F427622

General Info

Members Datasets Scaffolds Average Seq Length
377 205 377 245

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100486621|Ga0070697_1004866211
Length 263
Sequence MDRDPRGGRRVTRIGVVVFPGSNCDRDTLNGLELAGAEAVPLWHEQGSLDGVAAVVLPGGFAYGDYLRAGVIARFSPVMRAVAAFAAEGGLVLGICNGFQVLAEAGLVPGALLRNRGLRFLGRDVRIAAERVDTPFTALLGDGRPLRMPIAHGEGCYFADEATLDDLERGGQVLFRYVDAAGTHAGVEGDPANPNGSLRAIAGVLNARGNVAGLMPHPERASEPLLGSDDGLPILRSLVEAASRAAHEAARGAAGRAPVAVGS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.9
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10099435 3300005327 Bacteria 2403
2 Ga0070676_10215262 3300005328 Bacteria 1266
3 Ga0070683_100154456 3300005329 Bacteria 2176
4 Ga0070690_100030603 3300005330 Bacteria 3347
5 Ga0068869_100276130 3300005334 Bacteria 1350
6 Ga0070680_100000006 3300005336 Bacteria 113367
7 Ga0070680_100013646 3300005336 Bacteria 6333
8 Ga0070660_100285598 3300005339 Bacteria 1351
9 Ga0070689_100021019 3300005340 Bacteria 4852
10 Ga0070689_100192554 3300005340 Bacteria 1661
11 Ga0070691_10013198 3300005341 Bacteria 3785
12 Ga0070687_100004804 3300005343 Bacteria 5409
13 Ga0070687_100245409 3300005343 Bacteria 1110
14 Ga0070661_100073743 3300005344 Bacteria 2513
15 Ga0070692_10014742 3300005345 Bacteria 3680
16 Ga0070668_100052938 3300005347 Bacteria 3130
17 Ga0070668_100274194 3300005347 Bacteria 1407
18 Ga0070675_100002702 3300005354 Bacteria 13325
19 Ga0070674_100001116 3300005356 Bacteria 14090
20 Ga0070674_100194320 3300005356 Bacteria 1563
21 Ga0070709_10068704 3300005434 Bacteria 2280
22 Ga0070713_100122705 3300005436 Bacteria 2281
23 Ga0070710_10257005 3300005437 Bacteria 1125
24 Ga0070701_10003243 3300005438 Bacteria 6406
25 Ga0070711_100070483 3300005439 Bacteria 2461
26 Ga0070705_100142302 3300005440 Bacteria 1580
27 Ga0070705_100234111 3300005440 Bacteria 1280
28 Ga0070705_100328606 3300005440 Bacteria 1107
29 Ga0070705_100335390 3300005440 Bacteria 1097
30 Ga0070705_100380933 3300005440 Bacteria 1038
31 Ga0070700_100008655 3300005441 Bacteria 5549
32 Ga0070694_100086134 3300005444 Bacteria 2195
33 Ga0070694_100507886 3300005444 Bacteria 960
34 Ga0070708_100009795 3300005445 Bacteria 7735
35 Ga0070708_100019945 3300005445 Bacteria 5644
36 Ga0070678_100026757 3300005456 Bacteria 3906
37 Ga0070678_100103774 3300005456 Bacteria 2209
38 Ga0070662_100086261 3300005457 Bacteria 2348
39 Ga0070662_100270788 3300005457 Bacteria 1371
40 Ga0068867_100006532 3300005459 Bacteria 8236
41 Ga0068867_100641359 3300005459 Bacteria 931
42 Ga0070706_100019828 3300005467 Bacteria 6200
43 Ga0070706_100031050 3300005467 Bacteria 4926
44 Ga0070707_100010970 3300005468 Bacteria 8440
45 Ga0070707_100075401 3300005468 Bacteria 3253
46 Ga0070707_100158127 3300005468 Bacteria 2207
47 Ga0070707_100555758 3300005468 Bacteria 1110
48 Ga0070698_100011181 3300005471 Bacteria 9536
49 Ga0070698_100021889 3300005471 Bacteria 6693
50 Ga0070698_100074044 3300005471 Bacteria 3411
51 Ga0070698_100115770 3300005471 Bacteria 2645
52 Ga0070698_100168925 3300005471 Bacteria 2129
53 Ga0070699_100015400 3300005518 Bacteria 6571
54 Ga0070699_100021378 3300005518 Bacteria 5582
55 Ga0070699_100084891 3300005518 Bacteria 2763
56 Ga0070679_100248020 3300005530 Bacteria 1737
57 Ga0070684_100035818 3300005535 Bacteria 4250
58 Ga0070684_100205538 3300005535 Bacteria 1794
59 Ga0070697_100006254 3300005536 Bacteria 9218
60 Ga0070697_100035605 3300005536 Bacteria 4016
61 Ga0070697_100486621 3300005536 Bacteria 1078
62 Ga0070672_100081408 3300005543 Bacteria 2596
63 Ga0070686_100052794 3300005544 Bacteria 2593
64 Ga0070686_100311344 3300005544 Bacteria 1171
65 Ga0070695_100025586 3300005545 Bacteria 3645
66 Ga0070695_100373620 3300005545 Bacteria 1074
67 Ga0070696_100007321 3300005546 Bacteria 7370
68 Ga0070696_100069701 3300005546 Bacteria 2471
69 Ga0070696_100095257 3300005546 Bacteria 2125
70 Ga0070696_100143704 3300005546 Bacteria 1746
71 Ga0070696_100585363 3300005546 Bacteria 898
72 Ga0070704_100516470 3300005549 Bacteria 1039
73 Ga0068855_100082711 3300005563 Bacteria 3720
74 Ga0068857_100172421 3300005577 Bacteria 1966
75 Ga0068854_100413402 3300005578 Bacteria 1119
76 Ga0068856_100217455 3300005614 Bacteria 1926
77 Ga0070702_100002279 3300005615 Bacteria 8215
78 Ga0070702_100136688 3300005615 Bacteria 1556
79 Ga0068852_100089976 3300005616 Bacteria 2744
80 Ga0068864_100006074 3300005618 Bacteria 9911
81 Ga0068864_100022904 3300005618 Bacteria 5241
82 Ga0068864_100350949 3300005618 Bacteria 1392
83 Ga0068861_100337355 3300005719 Bacteria 1318
84 Ga0068870_10004617 3300005840 Bacteria 5942
85 Ga0081539_10003537 3300005985 Bacteria 19008
86 Ga0068871_100334064 3300006358 Bacteria 1337
87 Ga0075428_100068180 3300006844 Bacteria 3892
88 Ga0075430_100001243 3300006846 Bacteria 20504
89 Ga0075433_10040240 3300006852 Bacteria 4045
90 Ga0075434_100259133 3300006871 Bacteria 1758
91 Ga0075429_100431147 3300006880 Bacteria 1155
92 Ga0105240_10092666 3300009093 Bacteria 3689
93 Ga0111539_10015164 3300009094 Bacteria 9601
94 Ga0111539_10447275 3300009094 Bacteria 1504
95 Ga0111539_10502260 3300009094 Bacteria 1412
96 Ga0105245_10027187 3300009098 Bacteria 5040
97 Ga0105247_10172237 3300009101 Bacteria 1440
98 Ga0114129_10085876 3300009147 Bacteria 4365
99 Ga0114129_10096952 3300009147 Bacteria 4082
100 Ga0114129_10152106 3300009147 Bacteria 3166
101 Ga0114129_10396516 3300009147 Bacteria 1819
102 Ga0105243_10004531 3300009148 Bacteria 10980
