F427574

General Info

Members Datasets Scaffolds Average Seq Length
377 230 377 136

Family's Representative Sequence

Representative Sequence 3300004803|Ga0058862_12773115|Ga0058862_127731151
Length 150
Sequence MYTGSENNRHEAFKNMNLIDGIGGVFLFSNNPKRLAEWYRENLGITYEESPDCSSIYKSFVYRDLQDASVKRTTTWAILPSDDDISHKPRTGQINYRVRSMAETLSHVRSRGVAIDKTEDCEYGKFAWVTDPDGNKIELWEPVEERIEKP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
178 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
183 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
184 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.51
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2170430 2162886012 Unclassified 1324
2 MBSR1b_contig_890778 2162886012 Bacteria 940
3 2214936887 2209111006 Unclassified 541
4 JGI25406J46586_10039828 3300003203 Unclassified 1671
5 Ga0058863_11979021 3300004799 Unclassified 1645
6 Ga0058862_12773115 3300004803 Bacteria 1076
7 Ga0065712_10084450 3300005290 Unclassified 2757
8 Ga0065715_10089831 3300005293 Bacteria 8382
9 Ga0065715_10117963 3300005293 Bacteria 2331
10 Ga0065715_10458150 3300005293 Unclassified 819
11 Ga0065715_10591011 3300005293 Unclassified 714
12 Ga0070676_11203036 3300005328 Unclassified 576
13 Ga0070683_100000514 3300005329 Bacteria 27185
14 Ga0070690_100365310 3300005330 Bacteria 1051
15 Ga0068869_100851797 3300005334 Bacteria 786
16 Ga0070680_100002673 3300005336 Bacteria 13209
17 Ga0070680_100041088 3300005336 Bacteria 3749
18 Ga0070680_100099340 3300005336 Bacteria 2415
19 Ga0070682_100015886 3300005337 Bacteria 4370
20 Ga0070682_100187286 3300005337 Bacteria 1451
21 Ga0070682_100435076 3300005337 Bacteria 1001
22 Ga0070682_100979812 3300005337 Unclassified 700
23 Ga0070682_101119862 3300005337 Unclassified 660
24 Ga0070682_101157446 3300005337 Unclassified 650
25 Ga0068868_100139312 3300005338 Bacteria 1990
26 Ga0068868_101663259 3300005338 Bacteria 601
27 Ga0070687_100396305 3300005343 Unclassified 904
28 Ga0070661_100128986 3300005344 Unclassified 1898
29 Ga0070661_100541325 3300005344 Unclassified 936
30 Ga0070692_10004843 3300005345 Bacteria 5661
31 Ga0070692_10813215 3300005345 Unclassified 639
32 Ga0070668_100661813 3300005347 Bacteria 918
33 Ga0070669_100214873 3300005353 Bacteria 1518
34 Ga0070675_100558056 3300005354 Bacteria 1036
35 Ga0070671_101043446 3300005355 Unclassified 717
36 Ga0070674_100101896 3300005356 Bacteria 2093
37 Ga0070673_100724869 3300005364 Unclassified 914
38 Ga0070688_100415489 3300005365 Unclassified 999
39 Ga0070659_100664879 3300005366 Unclassified 899
40 Ga0070709_10107756 3300005434 Bacteria 1868
41 Ga0070714_100000051 3300005435 Bacteria 110289
42 Ga0070713_100044629 3300005436 Bacteria 3629
43 Ga0070713_101117774 3300005436 Unclassified 762
44 Ga0070711_100004654 3300005439 Bacteria 8124
45 Ga0070711_100538026 3300005439 Unclassified 968
46 Ga0070705_100469504 3300005440 Unclassified 948
47 Ga0070700_100202850 3300005441 Bacteria 1394
48 Ga0070700_100321822 3300005441 Bacteria 1136
49 Ga0070694_100004037 3300005444 Bacteria 8798
50 Ga0070694_100086856 3300005444 Bacteria 2186
51 Ga0070694_100213919 3300005444 Bacteria 1443
52 Ga0070708_100000308 3300005445 Bacteria 36695
53 Ga0070708_100081753 3300005445 Bacteria 2925
54 Ga0070708_100092617 3300005445 Bacteria 2753
55 Ga0070708_100394649 3300005445 Bacteria 1305
56 Ga0070663_100136087 3300005455 Unclassified 1871
57 Ga0070678_100403208 3300005456 Bacteria 1188
58 Ga0070662_100012561 3300005457 Bacteria 5617
59 Ga0070662_100339867 3300005457 Bacteria 1228
60 Ga0070681_10000487 3300005458 Bacteria 32364
61 Ga0070681_10001575 3300005458 Bacteria 20246
62 Ga0070681_10059952 3300005458 Bacteria 3784
63 Ga0070681_10145738 3300005458 Bacteria 2297
64 Ga0068867_100035566 3300005459 Bacteria 3614
65 Ga0068867_100441682 3300005459 Bacteria 1106
66 Ga0070706_100423767 3300005467 Bacteria 1238
67 Ga0070706_100486725 3300005467 Unclassified 1148
68 Ga0070706_101480580 3300005467 Unclassified 621
69 Ga0070707_100001652 3300005468 Bacteria 21586
70 Ga0070707_100425814 3300005468 Unclassified 1288
71 Ga0070698_100014088 3300005471 Bacteria 8455
72 Ga0070698_100748306 3300005471 Bacteria 920
73 Ga0070699_100065319 3300005518 Bacteria 3158
74 Ga0070699_100687415 3300005518 Unclassified 934
75 Ga0070699_100801665 3300005518 Unclassified 862
76 Ga0070679_100000208 3300005530 Bacteria 47947
77 Ga0070679_100051815 3300005530 Bacteria 4089
78 Ga0070679_100107927 3300005530 Bacteria 2770
79 Ga0070684_100007396 3300005535 Bacteria 8537
80 Ga0070697_100039857 3300005536 Bacteria 3799
81 Ga0070697_100228790 3300005536 Bacteria 1586
82 Ga0070697_100360609 3300005536 Bacteria 1256
83 Ga0070697_100481525 3300005536 Bacteria 1084
84 Ga0070697_100628261 3300005536 Bacteria 945
85 Ga0070697_101627276 3300005536 Unclassified 577
86 Ga0068853_100045838 3300005539 Bacteria 3747
87 Ga0070672_100804476 3300005543 Unclassified 827
88 Ga0070686_100111466 3300005544 Bacteria 1865
89 Ga0070686_100164662 3300005544 Unclassified 1564
90 Ga0070686_100481547 3300005544 Unclassified 960
91 Ga0070695_100005117 3300005545 Bacteria 7732
92 Ga0070696_100232090 3300005546 Bacteria 1388
93 Ga0070696_101006157 3300005546 Unclassified 697
94 Ga0070693_100101509 3300005547 Bacteria 1753
95 Ga0070693_100314155 3300005547 Bacteria 1061
96 Ga0070693_100329858 3300005547 Unclassified 1038
97 Ga0070693_100355243 3300005547 Bacteria 1004
98 Ga0070665_100103598 3300005548 Bacteria 2848
