F427650

General Info

Members Datasets Scaffolds Average Seq Length
377 320 754 405

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100009938|Ga0075428_10000993810
Length 419
Sequence LSTGALIVGAGQAGAQIAISLREIGYREPITLIGEEPYAPYQRPPLSKSVLLGDRDVLELHIKGPNYFAEKSIRVITGERVESIEVDTDGVGGRASTSSGQVIEFEKLALATGAGARRLDVEGADLDGVHCLRGIDDAVTLRDRLRADQRIVVVGGGFIGLEFAAAARSRGADVTVLQSTDRLLSRAVGPAISDFYLDAHTRRGVTVLLESDLVAIHGDPHSRAVNAVELADGTRLAADLVVVGIGAKPNVELAEHLGLECDGGIVVDAQARTSRTQIVAAGDCTVSLDPLTETRVRLESVQNAVNQGRCAAASLAGSMGIKPAVPYFWSDQYDLTLQIAGLSQGYDKVVIRGDRGSEQFAALYYRGSRLIAIDAVNCPRDYAAVLSALRSGAHIPAELAVQGALSLRDMMKAPIPAER

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
35 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
68 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
69 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
70 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
71 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
91 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
92 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
108 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
109 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
110 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
115 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
116 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
117 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
118 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
119 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
120 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
121 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
122 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
123 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
124 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
125 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
126 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
127 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
128 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
129 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
130 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
131 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
132 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
133 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
134 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
135 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
136 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
137 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
138 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
139 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
140 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
141 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
142 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
143 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
144 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
145 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
146 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
147 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
148 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
149 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
150 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
151 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
152 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
153 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
154 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
155 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
156 2643221558 Rhizobium sp. Root149 Isolate Unclassified
157 2643221599 Rhizobium sp. Root708 Isolate Unclassified
158 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
159 2718217882 Rhizobium sp. N741 Isolate Nodule
160 2718217927 Rhizobium sp. N324 Isolate Nodule
161 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
162 2718218009 Rhizobium sp. N561 Isolate Nodule
163 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
164 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
165 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
166 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
167 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
168 2718218363 Rhizobium sp. N113 Isolate Nodule
169 2718218365 Rhizobium sp. N731 Isolate Nodule
170 2718218366 Rhizobium sp. N621 Isolate Nodule
171 2718218423 Rhizobium sp. N941 Isolate Nodule
172 2721755514 Rhizobium sp. N6212 Isolate Nodule
173 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
174 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
175 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
176 2721755809 Rhizobium sp. N541 Isolate Nodule
177 2721755810 Rhizobium sp. N871 Isolate Nodule
178 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
179 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
180 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
181 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
182 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
183 2728369365 Rhizobium sp. N1341 Isolate Nodule
184 2728369397 Rhizobium sp. N1314 Isolate Nodule
185 2738541293 Rhizobium sp. GV031 Isolate Unclassified
186 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
