300049593 Bacteria 6843
302 Ga0501077_0021299 3300049593 Bacteria 4101
303 Ga0501079_0006171 3300049741 Bacteria 8988
304 Ga0501079_0007348 3300049741 Bacteria 8329
305 Ga0501079_0029987 3300049741 Bacteria 4178
306 Ga0501080_0046271 3300049742 Bacteria 4051
307 Ga0501080_0662210 3300049742 Bacteria 923
308 Ga0501081_0028774 3300049743 Bacteria 3751
309 Ga0501081_0031354 3300049743 Bacteria 3603
310 Ga0501083_0000827 3300049744 Bacteria 20290
311 Ga0501083_0000887 3300049744 Bacteria 19810
312 Ga0501083_0059633 3300049744 Bacteria 2552
313 Ga0501263_000845 3300049760 Bacteria 2612
314 Ga0501035_0091893 3300049822 Bacteria 2671
315 Ga0501044_0031046 3300049823 Bacteria 5626
316 Ga0501044_0327971 3300049823 Bacteria 1454
317 Ga0501045_0005503 3300049824 Bacteria 8761
318 Ga0501045_0013481 3300049824 Bacteria 5774
319 Ga0501045_0068369 3300049824 Bacteria 2610
320 nmdc:mga03683_109834_c1 3300050489 Bacteria 1218
321 nmdc:mga03683_30170_c1 3300050489 Bacteria 2168
322 nmdc:mga03683_32176_c1 3300050489 Bacteria 2109
323 nmdc:mga03n38_153935_c1 3300050490 Bacteria 1159
324 nmdc:mga00v17_140493_c1 3300050491 Bacteria 1548
325 nmdc:mga00v17_50282_c1 3300050491 Bacteria 2532
326 nmdc:mga00v17_6891_c1 3300050491 Bacteria 6041
327 nmdc:mga0yw44_10910_c1 3300050492 Bacteria 4659
328 nmdc:mga0yw44_188494_c1 3300050492 Bacteria 1359
329 nmdc:mga06z11_108003_c1 3300050494 Bacteria 1537
330 nmdc:mga06z11_12661_c1 3300050494 Bacteria 3675
331 nmdc:mga06z11_18870_c1 3300050494 Bacteria 3159
332 nmdc:mga06z11_245623_c1 3300050494 Bacteria 1052
333 nmdc:mga06z11_27541_c1 3300050494 Bacteria 2717
334 nmdc:mga06z11_295243_c1 3300050494 Bacteria 962
335 nmdc:mga07m45_58648_c1 3300050496 Bacteria 2178
336 nmdc:mga07m45_9824_c1 3300050496 Bacteria 3731
337 nmdc:mga05p37_220795_c1 3300050507 Bacteria 2287
338 nmdc:mga05p37_48930_c1 3300050507 Bacteria 5199
339 nmdc:mga09592_12512_c1 3300050508 Bacteria 6914
340 nmdc:mga0qj67_2936_c1 3300050509 Bacteria 12228
341 nmdc:mga06r32_14951_c1 3300050510 Bacteria 7044
342 nmdc:mga06r32_3778_c1 3300050510 Bacteria 13545
343 nmdc:mga08y16_137750_c1 3300050511 Bacteria 2537
344 nmdc:mga08y16_2684_c1 3300050511 Bacteria 18274
345 nmdc:mga08y16_652720_c1 3300050511 Bacteria 1056
346 nmdc:mga0sz30_751_c1 3300050516 Bacteria 11833
347 Ga0500647_0056711 3300053091 Bacteria 1884
348 Ga0500593_000257 3300053117 Bacteria 21760
349 Ga0500595_018259 3300053119 Bacteria 2569
350 Ga0500568_0000005 3300053139 Bacteria 614296
351 Ga0500604_0046039 3300053151 Bacteria 1333
352 Ga0500616_0007298 3300053153 Bacteria 7049
353 Ga0501084_0000151 3300054114 Bacteria 52908
354 Ga0501084_0000579 3300054114 Bacteria 27999
355 Ga0501084_0001104 3300054114 Bacteria 21003
356 Ga0501084_0056352 3300054114 Bacteria 3288
357 Ga0501082_0005872 3300060353 Bacteria 10657
358 Ga0501082_0059960 3300060353 Bacteria 3278
359 Ga0501082_0071181 3300060353 Bacteria 2994
360 Ga0501082_0170535 3300060353 Bacteria 1892
361 Ga0501082_0399479 3300060353 Bacteria 1200
362 Ga0501082_0413877 3300060353 Bacteria 1177
363 Ga0530510_0009084 3300061734 Bacteria 6965
364 Ga0530510_0015828 3300061734 Bacteria 5332
365 Ga0530510_0030918 3300061734 Bacteria 3847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10159144 Ga0105249_101591442 244
2 3300005844 Ga0068862_100144396 Ga0068862_1001443962 256
3 3300025961 Ga0207712_10186583 Ga0207712_101865832 256
4 3300050494 nmdc:mga06z11_295243_c1 nmdc:mga06z11_295243_c1_13_846 256
5 3300009094 Ga0111539_10151991 Ga0111539_101519915 264