99 Ga0070704_100151633 3300005549 Bacteria 1823
100 Ga0070704_100463592 3300005549 Bacteria 1093
101 Ga0068855_100028746 3300005563 Bacteria 6651
102 Ga0070664_100002711 3300005564 Bacteria 14296
103 Ga0068857_100420845 3300005577 Bacteria 1245
104 Ga0068857_100831113 3300005577 Unclassified 883
105 Ga0068854_100075017 3300005578 Bacteria 2482
106 Ga0068854_100662100 3300005578 Bacteria 897
107 Ga0068854_101342151 3300005578 Bacteria 645
108 Ga0068856_100017514 3300005614 Bacteria 6941
109 Ga0068856_100243464 3300005614 Bacteria 1813
110 Ga0070702_100237306 3300005615 Bacteria 1229
111 Ga0070702_100901480 3300005615 Unclassified 692
112 Ga0068852_100871306 3300005616 Unclassified 917
113 Ga0068866_10040968 3300005718 Bacteria 2295
114 Ga0068866_10221346 3300005718 Unclassified 1142
115 Ga0068861_100154261 3300005719 Bacteria 1887
116 Ga0068861_101866983 3300005719 Bacteria 597
117 Ga0068858_100376054 3300005842 Unclassified 1363
118 Ga0068860_102248800 3300005843 Unclassified 566
119 Ga0081539_10013035 3300005985 Bacteria 6307
120 Ga0070717_10124064 3300006028 Unclassified 2215
121 Ga0070717_10998982 3300006028 Unclassified 762
122 Ga0070717_11274867 3300006028 Unclassified 668
123 Ga0070717_11613630 3300006028 Unclassified 588
124 Ga0070715_10000043 3300006163 Bacteria 60239
125 Ga0070715_10023075 3300006163 Unclassified 2433
126 Ga0070715_10473300 3300006163 Unclassified 712
127 Ga0070716_100010084 3300006173 Bacteria 4727
128 Ga0070716_100201304 3300006173 Unclassified 1324
129 Ga0070712_100012370 3300006175 Bacteria 5424
130 Ga0070712_101790004 3300006175 Unclassified 538
131 Ga0097621_100197787 3300006237 Unclassified 1743
132 Ga0068871_100022359 3300006358 Bacteria 4874
133 Ga0068871_100902191 3300006358 Bacteria 819
134 Ga0075428_102191088 3300006844 Unclassified 570
135 Ga0075431_100055230 3300006847 Bacteria 4096
136 Ga0075433_10048232 3300006852 Bacteria 3703
137 Ga0075434_100003975 3300006871 Bacteria 13242
138 Ga0075434_100010466 3300006871 Bacteria 8696
139 Ga0075434_100043728 3300006871 Bacteria 4443
140 Ga0075429_100565034 3300006880 Unclassified 997
141 Ga0068865_100131120 3300006881 Bacteria 1878
142 Ga0075436_100451731 3300006914 Unclassified 936
143 Ga0075436_100501661 3300006914 Bacteria 888
144 Ga0075435_100152652 3300007076 Unclassified 1942
145 Ga0075435_100204277 3300007076 Unclassified 1675
146 Ga0075435_101551711 3300007076 Unclassified 581
147 Ga0099794_10009305 3300007265 Bacteria 4124
148 Ga0099795_10046904 3300007788 Bacteria 1559
149 Ga0099795_10205945 3300007788 Unclassified 832
150 Ga0099795_10310181 3300007788 Bacteria 696
151 Ga0105240_10111802 3300009093 Bacteria 3303
152 Ga0111539_12623162 3300009094 Bacteria 584
153 Ga0105245_10072050 3300009098 Bacteria 3138
154 Ga0105245_10102112 3300009098 Bacteria 2655
155 Ga0105245_10152190 3300009098 Bacteria 2188
156 Ga0105245_10157372 3300009098 Bacteria 2153
157 Ga0105245_10549878 3300009098 Bacteria 1176
158 Ga0114129_10047707 3300009147 Bacteria 6017
159 Ga0114129_10536549 3300009147 Bacteria 1523
160 Ga0114129_11002634 3300009147 Bacteria 1052
161 Ga0114129_11360666 3300009147 Bacteria 877
162 Ga0114129_11560863 3300009147 Unclassified 809
163 Ga0114129_12649766 3300009147 Unclassified 598
164 Ga0105243_10412772 3300009148 Bacteria 1257
165 Ga0105243_10712970 3300009148 Bacteria 979
166 Ga0105243_11963207 3300009148 Unclassified 619
167 Ga0105241_10305184 3300009174 Unclassified 1367
168 Ga0105242_10195790 3300009176 Bacteria 1792
169 Ga0105248_10909607 3300009177 Unclassified 994
170 Ga0105237_10171392 3300009545 Bacteria 2170
171 Ga0105237_11141344 3300009545 Unclassified 786
172 Ga0105249_10012963 3300009553 Bacteria 7357
173 Ga0099796_10033212 3300010159 Bacteria 1696
174 Ga0105239_10088081 3300010375 Bacteria 3423
175 Ga0105239_10244714 3300010375 Bacteria 2013
176 Ga0157373_10194164 3300013100 Bacteria 1431
177 Ga0157373_10330424 3300013100 Bacteria 1085
178 Ga0157373_11017761 3300013100 Unclassified 619
179 Ga0157371_10482651 3300013102 Unclassified 914
180 Ga0157378_10054803 3300013297 Bacteria 3551
181 Ga0157378_10099051 3300013297 Bacteria 2659
182 Ga0157378_10118713 3300013297 Bacteria 2435
183 Ga0157378_10305948 3300013297 Bacteria 1540
184 Ga0157378_10533584 3300013297 Bacteria 1177
185 Ga0157378_10616611 3300013297 Bacteria 1098
186 Ga0157372_10006243 3300013307 Bacteria 12673
187 Ga0157372_13240771 3300013307 Unclassified 519
188 Ga0157375_11525185 3300013308 Bacteria 789
189 Ga0157380_11552472 3300014326 Unclassified 716
190 Ga0157379_10981310 3300014968 Archaea 805
191 Ga0157376_10000037 3300014969 Bacteria 138129
192 Ga0163161_10270638 3300017792 Bacteria 1329
193 Ga0213873_10024808 3300021358 Bacteria 1442
194 Ga0224572_1012931 3300024225 Unclassified 1591
195 Ga0207692_10081582 3300025898 Unclassified 1731
196 Ga0207642_10015472 3300025899 Bacteria 2843
197 Ga0207642_10267133 3300025899 Unclassified 978
198 Ga0207685_10000038 3300025905 Bacteria 61306
199 Ga0207699_10064486 3300025906 Bacteria 2216
200 Ga0207645_10008567 3300025907 Bacteria 7125
201 Ga0207684_10292862 3300025910 Bacteria 1403
202 Ga0207684_10460699 3300025910 Bacteria 1091
203 Ga0207707_10000044 3300025912 Bacteria 122847
204 Ga0207707_10005095 3300025912 Bacteria 11524
205 Ga0207707_10349784 3300025912 Bacteria 1273
206 Ga0207707_10401839 3300025912 Unclassified 1176
207 Ga0207695_10935526 3300025913 Unclassified 746
208 Ga0207671_10133754 3300025914 Bacteria 1905
