F427669

General Info

Members Datasets Scaffolds Average Seq Length
377 230 348 185

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10027230|Ga0111539_100272302
Length 174
Sequence LRHLVAIQIQDLPLNGLRLIEPPVHTDPRGYFFELHHQARFEQLGLDVTLVQDNVSRSRRDVLRGLHFQAPAWQGKLVSVLQGEIFDVAVDLRRDSPTFGQWHGVCLSEENHRQLWVPPGFAVLYKCSAFYDPAHEHTLLWNDPDLGISWPVARPLVSEKDARGKRLRELPLAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
3 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
4 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
5 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
6 2818991457 Xanthomonas translucens 569 Isolate Unclassified
7 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
8 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
9 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
10 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
11 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
12 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
13 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
14 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
15 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
16 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
17 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
18 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
19 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
20 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
21 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
22 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
23 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
24 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
25 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
26 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
27 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
28 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
229 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
230 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.04
Metatranscriptomes 0.27
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 0.27
Rhizoplane 2.65
Rhizosphere 66.84
Stem 0
Stem Tuber 0
Unclassified 20.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1859639 2162886007 Bacteria 933
2 SwRhRL2b_contig_1921671 2162886007 Bacteria 6761
3 SwRhRL2b_contig_2034220 2162886007 Bacteria 2070
4 SwRhRL2b_contig_268782 2162886007 Bacteria 6287
5 JGI24741J21665_1006669 3300001915 Bacteria 2299
6 JGI24740J21852_10030076 3300001979 Bacteria 1774
7 rootH2_10067962 3300003320 Bacteria 2255
8 Ga0055527_1004526 3300003760 Bacteria 1900
9 Ga0055535_1000809 3300003761 Bacteria 22652
10 Ga0055542_1000285 3300003762 Bacteria 56650
11 Ga0055529_1000304 3300003763 Bacteria 56650
12 Ga0055526_1000218 3300003771 Bacteria 49706
13 Ga0055537_1000196 3300003773 Bacteria 45345
14 Ga0055536_1000357 3300003781 Bacteria 33928
15 Ga0055534_1000061 3300003784 Bacteria 82050
16 Ga0055528_1000332 3300003790 Bacteria 39798
17 Ga0055530_10002004 3300003791 Bacteria 13800
18 Ga0055531_10000512 3300003794 Bacteria 34953
19 Ga0055531_10000741 3300003794 Bacteria 27490
20 Ga0058692_1000026 3300003856 Bacteria 203096
21 Ga0065165_1000093 3300005262 Bacteria 146751
22 Ga0065714_10077704 3300005288 Bacteria 2666
23 Ga0065704_10070252 3300005289 Bacteria 48050
24 Ga0065704_10237693 3300005289 Bacteria 1024
25 Ga0065715_10005422 3300005293 Bacteria 4194
26 Ga0065715_10118500 3300005293 Bacteria 2314
27 Ga0070670_100003611 3300005331 Bacteria 12874
28 Ga0070680_100047853 3300005336 Bacteria 3483
29 Ga0070680_100130753 3300005336 Bacteria 2100
30 Ga0070680_100671907 3300005336 Bacteria 891
31 Ga0070682_100915641 3300005337 Bacteria 722
32 Ga0068868_100650897 3300005338 Bacteria 938