103 Ga0105243_10235303 3300009148 Bacteria 1627
104 Ga0105243_10435324 3300009148 Bacteria 1227
105 Ga0105242_10043927 3300009176 Bacteria 3617
106 Ga0105248_10118074 3300009177 Bacteria 2992
107 Ga0105248_10311486 3300009177 Bacteria 1773
108 Ga0105238_10042511 3300009551 Bacteria 4601
109 Ga0105249_10354631 3300009553 Bacteria 1487
110 Ga0105239_10007925 3300010375 Bacteria 12143
111 Ga0105246_10251041 3300011119 Bacteria 1404
112 Ga0105246_10292960 3300011119 Bacteria 1310
113 Ga0157373_10078535 3300013100 Bacteria 2327
114 Ga0157378_10044955 3300013297 Bacteria 3922
115 Ga0157378_10519997 3300013297 Bacteria 1191
116 Ga0157375_10005306 3300013308 Bacteria 11194
117 Ga0163163_10083895 3300014325 Bacteria 3192
118 Ga0163163_10295053 3300014325 Bacteria 1673
119 Ga0163163_10464084 3300014325 Bacteria 1327
120 Ga0157380_10010874 3300014326 Bacteria 6562
121 Ga0157377_10001395 3300014745 Bacteria 10417
122 Ga0157377_10376302 3300014745 Bacteria 960
123 Ga0157379_10137462 3300014968 Bacteria 2202
124 Ga0157376_10152748 3300014969 Bacteria 2084
125 Ga0157376_10248009 3300014969 Bacteria 1662
126 Ga0207688_10006583 3300025901 Bacteria 6319
127 Ga0207645_10163861 3300025907 Bacteria 1455
128 Ga0207643_10005791 3300025908 Bacteria 6604
129 Ga0207684_10014603 3300025910 Bacteria 6768
130 Ga0207684_10043015 3300025910 Bacteria 3829
131 Ga0207684_10058419 3300025910 Bacteria 3273
132 Ga0207663_10035602 3300025916 Bacteria 2988
133 Ga0207660_10000002 3300025917 Bacteria 883566
134 Ga0207660_10392390 3300025917 Bacteria 1117
135 Ga0207662_10002007 3300025918 Bacteria 10061
136 Ga0207657_10130696 3300025919 Bacteria 2058
137 Ga0207649_10033835 3300025920 Bacteria 3057
138 Ga0207652_10133475 3300025921 Bacteria 2216
139 Ga0207646_10010687 3300025922 Bacteria 8937
140 Ga0207646_10023623 3300025922 Bacteria 5645
141 Ga0207646_10353364 3300025922 Bacteria 1328
142 Ga0207659_10008112 3300025926 Bacteria 6499
143 Ga0207659_10011252 3300025926 Bacteria 5649
144 Ga0207687_10013365 3300025927 Bacteria 5360
145 Ga0207687_10122094 3300025927 Bacteria 1950
146 Ga0207687_10298773 3300025927 Bacteria 1296
147 Ga0207664_10068351 3300025929 Bacteria 2854
148 Ga0207706_10009261 3300025933 Bacteria 9048
149 Ga0207686_10027023 3300025934 Bacteria 3356
150 Ga0207709_10077442 3300025935 Bacteria 2132
151 Ga0207670_10009148 3300025936 Bacteria 5634
152 Ga0207669_10007236 3300025937 Bacteria 5117
153 Ga0207691_10074397 3300025940 Bacteria 3064
154 Ga0207691_10415848 3300025940 Bacteria 1146
155 Ga0207689_10288508 3300025942 Bacteria 1359
156 Ga0207689_10342385 3300025942 Bacteria 1242
157 Ga0207661_10076129 3300025944 Bacteria 2755
158 Ga0207651_10205393 3300025960 Bacteria 1582
159 Ga0207712_10132845 3300025961 Bacteria 1899
160 Ga0207668_10037695 3300025972 Bacteria 3238
161 Ga0207640_10441763 3300025981 Bacteria 1070
162 Ga0207703_10023793 3300026035 Bacteria 4818
163 Ga0207703_10837083 3300026035 Bacteria 880
164 Ga0207639_10036829 3300026041 Bacteria 3629
165 Ga0207678_10040635 3300026067 Bacteria 4033
166 Ga0207678_10324374 3300026067 Bacteria 1325
167 Ga0207708_10005128 3300026075 Bacteria 9664
168 Ga0207648_10003076 3300026089 Bacteria 17627
169 Ga0207648_10123081 3300026089 Bacteria 2281
170 Ga0207648_10254482 3300026089 Bacteria 1566
171 Ga0207648_10485983 3300026089 Bacteria 1128
172 Ga0207674_10118514 3300026116 Bacteria 2617
173 Ga0207674_10292350 3300026116 Bacteria 1578
174 Ga0207675_100383301 3300026118 Bacteria 1383
175 Ga0207683_10059840 3300026121 Bacteria 3346
176 Ga0207428_10076747 3300027907 Bacteria 2616
177 Ga0268264_10043072 3300028381 Bacteria 3739
178 Ga0265326_10080493 3300028558 Bacteria 921
179 Ga0265319_1002146 3300028563 Bacteria 11037
180 Ga0265319_1002720 3300028563 Bacteria 9482
181 Ga0265334_10011577 3300028573 Bacteria 3711
182 Ga0265334_10064104 3300028573 Bacteria 1380
183 Ga0265318_10052786 3300028577 Bacteria 1525
184 Ga0265322_10026684 3300028654 Bacteria 1651
185 Ga0265336_10009022 3300028666 Bacteria 3466
186 Ga0265336_10020138 3300028666 Bacteria 2145
187 Ga0265338_10322531 3300028800 Bacteria 1118
188 Ga0265338_10515523 3300028800 Bacteria 840
189 Ga0265324_10040497 3300029957 Bacteria 1613
190 Ga0265324_10098792 3300029957 Bacteria 992
191 Ga0265330_10026128 3300031235 Bacteria 2644
192 Ga0265332_10006274 3300031238 Bacteria 5409
193 Ga0265332_10025180 3300031238 Bacteria 2615
194 Ga0265332_10167501 3300031238 Bacteria 917
195 Ga0265320_10001931 3300031240 Bacteria 14633
196 Ga0265325_10014131 3300031241 Bacteria 4522
197 Ga0265329_10025054 3300031242 Bacteria 1977
198 Ga0265340_10001279 3300031247 Bacteria 14428
199 Ga0265340_10019890 3300031247 Bacteria 3454
200 Ga0265331_10003332 3300031250 Bacteria 10423
201 Ga0265316_10031165 3300031344 Bacteria 4363
202 Ga0265316_10127825 3300031344 Bacteria 1915
203 Ga0265313_10081735 3300031595 Bacteria 1466
204 Ga0265313_10113548 3300031595 Bacteria 1189
205 Ga0265314_10003728 3300031711 Bacteria 14585
206 Ga0265314_10040976 3300031711 Bacteria 3319
207 Ga0265314_10114407 3300031711 Bacteria 1709
208 Ga0265342_10063654 3300031712 Bacteria 2167
209 Ga0265342_10140192 3300031712 Bacteria 1349
210 Ga0265342_10175728 3300031712 Bacteria 1175
211 Ga0307413_10102376 3300031824 Bacteria 1896
212 Ga0307413_10304684 3300031824 Bacteria 1210
213 Ga0307410_10177816 3300031852 Bacteria 1609
214 Ga0307410_10564250 3300031852 Bacteria 945