209 Ga0207671_10740002 3300025914 Unclassified 781
210 Ga0207693_10018956 3300025915 Bacteria 5477
211 Ga0207693_10177174 3300025915 Bacteria 1678
212 Ga0207663_10022861 3300025916 Bacteria 3580
213 Ga0207663_10035915 3300025916 Bacteria 2977
214 Ga0207660_10002794 3300025917 Bacteria 11438
215 Ga0207660_10023820 3300025917 Bacteria 4138
216 Ga0207660_11095633 3300025917 Unclassified 649
217 Ga0207660_11169681 3300025917 Unclassified 626
218 Ga0207660_11460106 3300025917 Unclassified 553
219 Ga0207662_10003812 3300025918 Bacteria 7829
220 Ga0207652_10000179 3300025921 Bacteria 67330
221 Ga0207652_10032586 3300025921 Bacteria 4383
222 Ga0207652_10142083 3300025921 Bacteria 2147
223 Ga0207646_10010452 3300025922 Bacteria 9065
224 Ga0207646_10130086 3300025922 Bacteria 2265
225 Ga0207646_10286397 3300025922 Bacteria 1489
226 Ga0207646_11217367 3300025922 Unclassified 660
227 Ga0207687_10185685 3300025927 Bacteria 1614
228 Ga0207687_10503562 3300025927 Bacteria 1011
229 Ga0207687_10549259 3300025927 Unclassified 969
230 Ga0207687_11122786 3300025927 Eukaryota 675
231 Ga0207700_10090951 3300025928 Bacteria 2410
232 Ga0207700_10440750 3300025928 Bacteria 1147
233 Ga0207664_10000762 3300025929 Bacteria 21869
234 Ga0207664_10465123 3300025929 Bacteria 1130
235 Ga0207644_10359254 3300025931 Bacteria 1184
236 Ga0207644_10471182 3300025931 Bacteria 1033
237 Ga0207690_10644810 3300025932 Unclassified 867
238 Ga0207706_10031835 3300025933 Bacteria 4698
239 Ga0207706_11526576 3300025933 Unclassified 544
240 Ga0207686_10204147 3300025934 Bacteria 1417
241 Ga0207709_10155115 3300025935 Bacteria 1590
242 Ga0207709_10792223 3300025935 Unclassified 764
243 Ga0207669_10661670 3300025937 Unclassified 855
244 Ga0207669_11802540 3300025937 Unclassified 523
245 Ga0207704_10035272 3300025938 Bacteria 2865
246 Ga0207665_10053358 3300025939 Bacteria 2725
247 Ga0207665_10200122 3300025939 Unclassified 1455
248 Ga0207665_10209665 3300025939 Unclassified 1423
249 Ga0207665_11450318 3300025939 Unclassified 546
250 Ga0207661_10013533 3300025944 Bacteria 5958
251 Ga0207679_10674944 3300025945 Unclassified 936
252 Ga0207667_10061469 3300025949 Bacteria 3929
253 Ga0207667_10968635 3300025949 Bacteria 839
254 Ga0207712_10020698 3300025961 Unclassified 4311
255 Ga0207712_10699590 3300025961 Bacteria 884
256 Ga0207668_10791121 3300025972 Bacteria 839
257 Ga0207640_10374496 3300025981 Bacteria 1152
258 Ga0207677_10217369 3300026023 Bacteria 1530
259 Ga0207639_10179164 3300026041 Bacteria 1801
260 Ga0207639_11271922 3300026041 Unclassified 690
261 Ga0207678_10928863 3300026067 Unclassified 770
262 Ga0207702_10244514 3300026078 Bacteria 1682
263 Ga0207641_10235159 3300026088 Bacteria 1705
264 Ga0207648_10050789 3300026089 Bacteria 3625
265 Ga0207648_10197322 3300026089 Bacteria 1785
266 Ga0207676_10645555 3300026095 Bacteria 1021
267 Ga0207674_10614976 3300026116 Bacteria 1049
268 Ga0207675_100420108 3300026118 Bacteria 1320
269 Ga0207683_10076845 3300026121 Bacteria 2956
270 Ga0207698_10568526 3300026142 Bacteria 1114
271 Ga0209973_1022243 3300027252 Bacteria 850
272 Ga0209179_1003208 3300027512 Bacteria 2326
273 Ga0209968_1017071 3300027526 Bacteria 1156
274 Ga0209588_1022325 3300027671 Unclassified 1991
275 Ga0209974_10126243 3300027876 Unclassified 910
276 Ga0268266_10049099 3300028379 Bacteria 3618
277 Ga0268265_10317727 3300028380 Bacteria 1409
278 Ga0268264_11135143 3300028381 Bacteria 790
279 Ga0268264_11814042 3300028381 Unclassified 620
280 Ga0265760_10011240 3300031090 Unclassified 2560
281 Ga0373928_0021316 3300035084 Bacteria 1366
282 Ga0373934_0081283 3300035086 Bacteria 1302
283 Ga0373923_0020946 3300035111 Bacteria 2547
284 Ga0373936_0044775 3300035113 Bacteria 1781
285 Ga0373941_0004088 3300035115 Bacteria 3346
286 Ga0373945_0010022 3300035116 Bacteria 3114
287 Ga0373953_0052626 3300035117 Viruses 1648
288 Ga0373943_0002941 3300035170 Bacteria 7733
289 Ga0373946_0019828 3300035171 Bacteria 2594
290 Ga0373955_0143518 3300035172 Viruses 1401
291 Ga0373955_0436345 3300035172 Unclassified 798
292 Ga0373924_0235062 3300035410 Bacteria 810
293 Ga0373935_0003420 3300035692 Bacteria 9218
294 Ga0373935_0135371 3300035692 Bacteria 1659
295 Ga0373927_0000274 3300035695 Bacteria 40519
296 Ga0373933_0027487 3300035724 Bacteria 3276
297 Ga0373947_0066227 3300035725 Bacteria 2204
298 Ga0373947_0071215 3300035725 Bacteria 2132
299 Ga0373925_0002915 3300037068 Bacteria 13489
300 Ga0373925_0306104 3300037068 Unclassified 1284
301 Ga0373925_1335481 3300037068 Unclassified 588
302 Ga0395905_0877743 3300037471 Unclassified 800
303 Ga0436364_0959599 3300037853 Bacteria 2217
304 Ga0242420_002022 3300038996 Bacteria 2831
305 Ga0436362_0372255 3300039453 Bacteria 1658
306 Ga0451787_056263 3300041441 Bacteria 1969
307 Ga0451789_0308968 3300041443 Bacteria 2088
308 Ga0451791_1768605 3300041451 Bacteria 1692
309 Ga0451793_1069359 3300041452 Bacteria 908
310 Ga0451800_1683387 3300041459 Bacteria 998
311 Ga0451837_0138885 3300041494 Bacteria 1263
312 Ga0451839_1384707 3300041496 Unclassified 564
313 Ga0451851_0822162 3300041507 Bacteria 595
314 Ga0451853_0143098 3300041512 Bacteria 966
315 Ga0451576_1745410 3300045051 Bacteria 644
316 Ga0495603_0107920 3300046455 Bacteria 1624
317 Ga0495629_0235978 3300046459 Unclassified 1260
318 Ga0495653_0311183 3300046463 Unclassified 1024
319 Ga0495653_0417968 3300046463 Viruses 849
320 Ga0495580_0124789 3300046472 Unclassified 1787