33 Ga0070660_100619337 3300005339 Bacteria 906
34 Ga0070691_10004997 3300005341 Bacteria 6033
35 Ga0070691_10047971 3300005341 Bacteria 2031
36 Ga0070691_10344665 3300005341 Bacteria 826
37 Ga0070691_10345013 3300005341 Bacteria 825
38 Ga0070661_100118110 3300005344 Bacteria 1984
39 Ga0070661_100243895 3300005344 Bacteria 1384
40 Ga0070661_100593680 3300005344 Bacteria 895
41 Ga0070692_10069574 3300005345 Bacteria 1872
42 Ga0070668_100019998 3300005347 Bacteria 5048
43 Ga0070669_101215442 3300005353 Bacteria 651
44 Ga0070673_100102682 3300005364 Bacteria 2358
45 Ga0070659_100331677 3300005366 Bacteria 1273
46 Ga0070663_100066073 3300005455 Bacteria 2620
47 Ga0070663_100075254 3300005455 Bacteria 2467
48 Ga0070663_100218751 3300005455 Bacteria 1494
49 Ga0070678_101230018 3300005456 Bacteria 695
50 Ga0070662_100176202 3300005457 Bacteria 1683
51 Ga0070681_10001533 3300005458 Bacteria 20461
52 Ga0070681_10037603 3300005458 Bacteria 4856
53 Ga0070681_10038032 3300005458 Bacteria 4825
54 Ga0070679_100001575 3300005530 Bacteria 20436
55 Ga0070679_100040789 3300005530 Bacteria 4618
56 Ga0070679_100233878 3300005530 Bacteria 1797
57 Ga0070679_100459093 3300005530 Bacteria 1218
58 Ga0070684_100290711 3300005535 Bacteria 1498
59 Ga0070693_100018430 3300005547 Bacteria 3646
60 Ga0070665_100247458 3300005548 Bacteria 1783
61 Ga0070665_100249583 3300005548 Bacteria 1775
62 Ga0070664_100052570 3300005564 Bacteria 3451
63 Ga0068857_100242282 3300005577 Bacteria 1651
64 Ga0068857_100439528 3300005577 Bacteria 1218
65 Ga0068854_100069968 3300005578 Bacteria 2564
66 Ga0068854_100105640 3300005578 Bacteria 2117
67 Ga0068854_100180416 3300005578 Bacteria 1649
68 Ga0068854_100294159 3300005578 Bacteria 1311
69 Ga0068859_100248701 3300005617 Bacteria 1868
70 Ga0068864_100554191 3300005618 Bacteria 1111
71 Ga0068858_100209786 3300005842 Bacteria 1843
72 Ga0081539_10007810 3300005985 Bacteria 9567
73 Ga0075364_10374325 3300006051 Bacteria 971
74 Ga0075362_10164430 3300006177 Bacteria 1070
75 Ga0097621_100120579 3300006237 Bacteria 2224
76 Ga0075428_101413269 3300006844 Bacteria 730
77 Ga0097620_100248706 3300006931 Bacteria 1868
78 Ga0105251_10000137 3300009011 Bacteria 74569
79 Ga0105244_10036613 3300009036 Bacteria 2569
80 Ga0105240_10785646 3300009093 Bacteria 1032
81 Ga0105240_10888806 3300009093 Bacteria 959
82 Ga0111539_10027230 3300009094 Bacteria 6981
83 Ga0111539_10215866 3300009094 Bacteria 2235
84 Ga0111539_10631023 3300009094 Bacteria 1248
85 Ga0105237_10663254 3300009545 Bacteria 1050
86 Ga0105237_10741441 3300009545 Bacteria 989
87 Ga0105238_10423370 3300009551 Bacteria 1326
88 Ga0105249_11243949 3300009553 Bacteria 816
89 Ga0157373_10003377 3300013100 Bacteria 12076
90 Ga0157373_10004558 3300013100 Bacteria 10420
91 Ga0157373_10028173 3300013100 Bacteria 4053
92 Ga0157373_10114559 3300013100 Bacteria 1895
93 Ga0157371_10000450 3300013102 Bacteria 50419
94 Ga0157371_10000679 3300013102 Bacteria 40240
95 Ga0157371_10045094 3300013102 Bacteria 3138
96 Ga0157370_10011689 3300013104 Bacteria 9162
97 Ga0157370_10151660 3300013104 Bacteria 2157
98 Ga0157370_10196348 3300013104 Bacteria 1873
99 Ga0157370_10319541 3300013104 Bacteria 1432
100 Ga0157369_10019802 3300013105 Bacteria 7531
101 Ga0157369_10239087 3300013105 Bacteria 1897
102 Ga0157369_10383940 3300013105 Bacteria 1458
103 Ga0157378_10078085 3300013297 Bacteria 2986
104 Ga0157372_10110968 3300013307 Bacteria 3141
105 Ga0157372_10545264 3300013307 Bacteria 1352
106 Ga0157372_11005085 3300013307 Bacteria 966
107 Ga0157380_10585977 3300014326 Bacteria 1101
108 Ga0157379_10364972 3300014968 Bacteria 1324
109 Ga0157379_10429396 3300014968 Bacteria 1217
110 Ga0157376_10864323 3300014969 Bacteria 920