187 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
188 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
189 2791355260 Rhizobium sp. L9 Isolate Nodule
190 2791355261 Rhizobium sp. J15 Isolate Nodule
191 2791355262 Rhizobium sp. M1 Isolate Nodule
192 2791355263 Rhizobium chutanense C5 Isolate Nodule
193 2791355264 Rhizobium sp. S9 Isolate Nodule
194 2791355266 Rhizobium sp. L43 Isolate Nodule
195 2791355267 Rhizobium sp. L18 Isolate Nodule
196 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
197 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
198 2802429633 Rhizobium anhuiense J3 Isolate Nodule
199 2802429634 Rhizobium anhuiense S10 Isolate Nodule
200 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
201 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
202 2802429637 Rhizobium anhuiense C15 Isolate Nodule
203 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
204 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
205 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
206 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
207 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
208 2838048938 Rhizobium pisi 27/80 Isolate Nodule
209 2838061910 Rhizobium phaseoli L15 Isolate Nodule
210 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
211 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
212 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
213 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
214 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
215 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
216 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
217 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
218 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
219 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
220 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
221 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
222 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
223 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
224 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
225 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
226 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
227 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
228 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
229 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
230 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
231 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
232 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
233 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
234 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
235 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
236 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
237 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
238 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
239 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
240 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
241 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
242 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
243 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
244 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
245 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
246 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
247 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
248 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
249 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
250 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
251 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
252 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
253 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
254 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
255 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
256 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
257 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
258 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
259 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
260 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
261 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
262 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
263 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
264 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
265 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
266 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
267 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
268 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
269 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
270 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
271 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
272 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
273 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
274 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
275 2933599457 Rhizobium phaseoli M3 Isolate Nodule
276 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
277 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
278 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