321 Ga0495580_0592851 3300046472 Unclassified 733
322 Ga0495582_0026573 3300046473 Bacteria 3173
323 Ga0495662_0024284 3300046476 Bacteria 2925
324 Ga0495664_0011513 3300046477 Bacteria 4989
325 Ga0495664_0737391 3300046477 Unclassified 581
326 Ga0495594_0087724 3300046499 Unclassified 1741
327 Ga0495618_0558801 3300046514 Unclassified 684
328 Ga0495630_0078659 3300046517 Unclassified 2487
329 Ga0495630_0900006 3300046517 Viruses 674
330 Ga0495666_0098629 3300046526 Bacteria 1377
331 Ga0495665_0082425 3300046531 Unclassified 1691
332 Ga0495586_0203804 3300046535 Unclassified 1122
333 Ga0495622_0142262 3300046557 Unclassified 1089
334 Ga0495634_0196271 3300046642 Unclassified 1256
335 Ga0495635_0178033 3300046663 Unclassified 1446
336 Ga0495588_0299511 3300046674 Unclassified 847
337 Ga0495647_0027805 3300046681 Bacteria 2081
338 Ga0495658_0009339 3300046683 Bacteria 4885
339 Ga0495613_0011591 3300046689 Bacteria 6553
340 Ga0495624_0105078 3300046690 Unclassified 1738
341 Ga0495604_0784841 3300047317 Unclassified 601
342 Ga0495674_0004348 3300047319 Bacteria 13617
343 Ga0495674_0130181 3300047319 Bacteria 2120
344 Ga0495676_0331506 3300047321 Unclassified 1020
345 Ga0495684_0168216 3300047471 Unclassified 1632
346 Ga0495593_0103126 3300047673 Unclassified 1462
347 Ga0495614_0070784 3300048089 Unclassified 1503
348 Ga0496102_0009810 3300048905 Bacteria 8235
349 Ga0496104_1282619 3300048907 Unclassified 636
350 Ga0496105_0502368 3300048908 Unclassified 952
351 Ga0496110_0248139 3300048913 Bacteria 1620
352 Ga0496111_1144415 3300048914 Bacteria 553
353 Ga0496112_0014560 3300048915 Bacteria 7306
354 Ga0496112_0026167 3300048915 Bacteria 5610
355 Ga0496112_0314573 3300048915 Unclassified 1511
356 Ga0496112_0567277 3300048915 Bacteria 1068
357 Ga0496112_0840204 3300048915 Unclassified 842
358 Ga0496114_0063414 3300048917 Bacteria 3094
359 Ga0496115_0764607 3300048918 Unclassified 754
360 nmdc:mga05p37_1001746_c1 3300050507 Bacteria 887
361 nmdc:mga05p37_142264_c1 3300050507 Bacteria 2938
362 nmdc:mga05p37_496541_c1 3300050507 Bacteria 1402
363 nmdc:mga0qj67_333365_c1 3300050509 Unclassified 1227
364 nmdc:mga06r32_954683_c1 3300050510 Bacteria 812
365 nmdc:mga0n895_104976_c1 3300050512 Bacteria 2838
366 nmdc:mga0n895_15808_c1 3300050512 Bacteria 6901
367 nmdc:mga0n895_570312_c1 3300050512 Bacteria 1136
368 nmdc:mga0n895_66938_c1 3300050512 Unclassified 3556
369 nmdc:mga0rr50_1306994_c1 3300050513 Bacteria 615
370 nmdc:mga0rr50_735796_c1 3300050513 Unclassified 842
371 nmdc:mga08x19_157711_c1 3300050514 Bacteria 1540
372 nmdc:mga08x19_83490_c1 3300050514 Bacteria 2100
373 nmdc:mga08x19_842318_c1 3300050514 Unclassified 651
374 nmdc:mga0a205_276133_c1 3300050515 Bacteria 1556
375 nmdc:mga0a205_41290_c1 3300050515 Bacteria 4442
376 Ga0495619_0249462 3300053085 Unclassified 1230
377 Ga0500555_103417 3300053103 Bacteria 721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_0138885 Ga0451837_0138885_881_1252 117
2 3300025914 Ga0207671_10133754 Ga0207671_101337543 118
3 3300005547 Ga0070693_100355243 Ga0070693_1003552431 120
4 3300005718 Ga0068866_10221346 Ga0068866_102213462 120
5 3300005719 Ga0068861_101866983 Ga0068861_1018669832 120
6 3300009098 Ga0105245_10549878 Ga0105245_105498781 120
7 3300009176 Ga0105242_10195790 Ga0105242_101957902 120
8 3300013297 Ga0157378_10305948 Ga0157378_103059482 120
9 3300013308 Ga0157375_11525185 Ga0157375_115251851 120
10 3300025899 Ga0207642_10267133 Ga0207642_102671332 120
11 3300025927 Ga0207687_11122786 Ga0207687_111227861 120
12 3300025934 Ga0207686_10204147 Ga0207686_102041471 120
13 3300041496 Ga0451839_1384707 Ga0451839_1384707_130_510 120
14 3300003203 JGI25406J46586_10039828 JGI25406J46586_100398282 125
15 3300005439 Ga0070711_100004654 Ga0070711_1000046547 125
16 3300005445 Ga0070708_100092617 Ga0070708_1000926174 125
17 3300005445 Ga0070708_100394649 Ga0070708_1003946493 125
18 3300005467 Ga0070706_100423767 Ga0070706_1004237671 125
19 3300005471 Ga0070698_100014088 Ga0070698_1000140887 125
20 3300005536 Ga0070697_100039857 Ga0070697_1000398576 125
21 3300005577 Ga0068857_100831113 Ga0068857_1008311132 125
22 3300005842 Ga0068858_100376054 Ga0068858_1003760542 125
23 3300005985 Ga0081539_10013035 Ga0081539_100130353 125
24 3300006028 Ga0070717_10124064 Ga0070717_101240642 125
25 3300006163 Ga0070715_10000043 Ga0070715_1000004343 125
26 3300006163 Ga0070715_10023075 Ga0070715_100230755 125
27 3300006175 Ga0070712_100012370 Ga0070712_1000123703 125
28 3300006237 Ga0097621_100197787 Ga0097621_1001977871 125
29 3300006358 Ga0068871_100022359 Ga0068871_1000223591 125
30 3300006358 Ga0068871_100902191 Ga0068871_1009021912 125
31 3300007076 Ga0075435_101551711 Ga0075435_1015517112 125
32 3300007265 Ga0099794_10009305 Ga0099794_100093052 125
33 3300007788 Ga0099795_10046904 Ga0099795_100469042 125
34 3300009147 Ga0114129_11360666 Ga0114129_113606662 125
35 3300010159 Ga0099796_10033212 Ga0099796_100332121 125
36 3300013297 Ga0157378_10616611 Ga0157378_106166112 125
37 3300014969 Ga0157376_10000037 Ga0157376_1000003722 125
38 3300021358 Ga0213873_10024808 Ga0213873_100248081 125
39 3300024225 Ga0224572_1012931 Ga0224572_10129312 125
40 3300025905 Ga0207685_10000038 Ga0207685_1000003818 125
41 3300025910 Ga0207684_10460699 Ga0207684_104606991 125
42 3300025915 Ga0207693_10018956 Ga0207693_100189562 125
43 3300025916 Ga0207663_10022861 Ga0207663_100228615 125
44 3300025916 Ga0207663_10035915 Ga0207663_100359152 125