111 Ga0182006_1010931 3300015261 Bacteria 4014
112 Ga0182007_10000190 3300015262 Bacteria 41334
113 Ga0182007_10001819 3300015262 Bacteria 11136
114 Ga0182005_1007698 3300015265 Bacteria 3217
115 Ga0163161_10006770 3300017792 Bacteria 7917
116 Ga0163161_10016174 3300017792 Bacteria 5207
117 Ga0163161_10022036 3300017792 Bacteria 4482
118 Ga0154015_1289840 3300020610 Bacteria 1056
119 Ga0209672_100109 3300025228 Bacteria 96247
120 Ga0209258_100185 3300025242 Bacteria 132820
121 Ga0209148_1000042 3300025254 Bacteria 464111
122 Ga0209565_1000037 3300025263 Bacteria 289371
123 Ga0209455_1000016 3300025272 Bacteria 753097
124 Ga0209673_1000032 3300025273 Bacteria 339956
125 Ga0209675_1000020 3300025291 Bacteria 335854
126 Ga0209675_1012937 3300025291 Bacteria 2649
127 Ga0209676_1000149 3300025292 Bacteria 167854
128 Ga0209676_1000199 3300025292 Bacteria 134270
129 Ga0209676_1000775 3300025292 Bacteria 42707
130 Ga0209564_1000210 3300025295 Bacteria 133323
131 Ga0209050_1000199 3300025298 Bacteria 134682
132 Ga0209050_1023620 3300025298 Bacteria 2156
133 Ga0209256_1003064 3300025299 Bacteria 12303
134 Ga0209051_1052122 3300025303 Bacteria 1355
135 Ga0209257_1000067 3300025304 Bacteria 342468
136 Ga0209257_1000086 3300025304 Bacteria 287437
137 Ga0209257_1000664 3300025304 Bacteria 54069
138 Ga0209257_1000734 3300025304 Bacteria 49703
139 Ga0209257_1049179 3300025304 Bacteria 1202
140 Ga0207655_1031255 3300025728 Bacteria 2457
141 Ga0207713_1000253 3300025735 Bacteria 66728
142 Ga0207647_10026132 3300025904 Bacteria 3823
143 Ga0207705_10015664 3300025909 Bacteria 5444
144 Ga0207705_10056114 3300025909 Bacteria 2840
145 Ga0207705_10091355 3300025909 Bacteria 2230
146 Ga0207705_10225179 3300025909 Bacteria 1425
147 Ga0207705_10531314 3300025909 Bacteria 914
148 Ga0207707_10000548 3300025912 Bacteria 38306
149 Ga0207707_10006627 3300025912 Bacteria 10103
150 Ga0207707_10108634 3300025912 Bacteria 2425
151 Ga0207695_10013042 3300025913 Bacteria 9926
152 Ga0207695_10170558 3300025913 Bacteria 2102
153 Ga0207695_10576456 3300025913 Bacteria 1007
154 Ga0207695_10935068 3300025913 Bacteria 747
155 Ga0207660_10017076 3300025917 Bacteria 4815
156 Ga0207660_10034567 3300025917 Bacteria 3504
157 Ga0207660_10046786 3300025917 Bacteria 3055
158 Ga0207660_10495893 3300025917 Bacteria 991
159 Ga0207660_10635121 3300025917 Bacteria 870
160 Ga0207660_10774501 3300025917 Bacteria 783
161 Ga0207657_10225600 3300025919 Bacteria 1500
162 Ga0207657_10433108 3300025919 Bacteria 1033
163 Ga0207649_10242985 3300025920 Bacteria 1293
164 Ga0207652_10000565 3300025921 Bacteria 37414
165 Ga0207652_10002262 3300025921 Bacteria 16333
166 Ga0207652_10042402 3300025921 Bacteria 3873
167 Ga0207652_10439024 3300025921 Bacteria 1177
168 Ga0207652_10849263 3300025921 Bacteria 808
169 Ga0207650_10002871 3300025925 Bacteria 11898
170 Ga0207650_10067301 3300025925 Bacteria 2688
171 Ga0207644_10361701 3300025931 Bacteria 1180
172 Ga0207690_10152508 3300025932 Bacteria 1714
173 Ga0207690_10341231 3300025932 Bacteria 1182
174 Ga0207667_10045157 3300025949 Bacteria 4667
175 Ga0207667_10077501 3300025949 Bacteria 3447
176 Ga0207667_10102662 3300025949 Bacteria 2949
177 Ga0207667_10400127 3300025949 Bacteria 1398
178 Ga0207668_10019457 3300025972 Bacteria 4293
179 Ga0207640_10050550 3300025981 Bacteria 2698
180 Ga0207658_10681701 3300025986 Bacteria 928
181 Ga0207639_10269239 3300026041 Bacteria 1493
182 Ga0207678_10007269 3300026067 Bacteria 9817
183 Ga0207678_10116078 3300026067 Bacteria 2284
184 Ga0207702_10449310 3300026078 Bacteria 1250
185 Ga0207676_10131975 3300026095 Bacteria 2125
186 Ga0207674_10145451 3300026116 Bacteria 2329
187 Ga0207683_10633991 3300026121 Bacteria 990