215 Ga0307406_10299857 3300031901 Bacteria 1234
216 Ga0307416_100001579 3300032002 Bacteria 12493
217 Ga0307416_100730615 3300032002 Bacteria 1081
218 Ga0373940_0064254 3300035088 Bacteria 1056
219 Ga0373949_0014272 3300035090 Bacteria 1768
220 Ga0373952_0015928 3300035092 Bacteria 1523
221 Ga0373941_0047881 3300035115 Bacteria 1348
222 Ga0373937_0103225 3300036401 Bacteria 2648
223 Ga0373937_0654663 3300036401 Bacteria 996
224 Ga0395899_0016085 3300037312 Bacteria 5702
225 Ga0395900_0132156 3300037418 Bacteria 2557
226 Ga0395898_0002944 3300037466 Bacteria 19369
227 Ga0395905_0033927 3300037471 Bacteria 4793
228 Ga0395901_0287322 3300038443 Bacteria 1707
229 Ga0395901_0697613 3300038443 Unclassified 1013
230 Ga0439466_0028087 3300041411 Bacteria 1944
231 Ga0451853_0666768 3300041512 Bacteria 907
232 Ga0451853_3677978 3300041512 Bacteria 1590
233 Ga0451577_0365770 3300042876 Bacteria 1308
234 Ga0451577_0561922 3300042876 Bacteria 1036
235 Ga0453683_0030622 3300044673 Bacteria 3402
236 Ga0466964_0064495 3300044706 Bacteria 1532
237 Ga0451576_0151431 3300045051 Bacteria 2419
238 Ga0466967_0008183 3300045976 Bacteria 7636
239 Ga0466967_0020259 3300045976 Bacteria 5370
240 Ga0495656_0128744 3300046615 Bacteria 1203
241 Ga0496101_0422575 3300048904 Bacteria 1051
242 Ga0496102_0701707 3300048905 Bacteria 935
243 Ga0496102_0904613 3300048905 Bacteria 804
244 Ga0496104_0042465 3300048907 Bacteria 4267
245 Ga0496104_0080727 3300048907 Bacteria 3101
246 Ga0496105_0008043 3300048908 Bacteria 8195
247 Ga0496105_0090094 3300048908 Bacteria 2534
248 Ga0496105_0250320 3300048908 Bacteria 1436
249 Ga0496106_0500162 3300048909 Bacteria 976
250 Ga0496106_0667194 3300048909 Bacteria 830
251 Ga0496107_0113233 3300048910 Bacteria 1995
252 Ga0496108_0004201 3300048911 Bacteria 11602
253 Ga0496109_0002639 3300048912 Bacteria 15031
254 Ga0496109_0007211 3300048912 Bacteria 9396
255 Ga0496109_0100184 3300048912 Bacteria 2688
256 Ga0496109_0120667 3300048912 Bacteria 2442
257 Ga0496109_0334916 3300048912 Bacteria 1429
258 Ga0496109_0426531 3300048912 Bacteria 1253
259 Ga0496110_0044652 3300048913 Bacteria 3870
260 Ga0496110_0110645 3300048913 Bacteria 2468
261 Ga0496111_0109581 3300048914 Bacteria 2033
262 Ga0496112_0000007 3300048915 Bacteria 338850
263 Ga0496112_0028109 3300048915 Bacteria 5426
264 Ga0496112_0205039 3300048915 Bacteria 1930
265 Ga0496112_0530293 3300048915 Bacteria 1112
266 Ga0496114_0041985 3300048917 Bacteria 3790
267 Ga0501031_0070347 3300049568 Bacteria 2279
268 Ga0501031_0174569 3300049568 Bacteria 1404
269 Ga0501031_0194029 3300049568 Bacteria 1326
270 Ga0501032_0086547 3300049569 Bacteria 2083
271 Ga0501032_0389886 3300049569 Bacteria 895
272 Ga0501036_0015936 3300049572 Bacteria 6277
273 Ga0501036_0061123 3300049572 Bacteria 3191
274 Ga0501036_0335311 3300049572 Bacteria 1263
275 Ga0501037_0240405 3300049573 Bacteria 1269
276 Ga0501038_0166040 3300049574 Bacteria 1790
277 Ga0501039_0110986 3300049575 Bacteria 2144
278 Ga0501039_0146669 3300049575 Bacteria 1854
279 Ga0501039_0625409 3300049575 Bacteria 843
280 Ga0501040_0030658 3300049576 Bacteria 3633
281 Ga0501040_0098116 3300049576 Bacteria 2042
282 Ga0501040_0221450 3300049576 Bacteria 1346
283 Ga0501040_0275560 3300049576 Bacteria 1201
284 Ga0501041_0017737 3300049577 Bacteria 4237
285 Ga0501041_0053511 3300049577 Bacteria 2462
286 Ga0501041_0074883 3300049577 Bacteria 2081
287 Ga0501042_0127906 3300049578 Bacteria 1830
288 Ga0501042_0169745 3300049578 Bacteria 1574
289 Ga0501042_0339369 3300049578 Bacteria 1086
290 Ga0501042_0460806 3300049578 Bacteria 922
291 Ga0501043_0463687 3300049579 Bacteria 950
292 Ga0501046_0216757 3300049580 Bacteria 1419
293 Ga0501048_0071458 3300049582 Bacteria 2450
294 Ga0501048_0076481 3300049582 Bacteria 2362
295 Ga0501048_0147764 3300049582 Bacteria 1662
296 Ga0501067_0000845 3300049583 Bacteria 16504
297 Ga0501067_0078897 3300049583 Bacteria 1824
298 Ga0501068_0026448 3300049584 Bacteria 3419
299 Ga0501068_0073509 3300049584 Bacteria 2089
300 Ga0501069_0001111 3300049585 Bacteria 12988
301 Ga0501069_0082826 3300049585 Bacteria 1808
302 Ga0501070_0286394 3300049586 Bacteria 1344
303 Ga0501070_0437481 3300049586 Bacteria 1055
304 Ga0501071_0010881 3300049587 Bacteria 6105
305 Ga0501071_0017871 3300049587 Bacteria 4901
306 Ga0501071_0161569 3300049587 Bacteria 1674
307 Ga0501071_0269980 3300049587 Bacteria 1286
308 Ga0501071_0447509 3300049587 Bacteria 988
309 Ga0501072_0084222 3300049588 Bacteria 2521
310 Ga0501072_0209252 3300049588 Bacteria 1554
311 Ga0501072_0356413 3300049588 Bacteria 1161
312 Ga0501072_0502158 3300049588 Bacteria 959
313 Ga0501073_0422203 3300049589 Bacteria 922
314 Ga0501074_0020477 3300049590 Bacteria 4807
315 Ga0501074_0061186 3300049590 Bacteria 2713
316 Ga0501074_0076267 3300049590 Bacteria 2406
317 Ga0501075_0013476 3300049591 Bacteria 5835
318 Ga0501075_0040433 3300049591 Bacteria 3492
319 Ga0501075_0056751 3300049591 Bacteria 2948
320 Ga0501075_0066539 3300049591 Bacteria 2719
321 Ga0501075_0385640 3300049591 Bacteria 1068
322 Ga0501075_0476140 3300049591 Bacteria 952
323 Ga0501076_0015705 3300049592 Bacteria 5727
324 Ga0501076_0077192 3300049592 Bacteria 2672
325 Ga0501076_0113837 3300049592 Bacteria 2189
326 Ga0501076_0147972 3300049592 Bacteria 1910
327 Ga0501076_0156199 3300049592 Bacteria 1857
328 Ga0501076_0379953 3300049592 Bacteria 1161
329 Ga0501077_0072200 3300049593 Bacteria 2187