279 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
280 2936381700 Rhizobium chutanense C16 Isolate Unclassified
281 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
282 2996893221 Rhizobium sp. R635 Isolate Nodule
283 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
284 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
285 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
286 8005275841 Rhizobium sp. N4311 Isolate Nodule
287 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
288 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
289 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
290 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
291 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
292 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
293 8005382845 Rhizobium sp. R634 Isolate Nodule
294 8005395548 Rhizobium sp. R339 Isolate Nodule
295 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
296 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
297 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
298 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
299 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
300 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
301 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
302 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
303 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
304 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
305 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
306 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
307 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
308 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
309 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
310 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
311 8018176218 Rhizobium sp. N122 Isolate Nodule
312 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
313 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
314 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
315 8024501048 Rhizobium sp. H4 Isolate Nodule
316 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
317 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
318 8056382006 Rhizobium croatiense 13T Isolate Nodule
319 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
320 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.97
Metatranscriptomes 0
Isolates 57.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.71
Nodule 44.56
Rhizoplane 0.8
Rhizosphere 23.34
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100009938 3300006844 Bacteria 10570
2 JGI25162J39368_1000365 3300002737 Bacteria 38564
3 JGI25152J39213_1001841 3300002773 Bacteria 8561
4 JGI25151J46595_10000508 3300003187 Bacteria 36520
5 JGI25151J46595_10009496 3300003187 Bacteria 4599
6 JGI25165J46597_1001675 3300003214 Bacteria 10066
7 JGI25165J46597_1003343 3300003214 Bacteria 4078
8 JGI25153J46596_10006031 3300003215 Bacteria 6228
9 rootH1_10016241 3300003316 Bacteria 9812
10 rootH2_10063918 3300003320 Bacteria 13931
11 rootL2_10027409 3300003322 Bacteria 17052
12 rootL2_10032165 3300003322 Bacteria 1881
13 rootL2_10061222 3300003322 Bacteria 11605
14 rootH1_10013822 3300003323 Bacteria 3375
15 rootH1_10243441 3300003323 Bacteria 1899
16 JGI25160J50197_1000014 3300003354 Bacteria 259862
17 JGI25160J50197_1005949 3300003354 Bacteria 5011
18 JGI25161J50226_1000061 3300003374 Bacteria 101391
19 JGI25161J50226_1008166 3300003374 Bacteria 1642
20 Ga0055526_1000991 3300003771 Bacteria 20837
21 Ga0055526_1004842 3300003771 Bacteria 7943
22 Ga0055526_1013723 3300003771 Bacteria 3400
23 Ga0055526_1023639 3300003771 Bacteria 2045
24 Ga0055524_1002762 3300003775 Bacteria 8828
25 Ga0055528_1000109 3300003790 Bacteria 66661
26 Ga0055528_1000206 3300003790 Bacteria 49816
27 Ga0055528_1019456 3300003790 Bacteria 2250
28 Ga0055540_1000197 3300003792 Bacteria 58449
29 Ga0055543_1000005 3300004625 Bacteria 223621
30 Ga0055543_1000578 3300004625 Bacteria 20193
31 Ga0065165_1000126 3300005262 Bacteria 129946
32 Ga0065165_1010980 3300005262 Bacteria 3840
33 Ga0070669_100026661 3300005353 Bacteria 4159
34 Ga0070674_100004659 3300005356 Bacteria 7835
35 Ga0068866_10020742 3300005718 Bacteria 3016
36 Ga0068851_10070460 3300005834 Bacteria 1808
37 Ga0068862_100171839 3300005844 Bacteria 1941
38 Ga0081538_10000693 3300005981 Bacteria 37007
39 Ga0081540_1036168 3300005983 Bacteria 2637
40 Ga0075368_10017504 3300006042 Bacteria 2683
41 Ga0075370_10007207 3300006353 Bacteria 5651
42 Ga0075428_100152221 3300006844 Bacteria 2513
43 Ga0075428_100300195 3300006844 Bacteria 1727
44 Ga0068865_100053657 3300006881 Bacteria 2797
45 Ga0105240_10000012 3300009093 Bacteria 496639
46 Ga0105240_10344134 3300009093 Bacteria 1693
47 Ga0105240_10437099 3300009093 Bacteria 1467
48 Ga0111539_10000167 3300009094 Bacteria 75742
49 Ga0114129_10064305 3300009147 Bacteria 5119
50 Ga0105248_10240742 3300009177 Bacteria 2037
51 Ga0105237_10001333 3300009545 Bacteria 32755
52 Ga0123341_1000056 3300009765 Bacteria 48113
53 Ga0123342_1024749 3300009766 Bacteria 3714
54 Ga0157370_10019121 3300013104 Bacteria 6887
55 Ga0182005_1000879 3300015265 Bacteria 13296
56 Ga0209437_100040 3300025233 Bacteria 448096
57 Ga0207425_1005570 3300025245 Bacteria 3570
58 Ga0209677_100948 3300025253 Bacteria 14158