188 Ga0209371_1000028 3300027312 Bacteria 429688
189 Ga0209995_1010204 3300027471 Bacteria 1521
190 Ga0207428_10363444 3300027907 Bacteria 1064
191 Ga0268266_10271496 3300028379 Bacteria 1574
192 Ga0268266_10901139 3300028379 Bacteria 855
193 Ga0268264_10158414 3300028381 Bacteria 2037
194 Ga0307515_10284016 3300028794 Bacteria 1359
195 Ga0268256_1000030 3300030500 Bacteria 429688
196 Ga0316181_1085609 3300030744 Bacteria 1991
197 Ga0307513_10082278 3300031456 Bacteria 3315
198 Ga0307408_100062318 3300031548 Bacteria 2725
199 Ga0307516_10066109 3300031730 Bacteria 3489
200 Ga0307410_10251731 3300031852 Bacteria 1374
201 Ga0307410_10395715 3300031852 Bacteria 1115
202 Ga0307406_10554364 3300031901 Bacteria 941
203 Ga0307412_10000422 3300031911 Bacteria 25696
204 Ga0307412_10002851 3300031911 Bacteria 9591
205 Ga0307416_100019631 3300032002 Bacteria 4799
206 Ga0307414_10049987 3300032004 Bacteria 2894
207 Ga0307414_10123148 3300032004 Bacteria 1997
208 Ga0307411_10151745 3300032005 Bacteria 1723
209 Ga0307411_10578049 3300032005 Bacteria 963
210 Ga0395899_0028130 3300037312 Bacteria 4234
211 Ga0395899_0035682 3300037312 Bacteria 3732
212 Ga0395899_0052601 3300037312 Bacteria 3018
213 Ga0395900_0010565 3300037418 Bacteria 9442
214 Ga0395900_0030936 3300037418 Bacteria 5497
215 Ga0395900_0137822 3300037418 Bacteria 2500
216 Ga0395900_0653251 3300037418 Bacteria 988
217 Ga0395898_0030025 3300037466 Bacteria 5442
218 Ga0395898_0376727 3300037466 Bacteria 1353
219 Ga0395905_0001195 3300037471 Bacteria 32485
220 Ga0395905_0099463 3300037471 Bacteria 2731
221 Ga0395905_0113121 3300037471 Bacteria 2550
222 Ga0395901_0023786 3300038443 Bacteria 6282
223 Ga0395901_0296001 3300038443 Bacteria 1678
224 Ga0395901_0656583 3300038443 Bacteria 1051
225 Ga0395901_1311231 3300038443 Bacteria 685
226 Ga0439436_0000066 3300041404 Bacteria 29532
227 Ga0451807_1491765 3300041486 Bacteria 992
228 Ga0451833_0426302 3300041491 Bacteria 1299
229 Ga0451843_0080570 3300041509 Bacteria 1455
230 Ga0451853_0209765 3300041512 Bacteria 766
231 Ga0450901_007188 3300042533 Bacteria 1146
232 Ga0466966_0008551 3300044684 Bacteria 6776
233 Ga0466971_0207052 3300044719 Bacteria 927
234 Ga0466959_0577283 3300045049 Bacteria 757
235 Ga0495638_0001623 3300046460 Bacteria 20015
236 Ga0495606_0119493 3300046507 Bacteria 1579
237 Ga0495610_0001987 3300046512 Bacteria 17452
238 Ga0495610_0231041 3300046512 Bacteria 742
239 Ga0495644_0121598 3300046523 Bacteria 993
240 Ga0495663_0005381 3300046525 Bacteria 3553
241 Ga0495598_0008269 3300046537 Bacteria 2417
242 Ga0495633_0028625 3300046558 Bacteria 2713
243 Ga0495668_0001955 3300046616 Bacteria 18282
244 Ga0495668_0056429 3300046616 Bacteria 2168
245 Ga0495625_0014458 3300046660 Bacteria 6297
246 Ga0495660_0000348 3300046810 Bacteria 40994
247 Ga0495636_0052584 3300047318 Bacteria 1709
248 Ga0495677_0037116 3300047445 Bacteria 1780
249 Ga0495673_0000036 3300047469 Bacteria 311035
250 Ga0495686_0000033 3300047472 Bacteria 342031
251 Ga0496100_0231345 3300048903 Bacteria 1360
252 Ga0496104_0325546 3300048907 Bacteria 1450
253 Ga0496104_0334400 3300048907 Bacteria 1427
254 Ga0496105_0079477 3300048908 Bacteria 2708
255 Ga0496108_0375936 3300048911 Bacteria 1240
256 Ga0496109_0015915 3300048912 Bacteria 6569
257 Ga0496109_0464971 3300048912 Bacteria 1194
258 Ga0496112_0182950 3300048915 Bacteria 2059
259 Ga0496113_0030158 3300048916 Bacteria 3923
260 Ga0496116_0004829 3300048919 Bacteria 12718
261 Ga0496116_0054466 3300048919 Bacteria 2635
262 Ga0496117_0002697 3300048920 Bacteria 21945
263 Ga0496117_0003170 3300048920 Bacteria 19550
264 Ga0496117_0027591 3300048920 Bacteria 4418
265 Ga0496117_0041272 3300048920 Bacteria 3383
266 Ga0496118_0000646 3300048921 Bacteria 57111