330 Ga0501077_0170891 3300049593 Bacteria 1381
331 Ga0501077_0337209 3300049593 Bacteria 962
332 Ga0501079_0013761 3300049741 Bacteria 6169
333 Ga0501079_0039886 3300049741 Bacteria 3623
334 Ga0501079_0110021 3300049741 Bacteria 2140
335 Ga0501080_0018272 3300049742 Bacteria 6488
336 Ga0501080_0186163 3300049742 Bacteria 1909
337 Ga0501080_0400947 3300049742 Bacteria 1234
338 Ga0501081_0011970 3300049743 Bacteria 5684
339 Ga0501081_0019169 3300049743 Bacteria 4551
340 Ga0501081_0330216 3300049743 Bacteria 1122
341 Ga0501081_0403047 3300049743 Bacteria 1013
342 Ga0501083_0211594 3300049744 Bacteria 1264
343 Ga0501083_0243559 3300049744 Bacteria 1171
344 Ga0501045_0010783 3300049824 Bacteria 6406
345 Ga0501045_0059527 3300049824 Bacteria 2798
346 Ga0501045_0120473 3300049824 Bacteria 1948
347 Ga0501045_0136710 3300049824 Bacteria 1822
348 Ga0501045_0150499 3300049824 Bacteria 1731
349 Ga0501045_0317674 3300049824 Bacteria 1159
350 nmdc:mga05p37_1736_c1 3300050507 Bacteria 25436
351 nmdc:mga05p37_344235_c1 3300050507 Bacteria 1757
352 nmdc:mga09592_415200_c1 3300050508 Bacteria 1163
353 nmdc:mga0qj67_9792_c1 3300050509 Bacteria 7142
354 nmdc:mga08y16_54535_c1 3300050511 Bacteria 4177
355 nmdc:mga0n895_167070_c1 3300050512 Bacteria 2232
356 nmdc:mga0n895_36114_c1 3300050512 Bacteria 4770
357 nmdc:mga0rr50_463048_c1 3300050513 Bacteria 1075
358 nmdc:mga0rr50_87068_c1 3300050513 Bacteria 2424
359 nmdc:mga08x19_148974_c1 3300050514 Bacteria 1583
360 nmdc:mga0a205_181106_c1 3300050515 Bacteria 2001
361 nmdc:mga0a205_220328_c1 3300050515 Bacteria 1783
362 nmdc:mga0a205_306793_c1 3300050515 Bacteria 1459
363 Ga0501084_0011689 3300054114 Bacteria 7267
364 Ga0501084_0019556 3300054114 Bacteria 5643
365 Ga0501084_0351886 3300054114 Bacteria 1244
366 Ga0501084_0563697 3300054114 Bacteria 962
367 Ga0590074_001280 3300059423 Bacteria 3997
368 Ga0590077_004125 3300059426 Bacteria 2992
369 Ga0590077_011596 3300059426 Bacteria 1821
370 Ga0501082_0024356 3300060353 Bacteria 5218
371 Ga0501082_0057464 3300060353 Bacteria 3352
372 Ga0501082_0081691 3300060353 Bacteria 2789
373 Ga0501082_0462998 3300060353 Bacteria 1108
374 Ga0530510_0060346 3300061734 Bacteria 2744
375 Ga0530510_0083052 3300061734 Bacteria 2333
376 Ga0530510_0105435 3300061734 Bacteria 2063
377 Ga0530510_0113699 3300061734 Bacteria 1984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_306793_c1 nmdc:mga0a205_306793_c1_685_1428 196
2 3300005546 Ga0070696_100585363 Ga0070696_1005853631 200
3 3300049744 Ga0501083_0243559 Ga0501083_0243559_377_1066 200
4 3300049568 Ga0501031_0194029 Ga0501031_0194029_70_819 201
5 3300049575 Ga0501039_0625409 Ga0501039_0625409_74_823 201
6 3300049576 Ga0501040_0275560 Ga0501040_0275560_190_939 201
7 3300049578 Ga0501042_0127906 Ga0501042_0127906_954_1703 201
8 3300049588 Ga0501072_0084222 Ga0501072_0084222_1408_2157 201
9 3300049591 Ga0501075_0385640 Ga0501075_0385640_42_791 201
10 3300049743 Ga0501081_0330216 Ga0501081_0330216_72_821 201
11 3300060353 Ga0501082_0462998 Ga0501082_0462998_152_901 201
12 3300049575 Ga0501039_0110986 Ga0501039_0110986_1190_1942 207
13 3300049583 Ga0501067_0078897 Ga0501067_0078897_259_1023 210
14 3300049585 Ga0501069_0082826 Ga0501069_0082826_259_1023 210
15 3300061734 Ga0530510_0113699 Ga0530510_0113699_234_998 210
16 3300005471 Ga0070698_100011181 Ga0070698_1000111813 211
17 3300049579 Ga0501043_0463687 Ga0501043_0463687_231_920 211
18 3300048912 Ga0496109_0426531 Ga0496109_0426531_381_1142 215
19 3300005347 Ga0070668_100274194 Ga0070668_1002741942 218
20 3300005354 Ga0070675_100002702 Ga0070675_10000270210 218
21 3300005459 Ga0068867_100641359 Ga0068867_1006413591 218
22 3300025926 Ga0207659_10008112 Ga0207659_100081122 218
23 3300026089 Ga0207648_10123081 Ga0207648_101230812 218
24 3300049584 Ga0501068_0026448 Ga0501068_0026448_2567_3331 218
25 3300031852 Ga0307410_10564250 Ga0307410_105642502 219
26 3300032002 Ga0307416_100730615 Ga0307416_1007306153 219
27 3300037312 Ga0395899_0016085 Ga0395899_0016085_4272_4931 219
28 3300037418 Ga0395900_0132156 Ga0395900_0132156_1494_2153 219
29 3300037466 Ga0395898_0002944 Ga0395898_0002944_18682_19341 219
30 3300037471 Ga0395905_0033927 Ga0395905_0033927_1494_2153 219
31 3300038443 Ga0395901_0287322 Ga0395901_0287322_277_936 219
32 3300050512 nmdc:mga0n895_167070_c1 nmdc:mga0n895_167070_c1_1231_1983 219
33 3300059426 Ga0590077_011596 Ga0590077_011596_43_705 219
34 3300005341 Ga0070691_10013198 Ga0070691_100131985 220
35 3300031238 Ga0265332_10006274 Ga0265332_100062743 220
36 3300031595 Ga0265313_10113548 Ga0265313_101135482 220
37 3300031711 Ga0265314_10040976 Ga0265314_100409765 220
38 3300031712 Ga0265342_10175728 Ga0265342_101757282 220
39 3300050513 nmdc:mga0rr50_463048_c1 nmdc:mga0rr50_463048_c1_287_1039 220
40 3300006846 Ga0075430_100001243 Ga0075430_10000124316 221
41 3300006880 Ga0075429_100431147 Ga0075429_1004311472 221
42 3300042876 Ga0451577_0365770 Ga0451577_0365770_479_1183 221
43 3300050508 nmdc:mga09592_415200_c1 nmdc:mga09592_415200_c1_337_1029 221
44 3300050509 nmdc:mga0qj67_9792_c1 nmdc:mga0qj67_9792_c1_6037_6729 221
45 3300005467 Ga0070706_100031050 Ga0070706_1000310503 222
46 3300005468 Ga0070707_100158127 Ga0070707_1001581273 222
47 3300005468 Ga0070707_100555758 Ga0070707_1005557582 222
48 3300005518 Ga0070699_100015400 Ga0070699_1000154003 222
49 3300025910 Ga0207684_10014603 Ga0207684_100146031 222
50 3300025922 Ga0207646_10023623 Ga0207646_100236232 222