59 Ga0209129_1000016 3300025258 Bacteria 485491
60 Ga0209129_1001027 3300025258 Bacteria 16608
61 Ga0209233_1000051 3300025261 Bacteria 447617
62 Ga0209233_1000146 3300025261 Bacteria 187269
63 Ga0209233_1000216 3300025261 Bacteria 108123
64 Ga0209673_1000005 3300025273 Bacteria 692788
65 Ga0209673_1000023 3300025273 Bacteria 411385
66 Ga0209673_1000797 3300025273 Bacteria 41846
67 Ga0209673_1010190 3300025273 Bacteria 3985
68 Ga0209130_1000013 3300025284 Bacteria 412810
69 Ga0209675_1011924 3300025291 Bacteria 2841
70 Ga0209025_1002393 3300025294 Bacteria 20037
71 Ga0209025_1004618 3300025294 Bacteria 11782
72 Ga0209564_1000112 3300025295 Bacteria 211939
73 Ga0209564_1007010 3300025295 Bacteria 5910
74 Ga0209758_1001534 3300025297 Bacteria 26574
75 Ga0209758_1003167 3300025297 Bacteria 15436
76 Ga0209050_1022077 3300025298 Bacteria 2294
77 Ga0209256_1000485 3300025299 Bacteria 58920
78 Ga0209256_1000549 3300025299 Bacteria 53852
79 Ga0209256_1018319 3300025299 Bacteria 2282
80 Ga0207426_1000022 3300025302 Bacteria 547377
81 Ga0207426_1000355 3300025302 Bacteria 83450
82 Ga0209051_1000119 3300025303 Bacteria 148746
83 Ga0209257_1023179 3300025304 Bacteria 2190
84 Ga0207656_10034827 3300025321 Bacteria 2104
85 Ga0207642_10022489 3300025899 Bacteria 2502
86 Ga0207695_10000120 3300025913 Bacteria 234247
87 Ga0207695_10012471 3300025913 Bacteria 10200
88 Ga0207695_10295760 3300025913 Bacteria 1511
89 Ga0207671_10000755 3300025914 Bacteria 41010
90 Ga0207669_10018687 3300025937 Bacteria 3590
91 Ga0207704_10035457 3300025938 Bacteria 2859
92 Ga0207428_10000055 3300027907 Bacteria 166460
93 Ga0268265_10150630 3300028380 Bacteria 1961
94 Ga0265318_10003621 3300028577 Bacteria 7718
95 Ga0307515_10007811 3300028794 Bacteria 21042
96 Ga0307515_10238826 3300028794 Bacteria 1593
97 Ga0307513_10008730 3300031456 Bacteria 12909
98 Ga0265314_10024925 3300031711 Bacteria 4523
99 Ga0307415_100115609 3300032126 Bacteria 2000
100 Ga0451841_0267452 3300041498 Bacteria 1966
101 Ga0451847_0653548 3300041503 Bacteria 1518
102 Ga0451851_0227649 3300041507 Bacteria 2165
103 Ga0451843_0244535 3300041509 Bacteria 1609
104 Ga0451855_0274739 3300041511 Bacteria 1553
105 Ga0466963_0008728 3300044694 Bacteria 6085
106 Ga0466970_0001801 3300044765 Bacteria 10325
107 Ga0466957_0049471 3300044842 Bacteria 2556
108 Ga0466967_0160702 3300045976 Bacteria 2108
109 Ga0466967_0258718 3300045976 Bacteria 1665
110 Ga0495638_0000221 3300046460 Bacteria 79300
111 Ga0495662_0006894 3300046476 Bacteria 5643
112 Ga0495662_0009308 3300046476 Bacteria 4819
113 Ga0495583_0002418 3300046506 Bacteria 16034
114 Ga0495606_0005405 3300046507 Bacteria 12245
115 Ga0495606_0125236 3300046507 Bacteria 1533
116 Ga0495648_0046794 3300046524 Bacteria 2679
117 Ga0495648_0060867 3300046524 Bacteria 2244
118 Ga0495609_0038382 3300046538 Bacteria 2159
119 Ga0495625_0059707 3300046660 Bacteria 2704
120 Ga0495672_0031605 3300047320 Bacteria 3304
121 Ga0495686_0000547 3300047472 Bacteria 53728
122 Ga0495686_0046323 3300047472 Bacteria 2749
123 Ga0495626_0029582 3300048091 Bacteria 2650
124 Ga0496101_0047738 3300048904 Bacteria 3075
125 Ga0496101_0186586 3300048904 Bacteria 1599
126 Ga0496116_0026027 3300048919 Bacteria 4287
127 Ga0496116_0046446 3300048919 Bacteria 2931
128 Ga0496117_0022658 3300048920 Bacteria 5033
129 Ga0496117_0071649 3300048920 Bacteria 2321
130 Ga0496118_0000678 3300048921 Bacteria 55390
131 Ga0496118_0025744 3300048921 Bacteria 5033
132 Ga0496121_0006740 3300048924 Bacteria 14095
133 Ga0496121_0040375 3300048924 Bacteria 4095
134 Ga0496121_0041028 3300048924 Bacteria 4052
135 Ga0496122_0013405 3300048925 Bacteria 8026
136 Ga0496123_0030462 3300048926 Bacteria 3949
137 Ga0496124_0006040 3300048927 Bacteria 13343
138 Ga0496125_0019854 3300048928 Bacteria 6322
139 Ga0496126_0049046 3300048929 Bacteria 3856
140 Ga0496126_0112746 3300048929 Bacteria 2367
141 Ga0496126_0243400 3300048929 Bacteria 1502
142 Ga0501033_0048227 3300049570 Bacteria 3164
143 Ga0501034_0041533 3300049571 Bacteria 4654
144 Ga0501034_0118885 3300049571 Bacteria 2629
145 Ga0501067_0153425 3300049583 Unclassified 1283
146 Ga0501068_0068263 3300049584 Bacteria 2167
147 Ga0501070_0005092 3300049586 Bacteria 11201
148 Ga0501073_0093721 3300049589 Bacteria 2086
149 Ga0501073_0111525 3300049589 Bacteria 1897
150 Ga0501080_0104183 3300049742 Bacteria 2631
151 Ga0501044_0190620 3300049823 Bacteria 2013
152 nmdc:mga03683_53143_c1 3300050489 Bacteria 1695
153 nmdc:mga06r32_534738_c1 3300050510 Bacteria 1147
154 nmdc:mga08y16_37_c1 3300050511 Bacteria 150340
155 Ga0500594_0024308 3300053118 Bacteria 1543
156 Ga0500607_106364 3300053121 Bacteria 1384
157 Ga0500618_002873 3300053125 Bacteria 6177
158 Ga0500658_0001270 3300053134 Bacteria 10234
159 Ga0500568_0005923 3300053139 Bacteria 6223
160 Ga0500590_000016 3300053148 Bacteria 47232
161 Ga0500616_0000852 3300053153 Bacteria 33854
162 Ga0500616_0030779 3300053153 Bacteria 2944
163 2509385766 2509276021 Bacteria 7634384
164 2509448180 2509276033 Bacteria 7180565
165 2510136751 2510065019 Bacteria 6903379
166 2510843599 2510461069 Bacteria 5505000
167 2510899984 2510461076 Bacteria 8618824
168 2510900580 2510461076 Bacteria 8618824
169 2511132953 2510917022 Bacteria 6504556
170 2513569374 2513237084 Bacteria 7231967