45 3300025922 Ga0207646_10286397 Ga0207646_102863972 125
46 3300025928 Ga0207700_10440750 Ga0207700_104407502 125
47 3300025929 Ga0207664_10000762 Ga0207664_100007626 125
48 3300025929 Ga0207664_10465123 Ga0207664_104651231 125
49 3300025939 Ga0207665_11450318 Ga0207665_114503181 125
50 3300026116 Ga0207674_10614976 Ga0207674_106149762 125
51 3300027512 Ga0209179_1003208 Ga0209179_10032082 125
52 3300027671 Ga0209588_1022325 Ga0209588_10223251 125
53 3300028381 Ga0268264_11814042 Ga0268264_118140422 125
54 3300031090 Ga0265760_10011240 Ga0265760_100112404 125
55 3300035113 Ga0373936_0044775 Ga0373936_0044775_529_924 125
56 3300035172 Ga0373955_0143518 Ga0373955_0143518_687_1082 125
57 3300039453 Ga0436362_0372255 Ga0436362_0372255_769_1164 125
58 3300041441 Ga0451787_056263 Ga0451787_056263_1164_1562 125
59 3300041443 Ga0451789_0308968 Ga0451789_0308968_1201_1599 125
60 3300041451 Ga0451791_1768605 Ga0451791_1768605_1022_1420 125
61 3300041452 Ga0451793_1069359 Ga0451793_1069359_155_553 125
62 3300041507 Ga0451851_0822162 Ga0451851_0822162_80_478 125
63 3300046463 Ga0495653_0417968 Ga0495653_0417968_26_421 125
64 3300048917 Ga0496114_0063414 Ga0496114_0063414_2619_3011 125
65 3300048918 Ga0496115_0764607 Ga0496115_0764607_257_649 125
66 2209111006 2214936887 2213999740 126
67 3300005334 Ga0068869_100851797 Ga0068869_1008517971 126
68 3300005337 Ga0070682_101157446 Ga0070682_1011574461 126
69 3300005455 Ga0070663_100136087 Ga0070663_1001360872 126
70 3300005457 Ga0070662_100012561 Ga0070662_1000125614 126
71 3300005548 Ga0070665_100103598 Ga0070665_1001035982 126
72 3300009147 Ga0114129_10536549 Ga0114129_105365492 126
73 3300025933 Ga0207706_10031835 Ga0207706_100318355 126
74 3300025935 Ga0207709_10792223 Ga0207709_107922232 126
75 3300025937 Ga0207669_11802540 Ga0207669_118025401 126
76 3300026067 Ga0207678_10928863 Ga0207678_109288632 126
77 3300028379 Ga0268266_10049099 Ga0268266_100490993 126
78 3300028380 Ga0268265_10317727 Ga0268265_103177272 126
79 3300050507 nmdc:mga05p37_496541_c1 nmdc:mga05p37_496541_c1_471_884 126
80 3300004799 Ga0058863_11979021 Ga0058863_119790212 127
81 3300005290 Ga0065712_10084450 Ga0065712_100844505 127
82 3300005293 Ga0065715_10458150 Ga0065715_104581502 127
83 3300005293 Ga0065715_10591011 Ga0065715_105910111 127
84 3300005336 Ga0070680_100002673 Ga0070680_10000267314 127
85 3300005337 Ga0070682_100979812 Ga0070682_1009798121 127
86 3300005338 Ga0068868_101663259 Ga0068868_1016632592 127
87 3300005355 Ga0070671_101043446 Ga0070671_1010434462 127
88 3300005365 Ga0070688_100415489 Ga0070688_1004154891 127
89 3300005436 Ga0070713_100044629 Ga0070713_1000446293 127
90 3300005436 Ga0070713_101117774 Ga0070713_1011177742 127
91 3300005439 Ga0070711_100538026 Ga0070711_1005380261 127
92 3300005440 Ga0070705_100469504 Ga0070705_1004695042 127
93 3300005444 Ga0070694_100004037 Ga0070694_1000040377 127
94 3300005444 Ga0070694_100086856 Ga0070694_1000868562 127
95 3300005458 Ga0070681_10000487 Ga0070681_1000048717 127
96 3300005467 Ga0070706_100486725 Ga0070706_1004867252 127
97 3300005468 Ga0070707_100425814 Ga0070707_1004258141 127
98 3300005530 Ga0070679_100000208 Ga0070679_10000020827 127
99 3300005536 Ga0070697_100481525 Ga0070697_1004815251 127
100 3300005539 Ga0068853_100045838 Ga0068853_1000458383 127
101 3300005546 Ga0070696_101006157 Ga0070696_1010061572 127
102 3300005547 Ga0070693_100314155 Ga0070693_1003141552 127
103 3300005578 Ga0068854_101342151 Ga0068854_1013421512 127
104 3300005614 Ga0068856_100017514 Ga0068856_1000175145 127
105 3300005616 Ga0068852_100871306 Ga0068852_1008713062 127
106 3300006028 Ga0070717_11274867 Ga0070717_112748671 127
107 3300006028 Ga0070717_11613630 Ga0070717_116136301 127
108 3300006163 Ga0070715_10473300 Ga0070715_104733002 127
109 3300006844 Ga0075428_102191088 Ga0075428_1021910882 127
110 3300006847 Ga0075431_100055230 Ga0075431_1000552305 127
111 3300006871 Ga0075434_100010466 Ga0075434_1000104663 127
112 3300006871 Ga0075434_100043728 Ga0075434_1000437285 127
113 3300007076 Ga0075435_100152652 Ga0075435_1001526523 127
114 3300007076 Ga0075435_100204277 Ga0075435_1002042772 127
115 3300009094 Ga0111539_12623162 Ga0111539_126231622 127
116 3300009098 Ga0105245_10152190 Ga0105245_101521902 127
117 3300009147 Ga0114129_11002634 Ga0114129_110026342 127
118 3300009147 Ga0114129_11560863 Ga0114129_115608632 127
119 3300009148 Ga0105243_10412772 Ga0105243_104127723 127
120 3300009148 Ga0105243_10712970 Ga0105243_107129702 127
121 3300009174 Ga0105241_10305184 Ga0105241_103051842 127
122 3300009177 Ga0105248_10909607 Ga0105248_109096072 127
123 3300009545 Ga0105237_10171392 Ga0105237_101713923 127
124 3300009553 Ga0105249_10012963 Ga0105249_100129637 127
125 3300010375 Ga0105239_10244714 Ga0105239_102447143 127
126 3300013297 Ga0157378_10533584 Ga0157378_105335841 127
127 3300014968 Ga0157379_10981310 Ga0157379_109813102 127
128 3300025898 Ga0207692_10081582 Ga0207692_100815822 127
129 3300025912 Ga0207707_10000044 Ga0207707_1000004498 127
130 3300025915 Ga0207693_10177174 Ga0207693_101771742 127
131 3300025917 Ga0207660_10002794 Ga0207660_100027946 127
132 3300025921 Ga0207652_10000179 Ga0207652_1000017927 127
133 3300025922 Ga0207646_11217367 Ga0207646_112173671 127
134 3300025927 Ga0207687_10549259 Ga0207687_105492592 127
135 3300025928 Ga0207700_10090951 Ga0207700_100909512 127
136 3300025935 Ga0207709_10155115 Ga0207709_101551151 127