6 3300009147 Ga0114129_10617005 Ga0114129_106170052 264
7 3300042461 Ga0439460_0004791 Ga0439460_0004791_161_1000 264
8 3300049587 Ga0501071_0211677 Ga0501071_0211677_488_1327 264
9 3300050511 nmdc:mga08y16_137750_c1 nmdc:mga08y16_137750_c1_278_1117 264
10 3300026118 Ga0207675_100454984 Ga0207675_1004549842 265
11 3300005338 Ga0068868_100248073 Ga0068868_1002480732 266
12 3300005340 Ga0070689_100313407 Ga0070689_1003134072 266
13 3300013297 Ga0157378_10008639 Ga0157378_100086393 266
14 3300025936 Ga0207670_10116243 Ga0207670_101162432 266
15 3300038735 Ga0400485_05646 Ga0400485_05646_2182_3015 266
16 3300048913 Ga0496110_0565456 Ga0496110_0565456_100_930 266
17 3300049585 Ga0501069_0317006 Ga0501069_0317006_49_888 266
18 3300005459 Ga0068867_100026169 Ga0068867_1000261692 267
19 3300005544 Ga0070686_100060378 Ga0070686_1000603782 267
20 3300005718 Ga0068866_10022214 Ga0068866_100222142 267
21 3300006358 Ga0068871_100061647 Ga0068871_1000616472 267
22 3300009148 Ga0105243_10004690 Ga0105243_100046907 267
23 3300013306 Ga0163162_10253830 Ga0163162_102538302 267
24 3300013308 Ga0157375_10534680 Ga0157375_105346802 267
25 3300025981 Ga0207640_10104856 Ga0207640_101048562 267
26 3300005355 Ga0070671_100536906 Ga0070671_1005369061 268
27 3300006051 Ga0075364_10163413 Ga0075364_101634132 271
28 3300049823 Ga0501044_0327971 Ga0501044_0327971_592_1431 272
29 3300031727 Ga0316576_10170355 Ga0316576_101703551 273
30 3300037312 Ga0395899_0052745 Ga0395899_0052745_1967_2848 273
31 3300037418 Ga0395900_0049326 Ga0395900_0049326_3186_4067 273
32 3300038443 Ga0395901_0098073 Ga0395901_0098073_143_1024 273
33 3300005355 Ga0070671_100355341 Ga0070671_1003553412 274
34 3300005937 Ga0081455_10001606 Ga0081455_1000160611 274
35 3300005843 Ga0068860_100099059 Ga0068860_1000990593 275
36 3300028381 Ga0268264_10061702 Ga0268264_100617024 275
37 3300049576 Ga0501040_0026921 Ga0501040_0026921_28_903 275
38 3300049577 Ga0501041_0076688 Ga0501041_0076688_1115_1990 275
39 3300049578 Ga0501042_0104280 Ga0501042_0104280_1145_2020 275
40 3300049582 Ga0501048_0157732 Ga0501048_0157732_416_1291 275
41 3300049587 Ga0501071_0385994 Ga0501071_0385994_132_1007 275
42 3300049824 Ga0501045_0013481 Ga0501045_0013481_2379_3254 275
43 3300060353 Ga0501082_0413877 Ga0501082_0413877_24_899 275
44 3300005456 Ga0070678_100119029 Ga0070678_1001190292 276
45 3300009098 Ga0105245_10364811 Ga0105245_103648112 276
46 3300025918 Ga0207662_10029574 Ga0207662_100295742 276
47 3300026121 Ga0207683_10024224 Ga0207683_100242245 276
48 3300035695 Ga0373927_0323277 Ga0373927_0323277_15_890 276
49 3300037068 Ga0373925_0160792 Ga0373925_0160792_470_1345 276
50 3300046492 Ga0495585_0195531 Ga0495585_0195531_120_950 276
51 3300049575 Ga0501039_0042080 Ga0501039_0042080_43_927 276
52 3300005548 Ga0070665_100008670 Ga0070665_1000086706 277
53 3300005937 Ga0081455_10000113 Ga0081455_1000011368 277
54 3300005981 Ga0081538_10000383 Ga0081538_1000038341 277
55 3300006844 Ga0075428_100587807 Ga0075428_1005878072 277
56 3300028379 Ga0268266_10003146 Ga0268266_1000314611 277
57 3300049571 Ga0501034_0009446 Ga0501034_0009446_5453_6328 277
58 3300049572 Ga0501036_0010076 Ga0501036_0010076_3106_3996 277
59 3300049574 Ga0501038_0063979 Ga0501038_0063979_1501_2391 277
60 3300049575 Ga0501039_0001475 Ga0501039_0001475_680_1570 277
61 3300049575 Ga0501039_0167069 Ga0501039_0167069_36_869 277
62 3300049576 Ga0501040_0055261 Ga0501040_0055261_29_919 277