51 3300025922 Ga0207646_10353364 Ga0207646_103533642 222
52 3300049588 Ga0501072_0502158 Ga0501072_0502158_10_735 222
53 3300009148 Ga0105243_10235303 Ga0105243_102353033 223
54 3300028800 Ga0265338_10322531 Ga0265338_103225312 223
55 3300041512 Ga0451853_0666768 Ga0451853_0666768_67_753 223
56 3300005336 Ga0070680_100000006 Ga0070680_10000000668 224
57 3300025917 Ga0207660_10000002 Ga0207660_1000000267 224
58 3300028558 Ga0265326_10080493 Ga0265326_100804932 224
59 3300028563 Ga0265319_1002146 Ga0265319_10021465 224
60 3300028573 Ga0265334_10011577 Ga0265334_100115772 224
61 3300029957 Ga0265324_10098792 Ga0265324_100987922 224
62 3300031238 Ga0265332_10167501 Ga0265332_101675011 224
63 3300031247 Ga0265340_10019890 Ga0265340_100198902 224
64 3300031344 Ga0265316_10127825 Ga0265316_101278253 224
65 3300031711 Ga0265314_10114407 Ga0265314_101144072 224
66 3300031712 Ga0265342_10063654 Ga0265342_100636543 224
67 3300031824 Ga0307413_10304684 Ga0307413_103046843 224
68 3300050514 nmdc:mga08x19_148974_c1 nmdc:mga08x19_148974_c1_206_943 224
69 3300025981 Ga0207640_10441763 Ga0207640_104417631 225
70 3300048905 Ga0496102_0904613 Ga0496102_0904613_25_783 225
71 3300005985 Ga0081539_10003537 Ga0081539_100035378 226
72 3300026116 Ga0207674_10292350 Ga0207674_102923503 226
73 3300031901 Ga0307406_10299857 Ga0307406_102998572 226
74 3300035088 Ga0373940_0064254 Ga0373940_0064254_186_938 226
75 3300048908 Ga0496105_0008043 Ga0496105_0008043_7304_8017 226
76 3300005328 Ga0070676_10215262 Ga0070676_102152622 227
77 3300005334 Ga0068869_100276130 Ga0068869_1002761301 227
78 3300005719 Ga0068861_100337355 Ga0068861_1003373553 227
79 3300006852 Ga0075433_10040240 Ga0075433_100402403 227
80 3300009098 Ga0105245_10027187 Ga0105245_100271873 227
81 3300009553 Ga0105249_10354631 Ga0105249_103546312 227
82 3300011119 Ga0105246_10251041 Ga0105246_102510412 227
83 3300025907 Ga0207645_10163861 Ga0207645_101638612 227
84 3300025927 Ga0207687_10122094 Ga0207687_101220943 227
85 3300025942 Ga0207689_10288508 Ga0207689_102885082 227
86 3300025961 Ga0207712_10132845 Ga0207712_101328453 227
87 3300026067 Ga0207678_10324374 Ga0207678_103243742 227
88 3300026089 Ga0207648_10485983 Ga0207648_104859832 227
89 3300026118 Ga0207675_100383301 Ga0207675_1003833013 227
90 3300035115 Ga0373941_0047881 Ga0373941_0047881_119_862 227
91 3300036401 Ga0373937_0103225 Ga0373937_0103225_1097_1837 227
92 3300048909 Ga0496106_0500162 Ga0496106_0500162_30_779 227
93 3300048915 Ga0496112_0000007 Ga0496112_0000007_257384_258124 227
94 3300049593 Ga0501077_0337209 Ga0501077_0337209_177_929 227
95 3300049743 Ga0501081_0403047 Ga0501081_0403047_55_804 227
96 3300050515 nmdc:mga0a205_181106_c1 nmdc:mga0a205_181106_c1_56_808 227
97 3300005343 Ga0070687_100245409 Ga0070687_1002454092 228
98 3300005356 Ga0070674_100194320 Ga0070674_1001943201 228
99 3300005437 Ga0070710_10257005 Ga0070710_102570052 228
100 3300005440 Ga0070705_100142302 Ga0070705_1001423022 228
101 3300005444 Ga0070694_100086134 Ga0070694_1000861341 228
102 3300005445 Ga0070708_100019945 Ga0070708_1000199453 228
103 3300005471 Ga0070698_100168925 Ga0070698_1001689253 228
104 3300005518 Ga0070699_100084891 Ga0070699_1000848912 228
105 3300005545 Ga0070695_100025586 Ga0070695_1000255863 228
106 3300005546 Ga0070696_100069701 Ga0070696_1000697013 228
107 3300005546 Ga0070696_100095257 Ga0070696_1000952573 228
108 3300005549 Ga0070704_100516470 Ga0070704_1005164701 228
109 3300005578 Ga0068854_100413402 Ga0068854_1004134022 228
110 3300005618 Ga0068864_100350949 Ga0068864_1003509493 228
111 3300009148 Ga0105243_10435324 Ga0105243_104353242 228
112 3300013297 Ga0157378_10519997 Ga0157378_105199972 228
113 3300025910 Ga0207684_10043015 Ga0207684_100430155 228
114 3300025942 Ga0207689_10342385 Ga0207689_103423852 228
115 3300041411 Ga0439466_0028087 Ga0439466_0028087_1164_1904 228
116 3300048907 Ga0496104_0080727 Ga0496104_0080727_384_1133 228
117 3300048909 Ga0496106_0667194 Ga0496106_0667194_38_793 228
118 3300048912 Ga0496109_0334916 Ga0496109_0334916_373_1122 228
119 3300049592 Ga0501076_0077192 Ga0501076_0077192_1876_2616 228
120 3300060353 Ga0501082_0081691 Ga0501082_0081691_1999_2739 228
121 3300005440 Ga0070705_100234111 Ga0070705_1002341112 229
122 3300005440 Ga0070705_100335390 Ga0070705_1003353901 229
123 3300005471 Ga0070698_100074044 Ga0070698_1000740443 229
124 3300005518 Ga0070699_100021378 Ga0070699_1000213783 229
125 3300005536 Ga0070697_100006254 Ga0070697_1000062544 229
126 3300005614 Ga0068856_100217455 Ga0068856_1002174553 229
127 3300005618 Ga0068864_100022904 Ga0068864_1000229044 229
128 3300006844 Ga0075428_100068180 Ga0075428_1000681802 229
129 3300006871 Ga0075434_100259133 Ga0075434_1002591333 229
130 3300009147 Ga0114129_10085876 Ga0114129_100858764 229
131 3300014325 Ga0163163_10295053 Ga0163163_102950532 229
132 3300014968 Ga0157379_10137462 Ga0157379_101374623 229
133 3300025921 Ga0207652_10133475 Ga0207652_101334752 229
134 3300026035 Ga0207703_10837083 Ga0207703_108370831 229
135 3300028563 Ga0265319_1002720 Ga0265319_10027202 229
136 3300028573 Ga0265334_10064104 Ga0265334_100641042 229
137 3300028577 Ga0265318_10052786 Ga0265318_100527862 229
138 3300028654 Ga0265322_10026684 Ga0265322_100266842 229
139 3300028666 Ga0265336_10009022 Ga0265336_100090223 229
140 3300028666 Ga0265336_10020138 Ga0265336_100201383 229