137 3300025939 Ga0207665_10200122 Ga0207665_102001222 127
138 3300025961 Ga0207712_10020698 Ga0207712_100206981 127
139 3300025961 Ga0207712_10699590 Ga0207712_106995902 127
140 3300026041 Ga0207639_10179164 Ga0207639_101791643 127
141 3300026078 Ga0207702_10244514 Ga0207702_102445143 127
142 3300026088 Ga0207641_10235159 Ga0207641_102351594 127
143 3300026095 Ga0207676_10645555 Ga0207676_106455552 127
144 3300026142 Ga0207698_10568526 Ga0207698_105685262 127
145 3300035172 Ga0373955_0436345 Ga0373955_0436345_171_569 127
146 3300035725 Ga0373947_0071215 Ga0373947_0071215_862_1260 127
147 3300037068 Ga0373925_0306104 Ga0373925_0306104_184_582 127
148 3300037471 Ga0395905_0877743 Ga0395905_0877743_11_415 127
149 3300038996 Ga0242420_002022 Ga0242420_002022_94_498 127
150 3300045051 Ga0451576_1745410 Ga0451576_1745410_62_466 127
151 3300046455 Ga0495603_0107920 Ga0495603_0107920_1049_1447 127
152 3300046459 Ga0495629_0235978 Ga0495629_0235978_441_839 127
153 3300046463 Ga0495653_0311183 Ga0495653_0311183_267_665 127
154 3300046472 Ga0495580_0124789 Ga0495580_0124789_924_1322 127
155 3300046473 Ga0495582_0026573 Ga0495582_0026573_2725_3123 127
156 3300046476 Ga0495662_0024284 Ga0495662_0024284_394_792 127
157 3300046477 Ga0495664_0737391 Ga0495664_0737391_44_442 127
158 3300046499 Ga0495594_0087724 Ga0495594_0087724_259_657 127
159 3300046514 Ga0495618_0558801 Ga0495618_0558801_132_530 127
160 3300046517 Ga0495630_0078659 Ga0495630_0078659_792_1190 127
161 3300046526 Ga0495666_0098629 Ga0495666_0098629_584_982 127
162 3300046531 Ga0495665_0082425 Ga0495665_0082425_939_1337 127
163 3300046535 Ga0495586_0203804 Ga0495586_0203804_455_853 127
164 3300046557 Ga0495622_0142262 Ga0495622_0142262_53_451 127
165 3300046642 Ga0495634_0196271 Ga0495634_0196271_502_900 127
166 3300046663 Ga0495635_0178033 Ga0495635_0178033_1027_1425 127
167 3300046674 Ga0495588_0299511 Ga0495588_0299511_115_513 127
168 3300046681 Ga0495647_0027805 Ga0495647_0027805_1116_1514 127
169 3300046683 Ga0495658_0009339 Ga0495658_0009339_1626_2024 127
170 3300046689 Ga0495613_0011591 Ga0495613_0011591_4572_4970 127
171 3300046690 Ga0495624_0105078 Ga0495624_0105078_230_628 127
172 3300047319 Ga0495674_0004348 Ga0495674_0004348_121_519 127
173 3300047321 Ga0495676_0331506 Ga0495676_0331506_105_503 127
174 3300047471 Ga0495684_0168216 Ga0495684_0168216_697_1095 127
175 3300047673 Ga0495593_0103126 Ga0495593_0103126_660_1058 127
176 3300048089 Ga0495614_0070784 Ga0495614_0070784_736_1134 127
177 3300048905 Ga0496102_0009810 Ga0496102_0009810_6293_6697 127
178 3300048908 Ga0496105_0502368 Ga0496105_0502368_342_737 127
179 3300048913 Ga0496110_0248139 Ga0496110_0248139_622_1020 127
180 3300048914 Ga0496111_1144415 Ga0496111_1144415_56_460 127
181 3300048915 Ga0496112_0314573 Ga0496112_0314573_666_1070 127
182 3300048915 Ga0496112_0840204 Ga0496112_0840204_354_752 127
183 3300050507 nmdc:mga05p37_1001746_c1 nmdc:mga05p37_1001746_c1_180_578 127
184 3300050509 nmdc:mga0qj67_333365_c1 nmdc:mga0qj67_333365_c1_347_745 127
185 3300050510 nmdc:mga06r32_954683_c1 nmdc:mga06r32_954683_c1_368_766 127
186 3300050512 nmdc:mga0n895_104976_c1 nmdc:mga0n895_104976_c1_708_1112 127
187 3300050512 nmdc:mga0n895_570312_c1 nmdc:mga0n895_570312_c1_502_921 127
188 3300050512 nmdc:mga0n895_66938_c1 nmdc:mga0n895_66938_c1_1952_2347 127
189 3300050513 nmdc:mga0rr50_1306994_c1 nmdc:mga0rr50_1306994_c1_86_490 127
190 3300050513 nmdc:mga0rr50_735796_c1 nmdc:mga0rr50_735796_c1_239_643 127
191 3300050515 nmdc:mga0a205_276133_c1 nmdc:mga0a205_276133_c1_966_1361 127
192 3300050515 nmdc:mga0a205_41290_c1 nmdc:mga0a205_41290_c1_1654_2058 127
193 3300053085 Ga0495619_0249462 Ga0495619_0249462_235_633 127
194 3300053103 Ga0500555_103417 Ga0500555_103417_224_622 127
195 3300005544 Ga0070686_100164662 Ga0070686_1001646622 128
196 3300035116 Ga0373945_0010022 Ga0373945_0010022_517_924 129
197 3300035170 Ga0373943_0002941 Ga0373943_0002941_7139_7546 129
198 3300035171 Ga0373946_0019828 Ga0373946_0019828_2040_2447 129
199 3300035410 Ga0373924_0235062 Ga0373924_0235062_19_426 129
200 3300035692 Ga0373935_0003420 Ga0373935_0003420_7533_7940 129
201 3300035695 Ga0373927_0000274 Ga0373927_0000274_19006_19413 129
202 3300035725 Ga0373947_0066227 Ga0373947_0066227_168_575 129
203 3300037068 Ga0373925_0002915 Ga0373925_0002915_8012_8419 129
204 3300046477 Ga0495664_0011513 Ga0495664_0011513_2492_2899 129
205 3300047319 Ga0495674_0130181 Ga0495674_0130181_603_1010 129
206 3300037853 Ga0436364_0959599 Ga0436364_0959599_1202_1603 130
207 3300009147 Ga0114129_12649766 Ga0114129_126497662 131
208 3300005578 Ga0068854_100662100 Ga0068854_1006621001 132
209 3300013100 Ga0157373_11017761 Ga0157373_110177611 132
210 3300025981 Ga0207640_10374496 Ga0207640_103744962 132
211 3300041459 Ga0451800_1683387 Ga0451800_1683387_562_966 132
212 3300041512 Ga0451853_0143098 Ga0451853_0143098_68_466 132
213 3300025931 Ga0207644_10471182 Ga0207644_104711822 133
214 3300006028 Ga0070717_10998982 Ga0070717_109989822 135
215 3300004803 Ga0058862_12773115 Ga0058862_127731151 136
216 3300005344 Ga0070661_100128986 Ga0070661_1001289862 136
217 3300005435 Ga0070714_100000051 Ga0070714_1000000518 136
218 3300035086 Ga0373934_0081283 Ga0373934_0081283_268_717 136
219 3300035111 Ga0373923_0020946 Ga0373923_0020946_225_674 136
220 3300035117 Ga0373953_0052626 Ga0373953_0052626_244_693 136
221 3300035724 Ga0373933_0027487 Ga0373933_0027487_1257_1706 136