63 3300049577 Ga0501041_0003397 Ga0501041_0003397_5595_6485 277
64 3300049580 Ga0501046_0047197 Ga0501046_0047197_722_1612 277
65 3300049582 Ga0501048_0165556 Ga0501048_0165556_475_1365 277
66 3300049584 Ga0501068_0009002 Ga0501068_0009002_4051_4926 277
67 3300049586 Ga0501070_0109718 Ga0501070_0109718_253_1128 277
68 3300049587 Ga0501071_0116213 Ga0501071_0116213_441_1331 277
69 3300049588 Ga0501072_0011262 Ga0501072_0011262_1362_2252 277
70 3300049590 Ga0501074_0011011 Ga0501074_0011011_1867_2757 277
71 3300049591 Ga0501075_0019634 Ga0501075_0019634_1574_2464 277
72 3300049593 Ga0501077_0021299 Ga0501077_0021299_1192_2082 277
73 3300049743 Ga0501081_0028774 Ga0501081_0028774_605_1495 277
74 3300049822 Ga0501035_0091893 Ga0501035_0091893_723_1613 277
75 3300049823 Ga0501044_0031046 Ga0501044_0031046_555_1430 277
76 3300054114 Ga0501084_0001104 Ga0501084_0001104_12989_13879 277
77 3300060353 Ga0501082_0059960 Ga0501082_0059960_736_1626 277
78 3300061734 Ga0530510_0009084 Ga0530510_0009084_493_1383 277
79 3300005456 Ga0070678_100480920 Ga0070678_1004809201 278
80 3300006038 Ga0075365_10083684 Ga0075365_100836842 278
81 3300006051 Ga0075364_10006622 Ga0075364_100066224 278
82 3300009094 Ga0111539_10001574 Ga0111539_1000157411 278
83 3300025919 Ga0207657_10148087 Ga0207657_101480872 278
84 3300050489 nmdc:mga03683_109834_c1 nmdc:mga03683_109834_c1_77_952 278
85 3300050491 nmdc:mga00v17_6891_c1 nmdc:mga00v17_6891_c1_1798_2673 278
86 3300050492 nmdc:mga0yw44_10910_c1 nmdc:mga0yw44_10910_c1_416_1291 278
87 3300005844 Ga0068862_100072218 Ga0068862_1000722183 279
88 3300006186 Ga0075369_10064866 Ga0075369_100648661 279
89 3300007265 Ga0099794_10019581 Ga0099794_100195812 279
90 3300007265 Ga0099794_10177139 Ga0099794_101771392 279
91 3300009098 Ga0105245_10434580 Ga0105245_104345801 279
92 3300009551 Ga0105238_10505201 Ga0105238_105052012 279
93 3300014326 Ga0157380_10314660 Ga0157380_103146602 279
94 3300025934 Ga0207686_10038965 Ga0207686_100389652 279
95 3300025940 Ga0207691_10281686 Ga0207691_102816862 279
96 3300028380 Ga0268265_10032026 Ga0268265_100320263 279
97 3300048908 Ga0496105_0035340 Ga0496105_0035340_3162_4013 279
98 3300049570 Ga0501033_0036461 Ga0501033_0036461_1883_2722 279
99 3300049571 Ga0501034_0030291 Ga0501034_0030291_4125_4964 279
100 3300049760 Ga0501263_000845 Ga0501263_000845_1676_2515 279
101 3300050494 nmdc:mga06z11_27541_c1 nmdc:mga06z11_27541_c1_1084_1959 279
102 3300053091 Ga0500647_0056711 Ga0500647_0056711_955_1794 279
103 3300009551 Ga0105238_10452995 Ga0105238_104529952 280
104 3300009553 Ga0105249_10849297 Ga0105249_108492971 280
105 3300048922 Ga0496119_0002250 Ga0496119_0002250_12712_13554 280
106 3300048923 Ga0496120_0000779 Ga0496120_0000779_32550_33392 280
107 3300050494 nmdc:mga06z11_245623_c1 nmdc:mga06z11_245623_c1_36_878 280
108 3300005548 Ga0070665_100087465 Ga0070665_1000874651 281
109 3300028379 Ga0268266_10272982 Ga0268266_102729822 281
110 3300048903 Ga0496100_0328492 Ga0496100_0328492_265_1131 281
111 3300049581 Ga0501047_0492870 Ga0501047_0492870_39_947 281
112 3300053117 Ga0500593_000257 Ga0500593_000257_14723_15607 282
113 3300049742 Ga0501080_0662210 Ga0501080_0662210_23_901 283
114 iso_pu_bacteria 2795385470 2795787429 283
115 3300006178 Ga0075367_10017128 Ga0075367_100171283 285
116 3300025933 Ga0207706_10136256 Ga0207706_101362562 285
117 iso_pu_bacteria 2595698237 2596374122 285
118 iso_pu_bacteria 2889306138 2889311439 285
119 iso_pu_bacteria 2902330777 2902334026 285
120 iso_pu_bacteria 2902405164 2902411873 285