141 3300028800 Ga0265338_10515523 Ga0265338_105155232 229
142 3300029957 Ga0265324_10040497 Ga0265324_100404972 229
143 3300031235 Ga0265330_10026128 Ga0265330_100261282 229
144 3300031238 Ga0265332_10025180 Ga0265332_100251804 229
145 3300031240 Ga0265320_10001931 Ga0265320_100019315 229
146 3300031241 Ga0265325_10014131 Ga0265325_100141313 229
147 3300031242 Ga0265329_10025054 Ga0265329_100250543 229
148 3300031247 Ga0265340_10001279 Ga0265340_100012793 229
149 3300031250 Ga0265331_10003332 Ga0265331_100033323 229
150 3300031344 Ga0265316_10031165 Ga0265316_100311653 229
151 3300031595 Ga0265313_10081735 Ga0265313_100817352 229
152 3300031711 Ga0265314_10003728 Ga0265314_100037285 229
153 3300031712 Ga0265342_10140192 Ga0265342_101401922 229
154 3300036401 Ga0373937_0654663 Ga0373937_0654663_41_808 229
155 3300038443 Ga0395901_0697613 Ga0395901_0697613_207_950 229
156 3300045051 Ga0451576_0151431 Ga0451576_0151431_449_1198 229
157 3300048912 Ga0496109_0100184 Ga0496109_0100184_839_1585 229
158 3300048915 Ga0496112_0028109 Ga0496112_0028109_4472_5236 229
159 3300050507 nmdc:mga05p37_1736_c1 nmdc:mga05p37_1736_c1_21115_21855 229
160 3300059423 Ga0590074_001280 Ga0590074_001280_2213_2959 229
161 3300059426 Ga0590077_004125 Ga0590077_004125_283_1029 229
162 3300005329 Ga0070683_100154456 Ga0070683_1001544562 230
163 3300005330 Ga0070690_100030603 Ga0070690_1000306034 230
164 3300005339 Ga0070660_100285598 Ga0070660_1002855982 230
165 3300005340 Ga0070689_100021019 Ga0070689_1000210193 230
166 3300005340 Ga0070689_100192554 Ga0070689_1001925542 230
167 3300005343 Ga0070687_100004804 Ga0070687_1000048043 230
168 3300005344 Ga0070661_100073743 Ga0070661_1000737433 230
169 3300005345 Ga0070692_10014742 Ga0070692_100147424 230
170 3300005347 Ga0070668_100052938 Ga0070668_1000529383 230
171 3300005356 Ga0070674_100001116 Ga0070674_1000011165 230
172 3300005438 Ga0070701_10003243 Ga0070701_100032435 230
173 3300005440 Ga0070705_100328606 Ga0070705_1003286062 230
174 3300005440 Ga0070705_100380933 Ga0070705_1003809332 230
175 3300005441 Ga0070700_100008655 Ga0070700_1000086555 230
176 3300005444 Ga0070694_100507886 Ga0070694_1005078862 230
177 3300005445 Ga0070708_100009795 Ga0070708_1000097955 230
178 3300005456 Ga0070678_100026757 Ga0070678_1000267573 230
179 3300005456 Ga0070678_100103774 Ga0070678_1001037743 230
180 3300005457 Ga0070662_100086261 Ga0070662_1000862613 230
181 3300005457 Ga0070662_100270788 Ga0070662_1002707882 230
182 3300005459 Ga0068867_100006532 Ga0068867_1000065327 230
183 3300005467 Ga0070706_100019828 Ga0070706_1000198284 230
184 3300005468 Ga0070707_100010970 Ga0070707_1000109702 230
185 3300005471 Ga0070698_100115770 Ga0070698_1001157702 230
186 3300005530 Ga0070679_100248020 Ga0070679_1002480202 230
187 3300005535 Ga0070684_100035818 Ga0070684_1000358182 230
188 3300005535 Ga0070684_100205538 Ga0070684_1002055382 230
189 3300005536 Ga0070697_100035605 Ga0070697_1000356053 230
190 3300005543 Ga0070672_100081408 Ga0070672_1000814083 230
191 3300005544 Ga0070686_100052794 Ga0070686_1000527942 230
192 3300005544 Ga0070686_100311344 Ga0070686_1003113442 230
193 3300005545 Ga0070695_100373620 Ga0070695_1003736202 230
194 3300005546 Ga0070696_100007321 Ga0070696_1000073215 230
195 3300005546 Ga0070696_100143704 Ga0070696_1001437043 230
196 3300005577 Ga0068857_100172421 Ga0068857_1001724212 230
197 3300005615 Ga0070702_100002279 Ga0070702_1000022796 230
198 3300005615 Ga0070702_100136688 Ga0070702_1001366882 230
199 3300005616 Ga0068852_100089976 Ga0068852_1000899764 230
200 3300005618 Ga0068864_100006074 Ga0068864_1000060745 230
201 3300005840 Ga0068870_10004617 Ga0068870_100046176 230
202 3300006358 Ga0068871_100334064 Ga0068871_1003340642 230
203 3300009094 Ga0111539_10015164 Ga0111539_100151642 230
204 3300009094 Ga0111539_10447275 Ga0111539_104472751 230
205 3300009094 Ga0111539_10502260 Ga0111539_105022602 230
206 3300009101 Ga0105247_10172237 Ga0105247_101722371 230
207 3300009147 Ga0114129_10096952 Ga0114129_100969523 230
208 3300009147 Ga0114129_10152106 Ga0114129_101521062 230
209 3300009147 Ga0114129_10396516 Ga0114129_103965163 230
210 3300009148 Ga0105243_10004531 Ga0105243_100045312 230
211 3300009176 Ga0105242_10043927 Ga0105242_100439272 230
212 3300009177 Ga0105248_10118074 Ga0105248_101180742 230
213 3300009177 Ga0105248_10311486 Ga0105248_103114863 230
214 3300009551 Ga0105238_10042511 Ga0105238_100425111 230
215 3300010375 Ga0105239_10007925 Ga0105239_100079257 230
216 3300011119 Ga0105246_10292960 Ga0105246_102929602 230
217 3300013297 Ga0157378_10044955 Ga0157378_100449553 230
218 3300013308 Ga0157375_10005306 Ga0157375_100053065 230
219 3300014325 Ga0163163_10083895 Ga0163163_100838952 230
220 3300014325 Ga0163163_10464084 Ga0163163_104640842 230
221 3300014326 Ga0157380_10010874 Ga0157380_100108746 230
222 3300014745 Ga0157377_10001395 Ga0157377_100013953 230
223 3300014745 Ga0157377_10376302 Ga0157377_103763022 230
224 3300014969 Ga0157376_10152748 Ga0157376_101527483 230
225 3300014969 Ga0157376_10248009 Ga0157376_102480092 230
226 3300025901 Ga0207688_10006583 Ga0207688_100065833 230
227 3300025908 Ga0207643_10005791 Ga0207643_100057912 230
228 3300025910 Ga0207684_10058419 Ga0207684_100584192 230
229 3300025917 Ga0207660_10392390 Ga0207660_103923902 230
230 3300025918 Ga0207662_10002007 Ga0207662_100020075 230
231 3300025919 Ga0207657_10130696 Ga0207657_101306962 230