171 2513576695 2513237085 Bacteria 7695351
172 2513631625 2513237093 Bacteria 7545552
173 2513710040 2513237103 Bacteria 7647401
174 2513910014 2513237144 Bacteria 7530820
175 2514021443 2513237162 Bacteria 7468464
176 2515115326 2515075009 Bacteria 7288508
177 2515635946 2515154113 Bacteria 7807172
178 2515644789 2515154114 Bacteria 7848616
179 2515658088 2515154116 Bacteria 7552979
180 2515742187 2515154134 Bacteria 7220242
181 2517041679 2516653077 Bacteria 7555578
182 2517080738 2516653085 Bacteria 7346596
183 2517099136 2517093000 Bacteria 7412387
184 2517411035 2517287029 Bacteria 6905599
185 2524461626 2524023209 Bacteria 6679728
186 2524461764 2524023209 Bacteria 6679728
187 2530644835 2529292951 Bacteria 6916614
188 2585233668 2582581299 Bacteria 6518058
189 2585266048 2582581306 Bacteria 6450535
190 2585272332 2582581307 Bacteria 6597605
191 2585278400 2582581308 Bacteria 7413247
192 2585324756 2582581315 Bacteria 7318924
193 2585332189 2582581316 Bacteria 7774528
194 2585524420 2585427526 Bacteria 7258840
195 2585531944 2585427527 Bacteria 7273426
196 2585538674 2585427528 Bacteria 6842387
197 2585552303 2585427530 Bacteria 7383882
198 2585561604 2585427531 Bacteria 6992870
199 2585836627 2585427593 Bacteria 7141551
200 2585847911 2585427594 Bacteria 6180594
201 2585906832 2585427609 Bacteria 6667127
202 2587982253 2585428125 Bacteria 6662905
203 2616295018 2615840624 Bacteria 6557588
204 2616307918 2615840626 Bacteria 7921970
205 2616553153 2615840698 Bacteria 7319877
206 2617381768 2617270742 Bacteria 6808054
207 2617382397 2617270742 Bacteria 6808054
208 2643810930 2643221558 Bacteria 5460675
209 2644003673 2643221599 Bacteria 6292121
210 2671112913 2667528174 Bacteria 6435400
211 2719183956 2718217882 Bacteria 6556348
212 2719388718 2718217927 Bacteria 6972593
213 2719668242 2718217997 Bacteria 6740740
214 2719728397 2718218009 Bacteria 6478651
215 2720495005 2718218199 Bacteria 6740745
216 2720611324 2718218232 Bacteria 6720332
217 2720616494 2718218233 Bacteria 6662049
218 2720629579 2718218235 Bacteria 6630699
219 2720772152 2718218269 Bacteria 6906114
220 2721145258 2718218363 Bacteria 6524337
221 2721156002 2718218365 Bacteria 6274507
222 2721167345 2718218366 Bacteria 6425255
223 2721403345 2718218423 Bacteria 6438183
224 2722838323 2721755514 Bacteria 6424414
225 2723029576 2721755556 Bacteria 6745503
226 2723563182 2721755684 Bacteria 6859907
227 2723571177 2721755685 Bacteria 6704835
228 2724035702 2721755809 Bacteria 6438790
229 2724042591 2721755810 Bacteria 6479005
230 2724086972 2721755819 Bacteria 6906405
231 2724107128 2721755822 Bacteria 6726041
232 2724107934 2721755823 Bacteria 6752556
233 2725951570 2724679232 Bacteria 7646494
234 2730105890 2728369352 Bacteria 6745171
235 2730162096 2728369365 Bacteria 6555560
236 2730301109 2728369397 Bacteria 6274511
237 2738803445 2738541293 Bacteria 7065685
238 2739034099 2738541333 Bacteria 7106503
239 2766068619 2765235942 Bacteria 7445910
240 2793314827 2791355259 Bacteria 7254731
241 2793321484 2791355260 Bacteria 6598818
242 2793325855 2791355261 Bacteria 6661293
243 2793332859 2791355262 Bacteria 6774204
244 2793340347 2791355263 Bacteria 6872478
245 2793345960 2791355264 Bacteria 6429314
246 2793357998 2791355266 Bacteria 7116587
247 2793366759 2791355267 Bacteria 7222458
248 2805927862 2802429605 Bacteria 6875453
249 2805933709 2802429606 Bacteria 6346811
250 2806042896 2802429633 Bacteria 7341974
251 2806043284 2802429633 Bacteria 7341974
252 2806050849 2802429634 Bacteria 7083200
253 2806057983 2802429635 Bacteria 7650140
254 2806065304 2802429636 Bacteria 7597525
255 2806076787 2802429637 Bacteria 7067217
256 2819608015 2818991448 Bacteria 6772224
257 2819613402 2818991448 Bacteria 6772224
258 2819640187 2818991453 Bacteria 7181617
259 2838019268 2838016132 Bacteria 6577831
260 2838026667 2838022645 Bacteria 6494267
261 2838033755 2838029111 Bacteria 6603031
262 2838050334 2838048938 Bacteria 6044578
263 2838063037 2838061910 Bacteria 6794874
264 2838071598 2838068647 Bacteria 6208656
265 2838075571 2838074704 Bacteria 6785777
266 2838673667 2838668709 Bacteria 6671819
267 2838684187 2838680041 Bacteria 6545511
268 2838692293 2838686498 Bacteria 7807632
269 2838699677 2838694306 Bacteria 6853137
270 2838705300 2838701080 Bacteria 6669771
271 2838712037 2838707686 Bacteria 6619912
272 2838734289 2838729681 Bacteria 7400765
273 2838746741 2838742623 Bacteria 7396178
274 2841853432 2841851746 Bacteria 7532261
275 2841862943 2841859092 Bacteria 5436171
276 2841869186 2841864319 Bacteria 6742987
277 2842081653 2842077413 Bacteria 6508645
278 2842114649 2842110456 Bacteria 7656360
279 2842122229 2842118031 Bacteria 7033875
280 2842150210 2842146304 Bacteria 5957337
281 2842161483 2842156927 Bacteria 6894975
282 2842167312 2842163707 Bacteria 6916235
283 2842185716 2842180545 Bacteria 6888678
284 2842195453 2842192696 Bacteria 6147454
285 2842202270 2842198810 Bacteria 6608673
286 2842223136 2842217011 Bacteria 7497767
287 2842234113 2842229732 Bacteria 7475766
288 2842241449 2842237096 Bacteria 6620661
289 2842246414 2842243621 Bacteria 7421798
290 2842254896 2842250916 Bacteria 6579627
291 2842260726 2842257432 Bacteria 7401195
292 2842269376 2842264693 Bacteria 6472963
293 2842276015 2842271015 Bacteria 7807131