121 iso_pu_bacteria 2928125067 2928129706 285
122 3300049569 Ga0501032_0120605 Ga0501032_0120605_514_1473 286
123 3300049581 Ga0501047_0000029 Ga0501047_0000029_73337_74296 286
124 iso_pu_bacteria 2795385472 2795791489 287
125 3300013308 Ga0157375_10935932 Ga0157375_109359322 288
126 3300031616 Ga0307508_10090298 Ga0307508_100902982 288
127 3300035398 Ga0316574_0045500 Ga0316574_0045500_1830_2696 288
128 3300046533 Ga0495640_0069692 Ga0495640_0069692_631_1500 288
129 3300048928 Ga0496125_0012847 Ga0496125_0012847_3990_4904 288
130 3300005355 Ga0070671_100033915 Ga0070671_1000339154 289
131 3300005367 Ga0070667_100081559 Ga0070667_1000815592 289
132 3300005843 Ga0068860_100092677 Ga0068860_1000926773 289
133 3300006051 Ga0075364_10248715 Ga0075364_102487152 289
134 3300006178 Ga0075367_10116653 Ga0075367_101166531 289
135 3300025986 Ga0207658_10087017 Ga0207658_100870172 289
136 3300028379 Ga0268266_10075267 Ga0268266_100752673 289
137 3300028381 Ga0268264_10379706 Ga0268264_103797062 289
138 3300031727 Ga0316576_10048872 Ga0316576_100488722 289
139 3300035398 Ga0316574_0011828 Ga0316574_0011828_2952_3836 289
140 3300035398 Ga0316574_0062633 Ga0316574_0062633_495_1376 289
141 3300039062 Ga0400483_131890 Ga0400483_131890_362_1246 289
142 3300039062 Ga0400483_234363 Ga0400483_234363_11288_12157 289
143 3300048915 Ga0496112_0130715 Ga0496112_0130715_1446_2330 289
144 3300049824 Ga0501045_0068369 Ga0501045_0068369_1717_2586 289
145 3300050491 nmdc:mga00v17_50282_c1 nmdc:mga00v17_50282_c1_1228_2103 289
146 3300050492 nmdc:mga0yw44_188494_c1 nmdc:mga0yw44_188494_c1_163_1032 289
147 3300050494 nmdc:mga06z11_108003_c1 nmdc:mga06z11_108003_c1_87_962 289
148 3300053139 Ga0500568_0000005 Ga0500568_0000005_83952_84836 289
149 3300060353 Ga0501082_0399479 Ga0501082_0399479_50_919 289
150 3300005336 Ga0070680_100006249 Ga0070680_10000624910 290
151 3300005347 Ga0070668_100161052 Ga0070668_1001610522 290
152 3300005406 Ga0070703_10003354 Ga0070703_100033543 290
153 3300005440 Ga0070705_100000073 Ga0070705_10000007349 290
154 3300005444 Ga0070694_100002583 Ga0070694_1000025839 290
155 3300005455 Ga0070663_100034861 Ga0070663_1000348613 290
156 3300005518 Ga0070699_100002173 Ga0070699_1000021733 290
157 3300005549 Ga0070704_100007557 Ga0070704_1000075575 290
158 3300005577 Ga0068857_100025571 Ga0068857_1000255713 290
159 3300005617 Ga0068859_100354799 Ga0068859_1003547992 290
160 3300005618 Ga0068864_100030240 Ga0068864_1000302404 290
161 3300005719 Ga0068861_100236515 Ga0068861_1002365152 290
162 3300005843 Ga0068860_100083297 Ga0068860_1000832972 290
163 3300005844 Ga0068862_100035199 Ga0068862_1000351992 290
164 3300006038 Ga0075365_10000350 Ga0075365_1000035015 290
165 3300006178 Ga0075367_10088805 Ga0075367_100888052 290
166 3300006931 Ga0097620_100354795 Ga0097620_1003547951 290
167 3300025885 Ga0207653_10000357 Ga0207653_1000035713 290
168 3300025917 Ga0207660_10046651 Ga0207660_100466511 290
169 3300025961 Ga0207712_10008410 Ga0207712_100084103 290
170 3300025972 Ga0207668_10179039 Ga0207668_101790391 290
171 3300026067 Ga0207678_10030706 Ga0207678_100307065 290
172 3300026095 Ga0207676_10031420 Ga0207676_100314203 290
173 3300026116 Ga0207674_10030070 Ga0207674_100300704 290
174 3300026118 Ga0207675_100091086 Ga0207675_1000910862 290
175 3300028380 Ga0268265_10007918 Ga0268265_100079184 290
176 3300028381 Ga0268264_10019138 Ga0268264_100191384 290
177 3300031251 Ga0265327_10000940 Ga0265327_1000094031 290