232 3300025920 Ga0207649_10033835 Ga0207649_100338353 230
233 3300025922 Ga0207646_10010687 Ga0207646_100106872 230
234 3300025926 Ga0207659_10011252 Ga0207659_100112523 230
235 3300025927 Ga0207687_10013365 Ga0207687_100133655 230
236 3300025927 Ga0207687_10298773 Ga0207687_102987733 230
237 3300025933 Ga0207706_10009261 Ga0207706_100092613 230
238 3300025934 Ga0207686_10027023 Ga0207686_100270232 230
239 3300025935 Ga0207709_10077442 Ga0207709_100774422 230
240 3300025936 Ga0207670_10009148 Ga0207670_100091482 230
241 3300025937 Ga0207669_10007236 Ga0207669_100072363 230
242 3300025940 Ga0207691_10074397 Ga0207691_100743972 230
243 3300025940 Ga0207691_10415848 Ga0207691_104158482 230
244 3300025944 Ga0207661_10076129 Ga0207661_100761292 230
245 3300025960 Ga0207651_10205393 Ga0207651_102053931 230
246 3300025972 Ga0207668_10037695 Ga0207668_100376953 230
247 3300026035 Ga0207703_10023793 Ga0207703_100237936 230
248 3300026041 Ga0207639_10036829 Ga0207639_100368293 230
249 3300026067 Ga0207678_10040635 Ga0207678_100406351 230
250 3300026075 Ga0207708_10005128 Ga0207708_100051288 230
251 3300026089 Ga0207648_10003076 Ga0207648_1000307617 230
252 3300026089 Ga0207648_10254482 Ga0207648_102544823 230
253 3300026116 Ga0207674_10118514 Ga0207674_101185143 230
254 3300026121 Ga0207683_10059840 Ga0207683_100598403 230
255 3300027907 Ga0207428_10076747 Ga0207428_100767472 230
256 3300028381 Ga0268264_10043072 Ga0268264_100430722 230
257 3300031824 Ga0307413_10102376 Ga0307413_101023763 230
258 3300031852 Ga0307410_10177816 Ga0307410_101778162 230
259 3300032002 Ga0307416_100001579 Ga0307416_10000157913 230
260 3300035090 Ga0373949_0014272 Ga0373949_0014272_344_1096 230
261 3300035092 Ga0373952_0015928 Ga0373952_0015928_615_1367 230
262 3300041512 Ga0451853_3677978 Ga0451853_3677978_754_1494 230
263 3300042876 Ga0451577_0561922 Ga0451577_0561922_235_981 230
264 3300044673 Ga0453683_0030622 Ga0453683_0030622_2304_3068 230
265 3300046615 Ga0495656_0128744 Ga0495656_0128744_104_859 230
266 3300048904 Ga0496101_0422575 Ga0496101_0422575_154_903 230
267 3300048905 Ga0496102_0701707 Ga0496102_0701707_124_867 230
268 3300048907 Ga0496104_0042465 Ga0496104_0042465_1416_2165 230
269 3300048908 Ga0496105_0090094 Ga0496105_0090094_1742_2491 230
270 3300048908 Ga0496105_0250320 Ga0496105_0250320_606_1358 230
271 3300048910 Ga0496107_0113233 Ga0496107_0113233_813_1565 230
272 3300048911 Ga0496108_0004201 Ga0496108_0004201_51_800 230
273 3300048912 Ga0496109_0002639 Ga0496109_0002639_553_1302 230
274 3300048912 Ga0496109_0007211 Ga0496109_0007211_3181_3933 230
275 3300048912 Ga0496109_0120667 Ga0496109_0120667_158_916 230
276 3300048913 Ga0496110_0044652 Ga0496110_0044652_2786_3538 230
277 3300048913 Ga0496110_0110645 Ga0496110_0110645_290_1039 230
278 3300048915 Ga0496112_0205039 Ga0496112_0205039_375_1127 230
279 3300048915 Ga0496112_0530293 Ga0496112_0530293_91_852 230
280 3300048917 Ga0496114_0041985 Ga0496114_0041985_2544_3293 230
281 3300049568 Ga0501031_0070347 Ga0501031_0070347_727_1503 230
282 3300049568 Ga0501031_0174569 Ga0501031_0174569_336_1082 230
283 3300049569 Ga0501032_0086547 Ga0501032_0086547_963_1709 230
284 3300049569 Ga0501032_0389886 Ga0501032_0389886_42_794 230
285 3300049572 Ga0501036_0015936 Ga0501036_0015936_386_1162 230
286 3300049572 Ga0501036_0061123 Ga0501036_0061123_882_1628 230
287 3300049572 Ga0501036_0335311 Ga0501036_0335311_325_1077 230
288 3300049573 Ga0501037_0240405 Ga0501037_0240405_111_887 230
289 3300049574 Ga0501038_0166040 Ga0501038_0166040_222_968 230
290 3300049575 Ga0501039_0146669 Ga0501039_0146669_17_763 230
291 3300049576 Ga0501040_0030658 Ga0501040_0030658_184_960 230
292 3300049576 Ga0501040_0098116 Ga0501040_0098116_1104_1856 230
293 3300049576 Ga0501040_0221450 Ga0501040_0221450_26_772 230
294 3300049577 Ga0501041_0017737 Ga0501041_0017737_1569_2345 230
295 3300049577 Ga0501041_0053511 Ga0501041_0053511_102_848 230
296 3300049577 Ga0501041_0074883 Ga0501041_0074883_261_1013 230
297 3300049578 Ga0501042_0169745 Ga0501042_0169745_163_909 230
298 3300049578 Ga0501042_0339369 Ga0501042_0339369_164_913 230
299 3300049578 Ga0501042_0460806 Ga0501042_0460806_141_893 230
300 3300049580 Ga0501046_0216757 Ga0501046_0216757_13_759 230
301 3300049582 Ga0501048_0071458 Ga0501048_0071458_862_1638 230
302 3300049582 Ga0501048_0076481 Ga0501048_0076481_98_844 230
303 3300049582 Ga0501048_0147764 Ga0501048_0147764_368_1120 230
304 3300049586 Ga0501070_0437481 Ga0501070_0437481_70_846 230
305 3300049587 Ga0501071_0010881 Ga0501071_0010881_624_1376 230
306 3300049587 Ga0501071_0017871 Ga0501071_0017871_4070_4816 230
307 3300049587 Ga0501071_0161569 Ga0501071_0161569_368_1144 230
308 3300049587 Ga0501071_0269980 Ga0501071_0269980_341_1090 230
309 3300049587 Ga0501071_0447509 Ga0501071_0447509_103_855 230
310 3300049588 Ga0501072_0209252 Ga0501072_0209252_72_818 230
311 3300049588 Ga0501072_0356413 Ga0501072_0356413_115_867 230
312 3300049589 Ga0501073_0422203 Ga0501073_0422203_89_865 230
313 3300049590 Ga0501074_0020477 Ga0501074_0020477_2129_2881 230
314 3300049590 Ga0501074_0061186 Ga0501074_0061186_611_1357 230
315 3300049590 Ga0501074_0076267 Ga0501074_0076267_608_1384 230
316 3300049591 Ga0501075_0013476 Ga0501075_0013476_2024_2773 230
317 3300049591 Ga0501075_0040433 Ga0501075_0040433_1902_2648 230
318 3300049591 Ga0501075_0056751 Ga0501075_0056751_1786_2562 230
319 3300049591 Ga0501075_0066539 Ga0501075_0066539_1437_2189 230