267 Ga0496118_0003380 3300048921 Bacteria 20165
268 Ga0496118_0099320 3300048921 Bacteria 1973
269 Ga0496118_0144429 3300048921 Bacteria 1501
270 Ga0496119_0000113 3300048922 Bacteria 114626
271 Ga0496119_0000583 3300048922 Bacteria 49314
272 Ga0496119_0014798 3300048922 Bacteria 6070
273 Ga0496119_0044094 3300048922 Bacteria 2811
274 Ga0496119_0079833 3300048922 Bacteria 1888
275 Ga0496119_0241983 3300048922 Bacteria 914
276 Ga0496119_0425722 3300048922 Bacteria 629
277 Ga0496120_0000187 3300048923 Bacteria 105936
278 Ga0496120_0000262 3300048923 Bacteria 88205
279 Ga0496120_0000450 3300048923 Bacteria 65290
280 Ga0496120_0036229 3300048923 Bacteria 2939
281 Ga0496120_0039025 3300048923 Bacteria 2805
282 Ga0496121_0008306 3300048924 Bacteria 12277
283 Ga0496121_0070895 3300048924 Bacteria 2804
284 Ga0496121_0107578 3300048924 Bacteria 2135
285 Ga0496121_0356469 3300048924 Bacteria 972
286 Ga0496122_0000537 3300048925 Bacteria 78505
287 Ga0496122_0002036 3300048925 Bacteria 30007
288 Ga0496122_0037580 3300048925 Bacteria 3894
289 Ga0496122_0041311 3300048925 Bacteria 3649
290 Ga0496122_0194159 3300048925 Bacteria 1194
291 Ga0496123_0000987 3300048926 Bacteria 43765
292 Ga0496123_0001380 3300048926 Bacteria 34009
293 Ga0496123_0021304 3300048926 Bacteria 5042
294 Ga0496123_0191995 3300048926 Bacteria 1055
295 Ga0496124_0001915 3300048927 Bacteria 28557
296 Ga0496124_0003734 3300048927 Bacteria 18364
297 Ga0496124_0058029 3300048927 Bacteria 3257
298 Ga0496124_0059823 3300048927 Bacteria 3198
299 Ga0496124_0071265 3300048927 Bacteria 2881
300 Ga0496124_0132961 3300048927 Bacteria 1974
301 Ga0496124_0156229 3300048927 Bacteria 1783
302 Ga0496125_0005866 3300048928 Bacteria 13482
303 Ga0496125_0011875 3300048928 Bacteria 8676
304 Ga0496125_0019366 3300048928 Bacteria 6422
305 Ga0496125_0027008 3300048928 Bacteria 5212
306 Ga0496125_0097216 3300048928 Bacteria 2182
307 Ga0496125_0100999 3300048928 Bacteria 2124
308 Ga0496125_0128129 3300048928 Bacteria 1793
309 Ga0496126_0000847 3300048929 Bacteria 54109
310 Ga0496126_0032108 3300048929 Bacteria 4951
311 Ga0496126_0108026 3300048929 Bacteria 2426
312 Ga0496126_0280172 3300048929 Bacteria 1381
313 Ga0496126_0423308 3300048929 Bacteria 1076
314 Ga0501031_0107632 3300049568 Bacteria 1820
315 Ga0501032_0155673 3300049569 Bacteria 1501
316 Ga0501032_0570401 3300049569 Bacteria 721
317 Ga0501033_0029226 3300049570 Bacteria 4141
318 Ga0501034_0401326 3300049571 Bacteria 1294
319 Ga0501036_0086517 3300049572 Bacteria 2649
320 Ga0501038_0583799 3300049574 Bacteria 847
321 Ga0501039_0129487 3300049575 Bacteria 1980
322 Ga0501042_0362034 3300049578 Bacteria 1050
323 Ga0501043_0453966 3300049579 Bacteria 962
324 Ga0501046_0191258 3300049580 Bacteria 1526
325 Ga0501047_0016575 3300049581 Bacteria 7035
326 Ga0501047_0409533 3300049581 Bacteria 1188
327 Ga0501047_0696003 3300049581 Bacteria 834
328 Ga0501048_0261139 3300049582 Bacteria 1230
329 Ga0501067_0007762 3300049583 Bacteria 5968
330 Ga0501069_0386167 3300049585 Bacteria 827
331 Ga0501070_0000265 3300049586 Bacteria 49246
332 Ga0501070_0722463 3300049586 Bacteria 786
333 Ga0501071_0266833 3300049587 Bacteria 1293
334 Ga0501073_0005054 3300049589 Bacteria 9890
335 Ga0501073_0124892 3300049589 Bacteria 1784
336 Ga0501074_0660216 3300049590 Bacteria 738
337 Ga0501077_0228395 3300049593 Bacteria 1183
338 Ga0501080_0133810 3300049742 Bacteria 2295
339 Ga0501083_0075217 3300049744 Bacteria 2243
340 Ga0501035_0286705 3300049822 Bacteria 1390
341 Ga0501035_0491104 3300049822 Bacteria 1011
342 Ga0501045_0175858 3300049824 Bacteria 1595
343 nmdc:mga00v17_214037_c1 3300050491 Bacteria 1247
344 nmdc:mga06r32_1361867_c1 3300050510 Bacteria 652
345 nmdc:mga08y16_87289_c1 3300050511 Bacteria 3250