178 3300048905 Ga0496102_0016781 Ga0496102_0016781_1624_2511 290
179 3300048907 Ga0496104_0380718 Ga0496104_0380718_248_1135 290
180 3300048909 Ga0496106_0001324 Ga0496106_0001324_1628_2515 290
181 3300048910 Ga0496107_0022529 Ga0496107_0022529_1573_2460 290
182 3300049574 Ga0501038_0007253 Ga0501038_0007253_2553_3425 290
183 3300049577 Ga0501041_0138710 Ga0501041_0138710_84_956 290
184 3300049581 Ga0501047_0006210 Ga0501047_0006210_6835_7707 290
185 3300049583 Ga0501067_0013327 Ga0501067_0013327_1161_2033 290
186 3300049584 Ga0501068_0000179 Ga0501068_0000179_3520_4392 290
187 3300049585 Ga0501069_0001553 Ga0501069_0001553_80_952 290
188 3300049588 Ga0501072_0000018 Ga0501072_0000018_132478_133350 290
189 3300049588 Ga0501072_0052970 Ga0501072_0052970_2031_2903 290
190 3300049589 Ga0501073_0024313 Ga0501073_0024313_975_1847 290
191 3300049590 Ga0501074_0007564 Ga0501074_0007564_5884_6756 290
192 3300049592 Ga0501076_0009946 Ga0501076_0009946_2602_3474 290
193 3300049593 Ga0501077_0002505 Ga0501077_0002505_2536_3408 290
194 3300049741 Ga0501079_0007348 Ga0501079_0007348_2572_3444 290
195 3300049744 Ga0501083_0000887 Ga0501083_0000887_971_1843 290
196 3300054114 Ga0501084_0000151 Ga0501084_0000151_25290_26162 290
197 3300060353 Ga0501082_0071181 Ga0501082_0071181_1513_2385 290
198 3300061734 Ga0530510_0015828 Ga0530510_0015828_2504_3376 290
199 3300005329 Ga0070683_100049430 Ga0070683_1000494303 291
200 3300005340 Ga0070689_100314327 Ga0070689_1003143271 291
201 3300005344 Ga0070661_100012271 Ga0070661_1000122714 291
202 3300005365 Ga0070688_100063067 Ga0070688_1000630672 291
203 3300005535 Ga0070684_100043014 Ga0070684_1000430144 291
204 3300005539 Ga0068853_100344628 Ga0068853_1003446282 291
205 3300005564 Ga0070664_100021927 Ga0070664_1000219274 291
206 3300005577 Ga0068857_100085409 Ga0068857_1000854092 291
207 3300005614 Ga0068856_100030337 Ga0068856_1000303373 291
208 3300005616 Ga0068852_100010363 Ga0068852_1000103636 291
209 3300005842 Ga0068858_100000002 Ga0068858_10000000242 291
210 3300005981 Ga0081538_10060230 Ga0081538_100602303 291
211 3300006177 Ga0075362_10019497 Ga0075362_100194972 291
212 3300006846 Ga0075430_100002545 Ga0075430_10000254510 291
213 3300006847 Ga0075431_100000604 Ga0075431_10000060418 291
214 3300006880 Ga0075429_100020110 Ga0075429_1000201103 291
215 3300009177 Ga0105248_10000437 Ga0105248_1000043721 291
216 3300009545 Ga0105237_10151653 Ga0105237_101516532 291
217 3300009551 Ga0105238_10047499 Ga0105238_100474993 291
218 3300009553 Ga0105249_10109506 Ga0105249_101095063 291
219 3300010375 Ga0105239_10194391 Ga0105239_101943913 291
220 3300013104 Ga0157370_10351313 Ga0157370_103513132 291
221 3300013105 Ga0157369_10058197 Ga0157369_100581973 291
222 3300013307 Ga0157372_10156171 Ga0157372_101561712 291
223 3300014968 Ga0157379_10000003 Ga0157379_1000000366 291
224 3300025898 Ga0207692_10021848 Ga0207692_100218482 291
225 3300025904 Ga0207647_10056243 Ga0207647_100562432 291
226 3300025921 Ga0207652_10041685 Ga0207652_100416852 291
227 3300025924 Ga0207694_10104395 Ga0207694_101043952 291
228 3300025940 Ga0207691_10189449 Ga0207691_101894492 291
229 3300025941 Ga0207711_10000630 Ga0207711_1000063025 291
230 3300025945 Ga0207679_10019267 Ga0207679_100192674 291
231 3300025949 Ga0207667_10097344 Ga0207667_100973442 291
232 3300025949 Ga0207667_10515135 Ga0207667_105151352 291
233 3300026035 Ga0207703_10000001 Ga0207703_10000001286 291
234 3300026041 Ga0207639_10345696 Ga0207639_103456962 291