294 2842295309 2842291075 Bacteria 7076806
295 2842303206 2842298080 Bacteria 6123127
296 2842303238 2842298080 Bacteria 6123127
297 2842308666 2842304105 Bacteria 7023636
298 2842311996 2842311132 Bacteria 6616990
299 2842319215 2842317721 Bacteria 6793725
300 2842344272 2842341865 Bacteria 7003929
301 2842363681 2842357229 Bacteria 6485165
302 2842368177 2842363717 Bacteria 6844742
303 2842375852 2842370503 Bacteria 7038661
304 2842381916 2842377471 Bacteria 7140707
305 2842388778 2842384541 Bacteria 7057858
306 2842396666 2842395702 Bacteria 6780583
307 2842425231 2842422224 Bacteria 6239196
308 2842432667 2842428310 Bacteria 6767288
309 2842438885 2842434925 Bacteria 6502746
310 2842445515 2842441272 Bacteria 6769273
311 2842449969 2842447887 Bacteria 6754142
312 2842467760 2842462802 Bacteria 6588055
313 2842473500 2842469257 Bacteria 6752936
314 2842480502 2842475841 Bacteria 6603183
315 2842484075 2842482326 Bacteria 7212537
316 2842491662 2842489311 Bacteria 6620893
317 2842499732 2842495871 Bacteria 6820686
318 2842507217 2842502639 Bacteria 6604161
319 2842519540 2842515876 Bacteria 5436280
320 2844460846 2844454524 Bacteria 7952546
321 2852394441 2852387548 Bacteria 8025568
322 2857519455 2857516855 Bacteria 7787325
323 2889792034 2889790730 Bacteria 5689708
324 2889918337 2889914905 Bacteria 5702301
325 2896388865 2896384573 Bacteria 7700774
326 2919412701 2919408235 Bacteria 6149349
327 2933011853 2933011516 Bacteria 5439334
328 2933575203 2933570622 Bacteria 7023390
329 2933590495 2933586486 Bacteria 7667493
330 2933602397 2933599457 Bacteria 5858799
331 2935898472 2935894831 Bacteria 6620579
332 2935906904 2935901341 Bacteria 7341747
333 2936370430 2936367885 Bacteria 7324495
334 2936378095 2936375103 Bacteria 6652732
335 2936385489 2936381700 Bacteria 7006523
336 2939671727 2939669807 Bacteria 5028511
337 2996896761 2996893221 Bacteria 5823108
338 3005421130 3005416602 Bacteria 7064308
339 3005458304 3005452660 Bacteria 5889319
340 639651970 639633055 Bacteria 7751309
341 8005277441 8005275841 Bacteria 6929066
342 8005288042 8005282627 Bacteria 6675747
343 8005289411 8005289223 Bacteria 6634003
344 8005305257 8005301065 Bacteria 6614431
345 8005313361 8005307578 Bacteria 7395396
346 8005319135 8005314921 Bacteria 7072929
347 8005382104 8005376324 Bacteria 6590079
348 8005388647 8005382845 Bacteria 6732062
349 8005397992 8005395548 Bacteria 6806915
350 8005431265 8005430974 Bacteria 6689030
351 8005467054 8005460587 Bacteria 7157962
352 8005489542 8005484373 Bacteria 6297373
353 8005503258 8005497431 Bacteria 6477605
354 8005561928 8005556819 Bacteria 6908598
355 8005567333 8005563573 Bacteria 7153261
356 8005575749 8005570704 Bacteria 6957481
357 8005625403 8005619151 Bacteria 7030230
358 8005630385 8005626139 Bacteria 6534237
359 8005645473 8005645114 Bacteria 6950293
360 8005650408 8005645114 Bacteria 6950293
361 8005675177 8005668836 Bacteria 6953162
362 8005683448 8005682033 Bacteria 6726518
363 8005689279 8005688590 Bacteria 6610080
364 8005696853 8005695170 Bacteria 6912330
365 8018127790 8018127388 Bacteria 7351159
366 8018166155 8018163183 Bacteria 7277977
367 8018182948 8018176218 Bacteria 6896178
368 8023688318 8023680758 Bacteria 7729763
369 8024483954 8024479707 Bacteria 6954785
370 8024487325 8024486573 Bacteria 6540512
371 8024488935 8024486573 Bacteria 6540512
372 8024504011 8024501048 Bacteria 6427847
373 8046774731 8046767195 Bacteria 7547379
374 8056375381 8056375014 Bacteria 7006639
375 8056383092 8056382006 Bacteria 6408074
376 8057578646 8057575449 Bacteria 7367519
377 8057880840 8057874678 Bacteria 7494653
378 Ga0075428_100009938
379 JGI25162J39368_1000365
380 JGI25152J39213_1001841
381 JGI25151J46595_10000508
382 JGI25151J46595_10009496
383 JGI25165J46597_1001675
384 JGI25165J46597_1003343
385 JGI25153J46596_10006031
386 rootH1_10016241
387 rootH2_10063918
388 rootL2_10027409
389 rootL2_10032165
390 rootL2_10061222
391 rootH1_10013822
392 rootH1_10243441
393 JGI25160J50197_1000014
394 JGI25160J50197_1005949
395 JGI25161J50226_1000061
396 JGI25161J50226_1008166
397 Ga0055526_1000991
398 Ga0055526_1004842
399 Ga0055526_1013723
400 Ga0055526_1023639
401 Ga0055524_1002762
402 Ga0055528_1000109
403 Ga0055528_1000206
404 Ga0055528_1019456
405 Ga0055540_1000197
406 Ga0055543_1000005
407 Ga0055543_1000578
408 Ga0065165_1000126
409 Ga0065165_1010980
410 Ga0070669_100026661
411 Ga0070674_100004659
412 Ga0068866_10020742
413 Ga0068851_10070460
414 Ga0068862_100171839
415 Ga0081538_10000693
416 Ga0081540_1036168
417 Ga0075368_10017504
418 Ga0075370_10007207
419 Ga0075428_100152221
420 Ga0075428_100300195
421 Ga0068865_100053657
422 Ga0105240_10000012
423 Ga0105240_10344134
424 Ga0105240_10437099
425 Ga0111539_10000167
426 Ga0114129_10064305
427 Ga0105248_10240742
428 Ga0105237_10001333
429 Ga0123341_1000056
430 Ga0123342_1024749
431 Ga0157370_10019121
432 Ga0182005_1000879
433 Ga0209437_100040
434 Ga0207425_1005570
435 Ga0209677_100948
436 Ga0209129_1000016
437 Ga0209129_1001027
438 Ga0209233_1000051
439 Ga0209233_1000146
440 Ga0209233_1000216
441 Ga0209673_1000005
442 Ga0209673_1000023
443 Ga0209673_1000797
444 Ga0209673_1010190
445 Ga0209130_1000013
446 Ga0209675_1011924
447 Ga0209025_1002393
448 Ga0209025_1004618
449 Ga0209564_1000112