346 nmdc:mga0rr50_1071374_c1 3300050513 Bacteria 686
347 Ga0500651_0000120 3300053093 Bacteria 48678
348 Ga0501082_0248092 3300060353 Bacteria 1550

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10027230 Ga0111539_100272302 168
2 3300027907 Ga0207428_10363444 Ga0207428_103634442 168
3 3300050511 nmdc:mga08y16_87289_c1 nmdc:mga08y16_87289_c1_2282_2839 168
4 iso_pu_bacteria 2919130084 2919132062 169
5 iso_pu_bacteria 2929195423 2929199199 169
6 iso_pu_bacteria 2977247770 2977250926 170
7 3300003771 Ga0055526_1000218 Ga0055526_100021831 174
8 3300003773 Ga0055537_1000196 Ga0055537_100019637 174
9 3300003784 Ga0055534_1000061 Ga0055534_100006160 174
10 3300003790 Ga0055528_1000332 Ga0055528_100033219 174
11 3300005288 Ga0065714_10077704 Ga0065714_100777043 174
12 3300005293 Ga0065715_10005422 Ga0065715_100054223 174
13 3300009553 Ga0105249_11243949 Ga0105249_112439491 174
14 3300017792 Ga0163161_10022036 Ga0163161_100220363 174
15 3300025263 Ga0209565_1000037 Ga0209565_100003768 174
16 3300025273 Ga0209673_1000032 Ga0209673_1000032172 174
17 3300025291 Ga0209675_1000020 Ga0209675_1000020103 174
18 3300025295 Ga0209564_1000210 Ga0209564_100021020 174
19 3300048922 Ga0496119_0425722 Ga0496119_0425722_85_609 174
20 3300048923 Ga0496120_0036229 Ga0496120_0036229_800_1324 174
21 3300048924 Ga0496121_0008306 Ga0496121_0008306_10814_11338 174
22 3300048928 Ga0496125_0005866 Ga0496125_0005866_9919_10443 174
23 3300048929 Ga0496126_0000847 Ga0496126_0000847_27656_28180 174
24 3300050491 nmdc:mga00v17_214037_c1 nmdc:mga00v17_214037_c1_609_1133 174
25 3300049586 Ga0501070_0722463 Ga0501070_0722463_248_775 175
26 3300003781 Ga0055536_1000357 Ga0055536_10003575 177
27 3300003791 Ga0055530_10002004 Ga0055530_1000200412 177
28 3300003794 Ga0055531_10000512 Ga0055531_1000051227 177
29 3300025292 Ga0209676_1000199 Ga0209676_100019956 177
30 3300025298 Ga0209050_1000199 Ga0209050_100019955 177
31 3300025303 Ga0209051_1052122 Ga0209051_10521222 177
32 3300025304 Ga0209257_1000086 Ga0209257_1000086198 177
33 3300005338 Ga0068868_100650897 Ga0068868_1006508971 179
34 3300005617 Ga0068859_100248701 Ga0068859_1002487012 179
35 3300005842 Ga0068858_100209786 Ga0068858_1002097862 179
36 3300006177 Ga0075362_10164430 Ga0075362_101644302 179
37 3300006931 Ga0097620_100248706 Ga0097620_1002487062 179
38 3300014968 Ga0157379_10364972 Ga0157379_103649722 179
39 3300028381 Ga0268264_10158414 Ga0268264_101584142 179
40 3300048919 Ga0496116_0004829 Ga0496116_0004829_9225_9782 179
41 3300050510 nmdc:mga06r32_1361867_c1 nmdc:mga06r32_1361867_c1_20_580 179
42 3300050513 nmdc:mga0rr50_1071374_c1 nmdc:mga0rr50_1071374_c1_43_588 179
43 3300006237 Ga0097621_100120579 Ga0097621_1001205792 181
44 3300014969 Ga0157376_10864323 Ga0157376_108643232 181
45 iso_pu_bacteria 2747842428 2747949615 181
46 iso_pu_bacteria 2747842501 2748019021 181
47 iso_pu_bacteria 2765235840 2765577552 181
48 iso_pu_bacteria 2816332141 2816519319 181
49 iso_pu_bacteria 2818991457 2819662504 181
50 iso_pu_bacteria 2842391507 2842392540 181
51 iso_pu_bacteria 2842757796 2842759511 181
52 iso_pu_bacteria 2874220319 2874224398 181
53 iso_pu_bacteria 2895498888 2895501417 181
54 iso_pu_bacteria 2895511927 2895514560 181
55 iso_pu_bacteria 2895522137 2895523958 181
56 iso_pu_bacteria 2895525241 2895527447 181
57 iso_pu_bacteria 2919089067 2919091410 181
58 iso_pu_bacteria 2919134579 2919135183 181
59 iso_pu_bacteria 2928496128 2928499543 181
60 iso_pu_bacteria 2931380184 2931382197 181
61 iso_pu_bacteria 2937610967 2937611015 181
62 iso_pu_bacteria 2939622612 2939624774 181
63 iso_pu_bacteria 2939626828 2939628889 181
64 iso_pu_bacteria 2961047084 2961051162 181
65 iso_pu_bacteria 2961064222 2961065474 181