235 3300026078 Ga0207702_10033708 Ga0207702_100337085 291
236 3300026088 Ga0207641_10491494 Ga0207641_104914942 291
237 3300026116 Ga0207674_10168093 Ga0207674_101680932 291
238 3300026142 Ga0207698_10267398 Ga0207698_102673982 291
239 3300027907 Ga0207428_10087925 Ga0207428_100879253 291
240 3300028379 Ga0268266_10203861 Ga0268266_102038612 291
241 3300028573 Ga0265334_10029159 Ga0265334_100291592 291
242 3300035691 Ga0373931_0133451 Ga0373931_0133451_80_955 291
243 3300036712 Ga0316584_0301937 Ga0316584_0301937_47_928 291
244 3300037312 Ga0395899_0004593 Ga0395899_0004593_975_1850 291
245 3300037418 Ga0395900_0021022 Ga0395900_0021022_919_1794 291
246 3300037466 Ga0395898_0016486 Ga0395898_0016486_3388_4263 291
247 3300038443 Ga0395901_0011815 Ga0395901_0011815_2207_3082 291
248 3300038443 Ga0395901_0193009 Ga0395901_0193009_474_1349 291
249 3300042876 Ga0451577_0008487 Ga0451577_0008487_5518_6396 291
250 3300044712 Ga0453684_0002246 Ga0453684_0002246_37105_37983 291
251 3300044842 Ga0466957_0095987 Ga0466957_0095987_440_1315 291
252 3300045836 Ga0466958_0363904 Ga0466958_0363904_34_909 291
253 3300049570 Ga0501033_0042524 Ga0501033_0042524_1591_2466 291
254 3300049574 Ga0501038_0112818 Ga0501038_0112818_780_1658 291
255 3300049575 Ga0501039_0005016 Ga0501039_0005016_2511_3389 291
256 3300049576 Ga0501040_0069480 Ga0501040_0069480_717_1595 291
257 3300049577 Ga0501041_0004555 Ga0501041_0004555_3462_4340 291
258 3300049579 Ga0501043_0133110 Ga0501043_0133110_1049_1927 291
259 3300049580 Ga0501046_0035655 Ga0501046_0035655_2840_3718 291
260 3300049581 Ga0501047_0367681 Ga0501047_0367681_195_1070 291
261 3300049582 Ga0501048_0029675 Ga0501048_0029675_1974_2852 291
262 3300049585 Ga0501069_0000887 Ga0501069_0000887_7083_7964 291
263 3300049586 Ga0501070_0001336 Ga0501070_0001336_449_1330 291
264 3300049587 Ga0501071_0031737 Ga0501071_0031737_2018_2896 291
265 3300049587 Ga0501071_0051166 Ga0501071_0051166_1279_2157 291
266 3300049588 Ga0501072_0014473 Ga0501072_0014473_3350_4231 291
267 3300049588 Ga0501072_0027086 Ga0501072_0027086_1468_2346 291
268 3300049591 Ga0501075_0013053 Ga0501075_0013053_3283_4161 291
269 3300049592 Ga0501076_0047923 Ga0501076_0047923_1642_2520 291
270 3300049593 Ga0501077_0007243 Ga0501077_0007243_3847_4725 291
271 3300049741 Ga0501079_0006171 Ga0501079_0006171_2830_3711 291
272 3300049741 Ga0501079_0029987 Ga0501079_0029987_450_1328 291
273 3300049742 Ga0501080_0046271 Ga0501080_0046271_2650_3531 291
274 3300049743 Ga0501081_0031354 Ga0501081_0031354_797_1675 291
275 3300049744 Ga0501083_0000827 Ga0501083_0000827_19231_20112 291
276 3300049744 Ga0501083_0059633 Ga0501083_0059633_1232_2110 291
277 3300049824 Ga0501045_0005503 Ga0501045_0005503_5984_6862 291
278 3300050489 nmdc:mga03683_30170_c1 nmdc:mga03683_30170_c1_246_1121 291
279 3300050507 nmdc:mga05p37_220795_c1 nmdc:mga05p37_220795_c1_376_1263 291
280 3300050508 nmdc:mga09592_12512_c1 nmdc:mga09592_12512_c1_2900_3787 291
281 3300050509 nmdc:mga0qj67_2936_c1 nmdc:mga0qj67_2936_c1_8187_9074 291
282 3300050510 nmdc:mga06r32_3778_c1 nmdc:mga06r32_3778_c1_390_1277 291
283 3300050511 nmdc:mga08y16_2684_c1 nmdc:mga08y16_2684_c1_4156_5052 291
284 3300050511 nmdc:mga08y16_652720_c1 nmdc:mga08y16_652720_c1_118_993 291
285 3300053151 Ga0500604_0046039 Ga0500604_0046039_422_1297 291
286 3300054114 Ga0501084_0000579 Ga0501084_0000579_14934_15815 291
287 3300054114 Ga0501084_0056352 Ga0501084_0056352_1912_2790 291
288 3300060353 Ga0501082_0005872 Ga0501082_0005872_3748_4626 291