320 3300049591 Ga0501075_0476140 Ga0501075_0476140_68_817 230
321 3300049592 Ga0501076_0015705 Ga0501076_0015705_4451_5227 230
322 3300049592 Ga0501076_0113837 Ga0501076_0113837_213_956 230
323 3300049592 Ga0501076_0147972 Ga0501076_0147972_169_918 230
324 3300049592 Ga0501076_0156199 Ga0501076_0156199_870_1619 230
325 3300049592 Ga0501076_0379953 Ga0501076_0379953_118_867 230
326 3300049593 Ga0501077_0072200 Ga0501077_0072200_1377_2129 230
327 3300049593 Ga0501077_0170891 Ga0501077_0170891_227_973 230
328 3300049741 Ga0501079_0013761 Ga0501079_0013761_1845_2591 230
329 3300049741 Ga0501079_0039886 Ga0501079_0039886_826_1602 230
330 3300049741 Ga0501079_0110021 Ga0501079_0110021_272_1024 230
331 3300049742 Ga0501080_0018272 Ga0501080_0018272_267_1043 230
332 3300049742 Ga0501080_0186163 Ga0501080_0186163_75_821 230
333 3300049742 Ga0501080_0400947 Ga0501080_0400947_29_778 230
334 3300049743 Ga0501081_0011970 Ga0501081_0011970_2890_3636 230
335 3300049743 Ga0501081_0019169 Ga0501081_0019169_142_894 230
336 3300049744 Ga0501083_0211594 Ga0501083_0211594_201_947 230
337 3300049824 Ga0501045_0010783 Ga0501045_0010783_3482_4228 230
338 3300049824 Ga0501045_0059527 Ga0501045_0059527_1832_2584 230
339 3300049824 Ga0501045_0120473 Ga0501045_0120473_191_937 230
340 3300049824 Ga0501045_0136710 Ga0501045_0136710_194_946 230
341 3300049824 Ga0501045_0150499 Ga0501045_0150499_70_846 230
342 3300049824 Ga0501045_0317674 Ga0501045_0317674_217_969 230
343 3300050507 nmdc:mga05p37_344235_c1 nmdc:mga05p37_344235_c1_35_787 230
344 3300050511 nmdc:mga08y16_54535_c1 nmdc:mga08y16_54535_c1_3210_3962 230
345 3300050512 nmdc:mga0n895_36114_c1 nmdc:mga0n895_36114_c1_2603_3373 230
346 3300050513 nmdc:mga0rr50_87068_c1 nmdc:mga0rr50_87068_c1_1577_2347 230
347 3300050515 nmdc:mga0a205_220328_c1 nmdc:mga0a205_220328_c1_329_1081 230
348 3300054114 Ga0501084_0011689 Ga0501084_0011689_899_1645 230
349 3300054114 Ga0501084_0019556 Ga0501084_0019556_2031_2777 230
350 3300054114 Ga0501084_0351886 Ga0501084_0351886_19_795 230
351 3300054114 Ga0501084_0563697 Ga0501084_0563697_58_810 230
352 3300060353 Ga0501082_0024356 Ga0501082_0024356_3946_4698 230
353 3300060353 Ga0501082_0057464 Ga0501082_0057464_225_971 230
354 3300061734 Ga0530510_0060346 Ga0530510_0060346_910_1656 230
355 3300061734 Ga0530510_0083052 Ga0530510_0083052_890_1642 230
356 3300061734 Ga0530510_0105435 Ga0530510_0105435_711_1487 230
357 3300005434 Ga0070709_10068704 Ga0070709_100687044 231
358 3300005436 Ga0070713_100122705 Ga0070713_1001227054 231
359 3300005439 Ga0070711_100070483 Ga0070711_1000704832 231
360 3300005468 Ga0070707_100075401 Ga0070707_1000754013 231
361 3300005471 Ga0070698_100021889 Ga0070698_1000218894 231
362 3300025916 Ga0207663_10035602 Ga0207663_100356024 231
363 3300048914 Ga0496111_0109581 Ga0496111_0109581_1013_1723 231
364 3300005536 Ga0070697_100486621 Ga0070697_1004866211 232
365 3300005327 Ga0070658_10099435 Ga0070658_100994354 233
366 3300005336 Ga0070680_100013646 Ga0070680_1000136463 233
367 3300005563 Ga0068855_100082711 Ga0068855_1000827115 233
368 3300009093 Ga0105240_10092666 Ga0105240_100926664 233
369 3300013100 Ga0157373_10078535 Ga0157373_100785353 233
370 3300025929 Ga0207664_10068351 Ga0207664_100683513 233
371 3300044706 Ga0466964_0064495 Ga0466964_0064495_56_757 233
372 3300045976 Ga0466967_0008183 Ga0466967_0008183_6014_6715 233
373 3300045976 Ga0466967_0020259 Ga0466967_0020259_287_988 233
374 3300049583 Ga0501067_0000845 Ga0501067_0000845_8638_9339 233
375 3300049584 Ga0501068_0073509 Ga0501068_0073509_356_1057 233
376 3300049585 Ga0501069_0001111 Ga0501069_0001111_10114_10815 233
377 3300049586 Ga0501070_0286394 Ga0501070_0286394_13_714 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

11

229

0.91

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

13

140

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9238 4 223
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.903 4 223
7dw7-assembly1.cif.gz_A crystal structure of n1051a mutant of formylglycinamidine synthetase 0.8447 4 227
6jta-assembly1.cif.gz_A crystal structure of d464a l465a mutant of fgam synthetase 0.8425 4 227
6lym-assembly1.cif.gz_A crystal structure of d657a mutant of formylglycinamidine synthetase 0.8417 4 227
ID Description Score Start End Superfamily
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9471 6 226 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9407 4 225 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9388 6 226 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9378 6 226 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9285 4 225 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V9P6S3-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9739 78 233 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A538ITD3-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9656 92 223 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A7V9P6S3-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9618 78 233 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A2V8RZ66-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9614 85 200 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A6J6JNV2-F1-model_v4 Unannotated protein 0.9605 76 223 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787

Feature Viewer

pLDDT pTM Quality
90.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map