66 iso_pu_bacteria 2987605356 2987608859 181
67 iso_pu_bacteria 8021622325 8021625226 181
68 iso_pu_bacteria 8021626552 8021627502 181
69 iso_pu_bacteria 8021648035 8021649247 181
70 3300005336 Ga0070680_100130753 Ga0070680_1001307532 182
71 3300005344 Ga0070661_100118110 Ga0070661_1001181102 182
72 3300005345 Ga0070692_10069574 Ga0070692_100695742 182
73 3300005455 Ga0070663_100218751 Ga0070663_1002187512 182
74 3300005578 Ga0068854_100105640 Ga0068854_1001056402 182
75 3300013105 Ga0157369_10383940 Ga0157369_103839402 182
76 3300013307 Ga0157372_10545264 Ga0157372_105452641 182
77 3300025909 Ga0207705_10531314 Ga0207705_105313141 182
78 3300025913 Ga0207695_10170558 Ga0207695_101705582 182
79 3300025917 Ga0207660_10017076 Ga0207660_100170764 182
80 3300025919 Ga0207657_10225600 Ga0207657_102256002 182
81 3300025932 Ga0207690_10152508 Ga0207690_101525081 182
82 3300025949 Ga0207667_10400127 Ga0207667_104001271 182
83 3300026041 Ga0207639_10269239 Ga0207639_102692392 182
84 iso_pu_bacteria 2842918807 2842920363 182
85 3300009094 Ga0111539_10631023 Ga0111539_106310232 183
86 3300009094 Ga0111539_10215866 Ga0111539_102158663 184
87 3300041491 Ga0451833_0426302 Ga0451833_0426302_136_690 184
88 3300053093 Ga0500651_0000120 Ga0500651_0000120_44030_44584 184
89 2162886007 SwRhRL2b_contig_1859639 SwRhRL2b_0159.00006960 185
90 2162886007 SwRhRL2b_contig_1921671 SwRhRL2b_0817.00002780 185
91 2162886007 SwRhRL2b_contig_2034220 SwRhRL2b_0947.00006110 185
92 2162886007 SwRhRL2b_contig_268782 SwRhRL2b_0396.00002500 185
93 3300001915 JGI24741J21665_1006669 JGI24741J21665_10066692 185
94 3300001979 JGI24740J21852_10030076 JGI24740J21852_100300762 185
95 3300003320 rootH2_10067962 rootH2_100679622 185
96 3300003760 Ga0055527_1004526 Ga0055527_10045262 185
97 3300003761 Ga0055535_1000809 Ga0055535_10008093 185
98 3300003762 Ga0055542_1000285 Ga0055542_100028531 185
99 3300003763 Ga0055529_1000304 Ga0055529_100030431 185
100 3300003794 Ga0055531_10000741 Ga0055531_100007413 185
101 3300003856 Ga0058692_1000026 Ga0058692_1000026161 185
102 3300005262 Ga0065165_1000093 Ga0065165_1000093116 185
103 3300005289 Ga0065704_10070252 Ga0065704_1007025219 185
104 3300005289 Ga0065704_10237693 Ga0065704_102376932 185
105 3300005293 Ga0065715_10118500 Ga0065715_101185003 185
106 3300005331 Ga0070670_100003611 Ga0070670_1000036118 185
107 3300005336 Ga0070680_100047853 Ga0070680_1000478532 185
108 3300005336 Ga0070680_100671907 Ga0070680_1006719071 185
109 3300005337 Ga0070682_100915641 Ga0070682_1009156411 185
110 3300005339 Ga0070660_100619337 Ga0070660_1006193371 185
111 3300005341 Ga0070691_10004997 Ga0070691_100049976 185
112 3300005341 Ga0070691_10047971 Ga0070691_100479712 185
113 3300005341 Ga0070691_10344665 Ga0070691_103446651 185
114 3300005341 Ga0070691_10345013 Ga0070691_103450132 185
115 3300005344 Ga0070661_100243895 Ga0070661_1002438952 185
116 3300005344 Ga0070661_100593680 Ga0070661_1005936802 185
117 3300005347 Ga0070668_100019998 Ga0070668_1000199983 185
118 3300005353 Ga0070669_101215442 Ga0070669_1012154421 185
119 3300005364 Ga0070673_100102682 Ga0070673_1001026822 185
120 3300005366 Ga0070659_100331677 Ga0070659_1003316772 185
121 3300005455 Ga0070663_100066073 Ga0070663_1000660731 185
122 3300005455 Ga0070663_100075254 Ga0070663_1000752543 185
123 3300005456 Ga0070678_101230018 Ga0070678_1012300181 185
124 3300005457 Ga0070662_100176202 Ga0070662_1001762022 185
125 3300005458 Ga0070681_10001533 Ga0070681_100015333 185
126 3300005458 Ga0070681_10037603 Ga0070681_100376033 185
127 3300005458 Ga0070681_10038032 Ga0070681_100380323 185
128 3300005530 Ga0070679_100001575 Ga0070679_1000015753 185
129 3300005530 Ga0070679_100040789 Ga0070679_1000407895 185