289 3300061734 Ga0530510_0030918 Ga0530510_0030918_1063_1941 291
290 3300005327 Ga0070658_10000728 Ga0070658_100007288 292
291 3300005336 Ga0070680_100000091 Ga0070680_10000009126 292
292 3300005339 Ga0070660_100037000 Ga0070660_1000370002 292
293 3300005340 Ga0070689_100007960 Ga0070689_1000079602 292
294 3300005341 Ga0070691_10000688 Ga0070691_1000068812 292
295 3300005367 Ga0070667_100104498 Ga0070667_1001044982 292
296 3300005530 Ga0070679_100173725 Ga0070679_1001737252 292
297 3300005548 Ga0070665_100444286 Ga0070665_1004442862 292
298 3300005563 Ga0068855_100020471 Ga0068855_1000204715 292
299 3300005577 Ga0068857_100025122 Ga0068857_1000251223 292
300 3300005614 Ga0068856_100466255 Ga0068856_1004662552 292
301 3300005843 Ga0068860_100078470 Ga0068860_1000784704 292
302 3300005937 Ga0081455_10001078 Ga0081455_1000107817 292
303 3300005981 Ga0081538_10002120 Ga0081538_100021203 292
304 3300006038 Ga0075365_10039799 Ga0075365_100397993 292
305 3300006048 Ga0075363_100204154 Ga0075363_1002041542 292
306 3300006051 Ga0075364_10046475 Ga0075364_100464752 292
307 3300006177 Ga0075362_10025047 Ga0075362_100250472 292
308 3300006178 Ga0075367_10011125 Ga0075367_100111255 292
309 3300006195 Ga0075366_10023944 Ga0075366_100239445 292
310 3300006195 Ga0075366_10101130 Ga0075366_101011302 292
311 3300006846 Ga0075430_100010379 Ga0075430_1000103792 292
312 3300006847 Ga0075431_100008036 Ga0075431_1000080363 292
313 3300006880 Ga0075429_100004337 Ga0075429_1000043379 292
314 3300009011 Ga0105251_10014909 Ga0105251_100149092 292
315 3300009101 Ga0105247_10000255 Ga0105247_1000025527 292
316 3300009147 Ga0114129_10027792 Ga0114129_100277922 292
317 3300009177 Ga0105248_10044317 Ga0105248_100443173 292
318 3300009988 Ga0105035_104042 Ga0105035_1040422 292
319 3300014325 Ga0163163_10044785 Ga0163163_100447853 292
320 3300014968 Ga0157379_10093440 Ga0157379_100934402 292
321 3300014969 Ga0157376_10476472 Ga0157376_104764721 292
322 3300025900 Ga0207710_10000130 Ga0207710_1000013017 292
323 3300025909 Ga0207705_10007497 Ga0207705_100074978 292
324 3300025912 Ga0207707_10003240 Ga0207707_1000324013 292
325 3300025913 Ga0207695_10016537 Ga0207695_100165377 292
326 3300025915 Ga0207693_10133081 Ga0207693_101330812 292
327 3300025917 Ga0207660_10000899 Ga0207660_1000089911 292
328 3300025919 Ga0207657_10045244 Ga0207657_100452445 292
329 3300025921 Ga0207652_10001862 Ga0207652_100018622 292
330 3300025936 Ga0207670_10022293 Ga0207670_100222935 292
331 3300025949 Ga0207667_10033369 Ga0207667_100333696 292
332 3300026078 Ga0207702_10334357 Ga0207702_103343572 292
333 3300026116 Ga0207674_10031769 Ga0207674_100317692 292
334 3300027866 Ga0209813_10013121 Ga0209813_100131212 292
335 3300044694 Ga0466963_0003611 Ga0466963_0003611_1928_2896 292
336 3300045976 Ga0466967_0032140 Ga0466967_0032140_2288_3256 292
337 3300049571 Ga0501034_0145271 Ga0501034_0145271_619_1503 292
338 3300050491 nmdc:mga00v17_140493_c1 nmdc:mga00v17_140493_c1_380_1258 292
339 3300050494 nmdc:mga06z11_12661_c1 nmdc:mga06z11_12661_c1_543_1421 292
340 3300050496 nmdc:mga07m45_9824_c1 nmdc:mga07m45_9824_c1_1054_1932 292
341 3300050507 nmdc:mga05p37_48930_c1 nmdc:mga05p37_48930_c1_3479_4375 292
342 3300050510 nmdc:mga06r32_14951_c1 nmdc:mga06r32_14951_c1_4853_5749 292
343 iso_pu_bacteria 2579778521 2579856559 292
344 iso_pu_bacteria 2619618881 2619857397 292
345 iso_pu_bacteria 2619619003 2620352729 292
346 iso_pu_bacteria 8054913762 8054917467 292