222 3300046517 Ga0495630_0900006 Ga0495630_0900006_19_468 136
223 3300047317 Ga0495604_0784841 Ga0495604_0784841_47_496 136
224 3300048907 Ga0496104_1282619 Ga0496104_1282619_73_516 136
225 3300027252 Ga0209973_1022243 Ga0209973_10222432 137
226 3300005328 Ga0070676_11203036 Ga0070676_112030361 140
227 3300005338 Ga0068868_100139312 Ga0068868_1001393124 140
228 3300009098 Ga0105245_10072050 Ga0105245_100720502 140
229 3300025927 Ga0207687_10503562 Ga0207687_105035621 140
230 2162886012 MBSR1b_contig_2170430 MBSR1b_0202.00002440 141
231 2162886012 MBSR1b_contig_890778 MBSR1b_0373.00006590 141
232 3300005293 Ga0065715_10089831 Ga0065715_100898316 141
233 3300005293 Ga0065715_10117963 Ga0065715_101179635 141
234 3300005329 Ga0070683_100000514 Ga0070683_10000051428 141
235 3300005330 Ga0070690_100365310 Ga0070690_1003653102 141
236 3300005336 Ga0070680_100041088 Ga0070680_1000410881 141
237 3300005336 Ga0070680_100099340 Ga0070680_1000993403 141
238 3300005337 Ga0070682_100015886 Ga0070682_1000158863 141
239 3300005337 Ga0070682_100187286 Ga0070682_1001872862 141
240 3300005337 Ga0070682_100435076 Ga0070682_1004350762 141
241 3300005337 Ga0070682_101119862 Ga0070682_1011198621 141
242 3300005343 Ga0070687_100396305 Ga0070687_1003963052 141
243 3300005344 Ga0070661_100541325 Ga0070661_1005413251 141
244 3300005345 Ga0070692_10004843 Ga0070692_100048437 141
245 3300005345 Ga0070692_10813215 Ga0070692_108132151 141
246 3300005347 Ga0070668_100661813 Ga0070668_1006618132 141
247 3300005353 Ga0070669_100214873 Ga0070669_1002148732 141
248 3300005354 Ga0070675_100558056 Ga0070675_1005580562 141
249 3300005356 Ga0070674_100101896 Ga0070674_1001018962 141
250 3300005364 Ga0070673_100724869 Ga0070673_1007248691 141
251 3300005366 Ga0070659_100664879 Ga0070659_1006648791 141
252 3300005434 Ga0070709_10107756 Ga0070709_101077562 141
253 3300005441 Ga0070700_100202850 Ga0070700_1002028501 141
254 3300005441 Ga0070700_100321822 Ga0070700_1003218221 141
255 3300005444 Ga0070694_100213919 Ga0070694_1002139192 141
256 3300005445 Ga0070708_100000308 Ga0070708_10000030821 141
257 3300005445 Ga0070708_100081753 Ga0070708_1000817535 141
258 3300005456 Ga0070678_100403208 Ga0070678_1004032082 141
259 3300005457 Ga0070662_100339867 Ga0070662_1003398672 141
260 3300005458 Ga0070681_10001575 Ga0070681_1000157518 141
261 3300005458 Ga0070681_10059952 Ga0070681_100599522 141
262 3300005458 Ga0070681_10145738 Ga0070681_101457382 141
263 3300005459 Ga0068867_100035566 Ga0068867_1000355664 141
264 3300005459 Ga0068867_100441682 Ga0068867_1004416822 141
265 3300005467 Ga0070706_101480580 Ga0070706_1014805801 141
266 3300005468 Ga0070707_100001652 Ga0070707_1000016522 141
267 3300005471 Ga0070698_100748306 Ga0070698_1007483062 141
268 3300005518 Ga0070699_100065319 Ga0070699_1000653192 141
269 3300005518 Ga0070699_100687415 Ga0070699_1006874151 141
270 3300005518 Ga0070699_100801665 Ga0070699_1008016651 141
271 3300005530 Ga0070679_100051815 Ga0070679_1000518155 141
272 3300005530 Ga0070679_100107927 Ga0070679_1001079273 141
273 3300005535 Ga0070684_100007396 Ga0070684_1000073966 141
274 3300005536 Ga0070697_100228790 Ga0070697_1002287902 141
275 3300005536 Ga0070697_100360609 Ga0070697_1003606092 141
276 3300005536 Ga0070697_100628261 Ga0070697_1006282611 141
277 3300005536 Ga0070697_101627276 Ga0070697_1016272761 141
278 3300005543 Ga0070672_100804476 Ga0070672_1008044762 141
279 3300005544 Ga0070686_100111466 Ga0070686_1001114662 141
280 3300005544 Ga0070686_100481547 Ga0070686_1004815471 141
281 3300005545 Ga0070695_100005117 Ga0070695_1000051176 141
282 3300005546 Ga0070696_100232090 Ga0070696_1002320901 141
283 3300005547 Ga0070693_100101509 Ga0070693_1001015094 141
284 3300005547 Ga0070693_100329858 Ga0070693_1003298582 141
285 3300005549 Ga0070704_100151633 Ga0070704_1001516334 141
286 3300005549 Ga0070704_100463592 Ga0070704_1004635922 141
287 3300005563 Ga0068855_100028746 Ga0068855_1000287465 141
288 3300005564 Ga0070664_100002711 Ga0070664_1000027116 141
289 3300005577 Ga0068857_100420845 Ga0068857_1004208452 141
290 3300005578 Ga0068854_100075017 Ga0068854_1000750172 141
291 3300005614 Ga0068856_100243464 Ga0068856_1002434641 141
292 3300005615 Ga0070702_100237306 Ga0070702_1002373062 141
293 3300005615 Ga0070702_100901480 Ga0070702_1009014801 141
294 3300005718 Ga0068866_10040968 Ga0068866_100409683 141
295 3300005719 Ga0068861_100154261 Ga0068861_1001542612 141
296 3300005843 Ga0068860_102248800 Ga0068860_1022488001 141
297 3300006173 Ga0070716_100010084 Ga0070716_1000100843 141
298 3300006173 Ga0070716_100201304 Ga0070716_1002013042 141
299 3300006175 Ga0070712_101790004 Ga0070712_1017900041 141
300 3300006852 Ga0075433_10048232 Ga0075433_100482326 141
301 3300006871 Ga0075434_100003975 Ga0075434_1000039756 141
302 3300006880 Ga0075429_100565034 Ga0075429_1005650342 141
303 3300006881 Ga0068865_100131120 Ga0068865_1001311204 141
304 3300006914 Ga0075436_100451731 Ga0075436_1004517312 141
305 3300006914 Ga0075436_100501661 Ga0075436_1005016612 141
306 3300007788 Ga0099795_10205945 Ga0099795_102059451 141
307 3300007788 Ga0099795_10310181 Ga0099795_103101811 141
308 3300009093 Ga0105240_10111802 Ga0105240_101118025 141
309 3300009098 Ga0105245_10102112 Ga0105245_101021125 141
310 3300009098 Ga0105245_10157372 Ga0105245_101573724 141
311 3300009147 Ga0114129_10047707 Ga0114129_100477074 141
312 3300009148 Ga0105243_11963207 Ga0105243_119632071 141