450 Ga0209564_1007010
451 Ga0209758_1001534
452 Ga0209758_1003167
453 Ga0209050_1022077
454 Ga0209256_1000485
455 Ga0209256_1000549
456 Ga0209256_1018319
457 Ga0207426_1000022
458 Ga0207426_1000355
459 Ga0209051_1000119
460 Ga0209257_1023179
461 Ga0207656_10034827
462 Ga0207642_10022489
463 Ga0207695_10000120
464 Ga0207695_10012471
465 Ga0207695_10295760
466 Ga0207671_10000755
467 Ga0207669_10018687
468 Ga0207704_10035457
469 Ga0207428_10000055
470 Ga0268265_10150630
471 Ga0265318_10003621
472 Ga0307515_10007811
473 Ga0307515_10238826
474 Ga0307513_10008730
475 Ga0265314_10024925
476 Ga0307415_100115609
477 Ga0451841_0267452
478 Ga0451847_0653548
479 Ga0451851_0227649
480 Ga0451843_0244535
481 Ga0451855_0274739
482 Ga0466963_0008728
483 Ga0466970_0001801
484 Ga0466957_0049471
485 Ga0466967_0160702
486 Ga0466967_0258718
487 Ga0495638_0000221
488 Ga0495662_0006894
489 Ga0495662_0009308
490 Ga0495583_0002418
491 Ga0495606_0005405
492 Ga0495606_0125236
493 Ga0495648_0046794
494 Ga0495648_0060867
495 Ga0495609_0038382
496 Ga0495625_0059707
497 Ga0495672_0031605
498 Ga0495686_0000547
499 Ga0495686_0046323
500 Ga0495626_0029582
501 Ga0496101_0047738
502 Ga0496101_0186586
503 Ga0496116_0026027
504 Ga0496116_0046446
505 Ga0496117_0022658
506 Ga0496117_0071649
507 Ga0496118_0000678
508 Ga0496118_0025744
509 Ga0496121_0006740
510 Ga0496121_0040375
511 Ga0496121_0041028
512 Ga0496122_0013405
513 Ga0496123_0030462
514 Ga0496124_0006040
515 Ga0496125_0019854
516 Ga0496126_0049046
517 Ga0496126_0112746
518 Ga0496126_0243400
519 Ga0501033_0048227
520 Ga0501034_0041533
521 Ga0501034_0118885
522 Ga0501067_0153425
523 Ga0501068_0068263
524 Ga0501070_0005092
525 Ga0501073_0093721
526 Ga0501073_0111525
527 Ga0501080_0104183
528 Ga0501044_0190620
529 nmdc:mga03683_53143_c1
530 nmdc:mga06r32_534738_c1
531 nmdc:mga08y16_37_c1
532 Ga0500594_0024308
533 Ga0500607_106364
534 Ga0500618_002873
535 Ga0500658_0001270
536 Ga0500568_0005923
537 Ga0500590_000016
538 Ga0500616_0000852
539 Ga0500616_0030779
540 2509385766
541 2509448180
542 2510136751
543 2510843599
544 2510899984
545 2510900580
546 2511132953
547 2513569374
548 2513576695
549 2513631625
550 2513710040
551 2513910014
552 2514021443
553 2515115326
554 2515635946
555 2515644789
556 2515658088
557 2515742187
558 2517041679
559 2517080738
560 2517099136
561 2517411035
562 2524461626
563 2524461764
564 2530644835
565 2585233668
566 2585266048
567 2585272332
568 2585278400
569 2585324756
570 2585332189
571 2585524420
572 2585531944
573 2585538674
574 2585552303
575 2585561604
576 2585836627
577 2585847911
578 2585906832
579 2587982253
580 2616295018
581 2616307918
582 2616553153
583 2617381768
584 2617382397
585 2643810930
586 2644003673
587 2671112913
588 2719183956
589 2719388718
590 2719668242
591 2719728397
592 2720495005
593 2720611324
594 2720616494
595 2720629579
596 2720772152
597 2721145258
598 2721156002
599 2721167345
600 2721403345
601 2722838323
602 2723029576
603 2723563182
604 2723571177
605 2724035702
606 2724042591
607 2724086972
608 2724107128
609 2724107934
610 2725951570
611 2730105890
612 2730162096
613 2730301109
614 2738803445
615 2739034099
616 2766068619
617 2793314827
618 2793321484
619 2793325855
620 2793332859
621 2793340347
622 2793345960
623 2793357998
624 2793366759
625 2805927862
626 2805933709
627 2806042896
628 2806043284
629 2806050849
630 2806057983
631 2806065304
632 2806076787
633 2819608015
634 2819613402
635 2819640187
636 2838019268
637 2838026667
638 2838033755
639 2838050334
640 2838063037
641 2838071598
642 2838075571
643 2838673667
644 2838684187
645 2838692293
646 2838699677
647 2838705300
648 2838712037
649 2838734289
650 2838746741
651 2841853432
652 2841862943
653 2841869186
654 2842081653
655 2842114649
656 2842122229
657 2842150210
658 2842161483
659 2842167312
660 2842185716
661 2842195453
662 2842202270
663 2842223136
664 2842234113
665 2842241449
666 2842246414
667 2842254896
668 2842260726
669 2842269376
670 2842276015
671 2842295309
672 2842303206
673 2842303238
674 2842308666
675 2842311996
676 2842319215
677 2842344272
678 2842363681
679 2842368177
680 2842375852
681 2842381916
682 2842388778
683 2842396666
684 2842425231
685 2842432667
686 2842438885
687 2842445515
688 2842449969
689 2842467760
690 2842473500
691 2842480502
692 2842484075
693 2842491662
694 2842499732
695 2842507217
696 2842519540
697 2844460846
698 2852394441
699 2857519455
700 2889792034
701 2889918337
702 2896388865
703 2919412701
704 2933011853
705 2933575203
706 2933590495
707 2933602397
708 2935898472
709 2935906904
710 2936370430
711 2936378095
712 2936385489
713 2939671727
714 2996896761
715 3005421130
716 3005458304
717 639651970
718 8005277441
719 8005288042
720 8005289411
721 8005305257
722 8005313361
723 8005319135
724 8005382104
725 8005388647
726 8005397992
727 8005431265
728 8005467054
729 8005489542
730 8005503258
731 8005561928
732 8005567333
733 8005575749
734 8005625403
735 8005630385
736 8005645473
737 8005650408
738 8005675177
739 8005683448
740 8005689279
741 8005696853
742 8018127790
743 8018166155
744 8018182948
745 8023688318
746 8024483954
747 8024487325
748 8024488935
749 8024504011
750 8046774731
751 8056375381
752 8056383092
753 8057578646
754 8057880840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14759