347 3300003203 JGI25406J46586_10018849 JGI25406J46586_100188492 293
348 3300005467 Ga0070706_100111703 Ga0070706_1001117032 293
349 3300005471 Ga0070698_100002891 Ga0070698_10000289114 293
350 3300005518 Ga0070699_100066383 Ga0070699_1000663832 293
351 3300005548 Ga0070665_100368319 Ga0070665_1003683192 293
352 3300005937 Ga0081455_10000366 Ga0081455_100003668 293
353 3300005985 Ga0081539_10000797 Ga0081539_1000079729 293
354 3300005985 Ga0081539_10041354 Ga0081539_100413542 293
355 3300005985 Ga0081539_10059738 Ga0081539_100597382 293
356 3300006048 Ga0075363_100177587 Ga0075363_1001775872 293
357 3300006177 Ga0075362_10011970 Ga0075362_100119703 293
358 3300006178 Ga0075367_10132770 Ga0075367_101327702 293
359 3300028800 Ga0265338_10102373 Ga0265338_101023732 293
360 3300031251 Ga0265327_10047870 Ga0265327_100478702 293
361 3300031548 Ga0307408_100542082 Ga0307408_1005420822 293
362 3300035170 Ga0373943_0038715 Ga0373943_0038715_991_1872 293
363 3300037068 Ga0373925_0048898 Ga0373925_0048898_881_1762 293
364 3300037312 Ga0395899_0070083 Ga0395899_0070083_950_1831 293
365 3300039438 Ga0436360_0681478 Ga0436360_0681478_6638_7519 293
366 3300039447 Ga0436361_0046963 Ga0436361_0046963_34_915 293
367 3300047472 Ga0495686_0000065 Ga0495686_0000065_101722_102615 293
368 3300049569 Ga0501032_0001190 Ga0501032_0001190_351_1247 293
369 3300050489 nmdc:mga03683_32176_c1 nmdc:mga03683_32176_c1_1052_1933 293
370 3300050490 nmdc:mga03n38_153935_c1 nmdc:mga03n38_153935_c1_64_945 293
371 3300050494 nmdc:mga06z11_18870_c1 nmdc:mga06z11_18870_c1_1832_2713 293
372 3300050496 nmdc:mga07m45_58648_c1 nmdc:mga07m45_58648_c1_180_1061 293
373 3300050516 nmdc:mga0sz30_751_c1 nmdc:mga0sz30_751_c1_8349_9230 293
374 3300053119 Ga0500595_018259 Ga0500595_018259_1047_1946 293
375 3300053153 Ga0500616_0007298 Ga0500616_0007298_3735_4616 293
376 3300060353 Ga0501082_0170535 Ga0501082_0170535_304_1191 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

39

253

0.98

PF15617

C-C_Bond_Lyase

C-C_Bond_Lyase of the TIM-Barrel fold

40

316

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.9345 5 235
1sgj-assembly1.cif.gz_C crystal structure of citrate lyase beta subunit 0.9224 5 234
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.922 10 240
1sgj-assembly1.cif.gz_C crystal structure of citrate lyase beta subunit 0.9147 5 234
5vxc-assembly1.cif.gz_A crystal structure analysis of human clybl in complex with free coash 0.8962 3 287
ID Description Score Start End Superfamily
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9514 3 283 3.20.20.60
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9345 5 235 3.20.20.60
af_Q54Q74_39_346_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9205 5 283 3.20.20.60
1sgjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9169 5 234 3.20.20.60
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9136 3 283 3.20.20.60
ID Description Score Start End GO Terms
AF-H6SJU7-F1-model_v4 Citrate lyase (EC 4.1.3.6) 0.9832 1 291 GO:0000287
GO:0006107
GO:0008815
AF-A0A3B8T1R9-F1-model_v4 CoA ester lyase 0.9818 92 287 GO:0000287
GO:0006107
GO:0016829
AF-A0A0P9CZ94-F1-model_v4 Citryl-CoA lyase 0.9791 171 287 GO:0000287
GO:0006107
GO:0016829
AF-A0A522BU16-F1-model_v4 CoA ester lyase 0.9782 14 254 GO:0000287
GO:0006107
GO:0016829
AF-A0A2E1VGY6-F1-model_v4 CoA ester lyase 0.9768 3 289 GO:0000287
GO:0006107
GO:0016829

Feature Viewer

pLDDT pTM Quality
94.74 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map