313 3300009545 Ga0105237_11141344 Ga0105237_111413441 141
314 3300010375 Ga0105239_10088081 Ga0105239_100880812 141
315 3300013100 Ga0157373_10194164 Ga0157373_101941642 141
316 3300013100 Ga0157373_10330424 Ga0157373_103304241 141
317 3300013102 Ga0157371_10482651 Ga0157371_104826511 141
318 3300013297 Ga0157378_10054803 Ga0157378_100548035 141
319 3300013297 Ga0157378_10099051 Ga0157378_100990512 141
320 3300013297 Ga0157378_10118713 Ga0157378_101187133 141
321 3300013307 Ga0157372_10006243 Ga0157372_100062435 141
322 3300013307 Ga0157372_13240771 Ga0157372_132407711 141
323 3300014326 Ga0157380_11552472 Ga0157380_115524721 141
324 3300017792 Ga0163161_10270638 Ga0163161_102706382 141
325 3300025899 Ga0207642_10015472 Ga0207642_100154723 141
326 3300025906 Ga0207699_10064486 Ga0207699_100644863 141
327 3300025907 Ga0207645_10008567 Ga0207645_100085675 141
328 3300025910 Ga0207684_10292862 Ga0207684_102928622 141
329 3300025912 Ga0207707_10005095 Ga0207707_100050959 141
330 3300025912 Ga0207707_10349784 Ga0207707_103497842 141
331 3300025912 Ga0207707_10401839 Ga0207707_104018392 141
332 3300025913 Ga0207695_10935526 Ga0207695_109355261 141
333 3300025914 Ga0207671_10740002 Ga0207671_107400021 141
334 3300025917 Ga0207660_10023820 Ga0207660_100238202 141
335 3300025917 Ga0207660_11095633 Ga0207660_110956331 141
336 3300025917 Ga0207660_11169681 Ga0207660_111696811 141
337 3300025917 Ga0207660_11460106 Ga0207660_114601061 141
338 3300025918 Ga0207662_10003812 Ga0207662_100038126 141
339 3300025921 Ga0207652_10032586 Ga0207652_100325862 141
340 3300025921 Ga0207652_10142083 Ga0207652_101420835 141
341 3300025922 Ga0207646_10010452 Ga0207646_1001045210 141
342 3300025922 Ga0207646_10130086 Ga0207646_101300861 141
343 3300025927 Ga0207687_10185685 Ga0207687_101856852 141
344 3300025931 Ga0207644_10359254 Ga0207644_103592541 141
345 3300025932 Ga0207690_10644810 Ga0207690_106448101 141
346 3300025933 Ga0207706_11526576 Ga0207706_115265761 141
347 3300025937 Ga0207669_10661670 Ga0207669_106616701 141
348 3300025938 Ga0207704_10035272 Ga0207704_100352722 141
349 3300025939 Ga0207665_10053358 Ga0207665_100533584 141
350 3300025939 Ga0207665_10209665 Ga0207665_102096652 141
351 3300025944 Ga0207661_10013533 Ga0207661_100135336 141
352 3300025945 Ga0207679_10674944 Ga0207679_106749441 141
353 3300025949 Ga0207667_10061469 Ga0207667_100614693 141
354 3300025949 Ga0207667_10968635 Ga0207667_109686351 141
355 3300025972 Ga0207668_10791121 Ga0207668_107911212 141
356 3300026023 Ga0207677_10217369 Ga0207677_102173691 141
357 3300026041 Ga0207639_11271922 Ga0207639_112719221 141
358 3300026089 Ga0207648_10050789 Ga0207648_100507892 141
359 3300026089 Ga0207648_10197322 Ga0207648_101973222 141
360 3300026118 Ga0207675_100420108 Ga0207675_1004201081 141
361 3300026121 Ga0207683_10076845 Ga0207683_100768455 141
362 3300027526 Ga0209968_1017071 Ga0209968_10170711 141
363 3300027876 Ga0209974_10126243 Ga0209974_101262431 141
364 3300028381 Ga0268264_11135143 Ga0268264_111351431 141
365 3300035084 Ga0373928_0021316 Ga0373928_0021316_346_771 141
366 3300035115 Ga0373941_0004088 Ga0373941_0004088_2884_3309 141
367 3300035692 Ga0373935_0135371 Ga0373935_0135371_926_1351 141
368 3300037068 Ga0373925_1335481 Ga0373925_1335481_42_467 141
369 3300046472 Ga0495580_0592851 Ga0495580_0592851_84_509 141
370 3300048915 Ga0496112_0014560 Ga0496112_0014560_3774_4199 141
371 3300048915 Ga0496112_0026167 Ga0496112_0026167_3383_3808 141
372 3300048915 Ga0496112_0567277 Ga0496112_0567277_81_506 141
373 3300050507 nmdc:mga05p37_142264_c1 nmdc:mga05p37_142264_c1_1934_2359 141
374 3300050512 nmdc:mga0n895_15808_c1 nmdc:mga0n895_15808_c1_2936_3361 141
375 3300050514 nmdc:mga08x19_157711_c1 nmdc:mga08x19_157711_c1_308_733 141
376 3300050514 nmdc:mga08x19_83490_c1 nmdc:mga08x19_83490_c1_707_1132 141
377 3300050514 nmdc:mga08x19_842318_c1 nmdc:mga08x19_842318_c1_168_593 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

139

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qlz-assembly2.cif.gz_B idol f3ab subdomain 0.8299 112 141
2i4e-assembly2.cif.gz_B structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors 0.7845 110 139
6o64-assembly3.cif.gz_E crystal structure of arabidopsis thaliana spermidine synthase isoform 2 (atspds2) 0.7839 111 137
2i5x-assembly1.cif.gz_A engineering the ptpbeta catalytic domain with improved crystallization properties 0.7828 110 139
1jq3-assembly1.cif.gz_D crystal structure of spermidine synthase in complex with transition state analogue adodato 0.782 112 137
ID Description Score Start End Superfamily
af_O57457_206_298_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8523 112 137 2.30.29.30
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.84 89 140 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8199 90 140 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8089 89 141 3.30.720.110
af_P77795_256_333_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8066 112 139 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A496NZ66-F1-model_v4 deleted 0.9346 89 140
AF-A0A0M9YF21-F1-model_v4 Glyoxalase 0.9343 92 139
AF-A0A1S2KET6-F1-model_v4 Glyoxalase-like domain-containing protein 0.9328 89 141
AF-A0A4R8W9L0-F1-model_v4 VOC domain-containing protein 0.9298 92 140
AF-A0A6L9IQR2-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9297 92 140

Feature Viewer

pLDDT pTM Quality
87.8 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map