Reductase_C

Reductase C-terminal

327

411

0.98

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

4

308

0.94

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

150

233

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ef6-assembly1.cif.gz_A crystal structure of toluene 2,3-dioxygenase reductase 0.9389 2 405
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.9382 1 404
3ef6-assembly1.cif.gz_A crystal structure of toluene 2,3-dioxygenase reductase 0.9344 2 405
4h4u-assembly1.cif.gz_A-2 crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form) 0.9343 4 408
4h4x-assembly1.cif.gz_A crystal structure of ferredoxin reductase, bpha4 e175a/t176r/q177g mutant (oxidized form) 0.9335 4 408
ID Description Score Start End Superfamily
4k8dA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9561 142 233 3.50.50.60
2yquB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9554 142 235 3.50.50.60
5x1yA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9432 142 233 3.50.50.60
2rabB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9431 142 232 3.50.50.60
3lb8B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9428 124 235 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A527XJR8-F1-model_v4 Ferredoxin reductase 0.9936 296 380
AF-K0VW54-F1-model_v4 FAD-dependent pyridine nucleotide-disulfide oxidoreductase 0.976 1 248 GO:0005737
GO:0016651
GO:0046872
GO:0051537
AF-A0A529WZ47-F1-model_v4 Ferredoxin reductase 0.9754 1 354 GO:0005737
GO:0016651
AF-A0A3S2PDA6-F1-model_v4 deleted 0.9718 36 408
AF-A0A527XJR8-F1-model_v4 Ferredoxin reductase 0.9709 296 380

Map