130 3300005530 Ga0070679_100233878 Ga0070679_1002338782 185
131 3300005530 Ga0070679_100459093 Ga0070679_1004590931 185
132 3300005535 Ga0070684_100290711 Ga0070684_1002907111 185
133 3300005547 Ga0070693_100018430 Ga0070693_1000184302 185
134 3300005548 Ga0070665_100247458 Ga0070665_1002474582 185
135 3300005548 Ga0070665_100249583 Ga0070665_1002495833 185
136 3300005564 Ga0070664_100052570 Ga0070664_1000525702 185
137 3300005577 Ga0068857_100242282 Ga0068857_1002422822 185
138 3300005577 Ga0068857_100439528 Ga0068857_1004395282 185
139 3300005578 Ga0068854_100069968 Ga0068854_1000699681 185
140 3300005578 Ga0068854_100180416 Ga0068854_1001804162 185
141 3300005578 Ga0068854_100294159 Ga0068854_1002941592 185
142 3300005618 Ga0068864_100554191 Ga0068864_1005541912 185
143 3300005985 Ga0081539_10007810 Ga0081539_100078106 185
144 3300006051 Ga0075364_10374325 Ga0075364_103743252 185
145 3300006844 Ga0075428_101413269 Ga0075428_1014132691 185
146 3300009011 Ga0105251_10000137 Ga0105251_1000013737 185
147 3300009036 Ga0105244_10036613 Ga0105244_100366132 185
148 3300009093 Ga0105240_10785646 Ga0105240_107856462 185
149 3300009093 Ga0105240_10888806 Ga0105240_108888061 185
150 3300009545 Ga0105237_10663254 Ga0105237_106632542 185
151 3300009545 Ga0105237_10741441 Ga0105237_107414411 185
152 3300009551 Ga0105238_10423370 Ga0105238_104233702 185
153 3300013100 Ga0157373_10003377 Ga0157373_1000337711 185
154 3300013100 Ga0157373_10004558 Ga0157373_100045582 185
155 3300013100 Ga0157373_10028173 Ga0157373_100281732 185
156 3300013100 Ga0157373_10114559 Ga0157373_101145592 185
157 3300013102 Ga0157371_10000450 Ga0157371_1000045015 185
158 3300013102 Ga0157371_10000679 Ga0157371_1000067915 185
159 3300013102 Ga0157371_10045094 Ga0157371_100450943 185
160 3300013104 Ga0157370_10011689 Ga0157370_100116894 185
161 3300013104 Ga0157370_10151660 Ga0157370_101516602 185
162 3300013104 Ga0157370_10196348 Ga0157370_101963482 185
163 3300013104 Ga0157370_10319541 Ga0157370_103195412 185
164 3300013105 Ga0157369_10019802 Ga0157369_100198022 185
165 3300013105 Ga0157369_10239087 Ga0157369_102390873 185
166 3300013297 Ga0157378_10078085 Ga0157378_100780853 185
167 3300013307 Ga0157372_10110968 Ga0157372_101109682 185
168 3300013307 Ga0157372_11005085 Ga0157372_110050852 185
169 3300014326 Ga0157380_10585977 Ga0157380_105859772 185
170 3300014968 Ga0157379_10429396 Ga0157379_104293962 185
171 3300015261 Ga0182006_1010931 Ga0182006_10109312 185
172 3300015262 Ga0182007_10000190 Ga0182007_1000019023 185
173 3300015262 Ga0182007_10001819 Ga0182007_100018197 185
174 3300015265 Ga0182005_1007698 Ga0182005_10076983 185
175 3300017792 Ga0163161_10006770 Ga0163161_100067706 185
176 3300017792 Ga0163161_10016174 Ga0163161_100161743 185
177 3300020610 Ga0154015_1289840 Ga0154015_12898402 185
178 3300025228 Ga0209672_100109 Ga0209672_10010916 185
179 3300025242 Ga0209258_100185 Ga0209258_10018564 185
180 3300025254 Ga0209148_1000042 Ga0209148_1000042340 185
181 3300025272 Ga0209455_1000016 Ga0209455_1000016595 185
182 3300025291 Ga0209675_1012937 Ga0209675_10129372 185
183 3300025292 Ga0209676_1000149 Ga0209676_100014964 185
184 3300025292 Ga0209676_1000775 Ga0209676_100077515 185
185 3300025298 Ga0209050_1023620 Ga0209050_10236202 185
186 3300025299 Ga0209256_1003064 Ga0209256_10030649 185
187 3300025304 Ga0209257_1000067 Ga0209257_100006777 185
188 3300025304 Ga0209257_1000664 Ga0209257_100066432 185
189 3300025304 Ga0209257_1000734 Ga0209257_100073415 185
190 3300025304 Ga0209257_1049179 Ga0209257_10491792 185
191 3300025728 Ga0207655_1031255 Ga0207655_10312552 185
192 3300025735 Ga0207713_1000253 Ga0207713_100025349 185
193 3300025904 Ga0207647_10026132 Ga0207647_100261322 185
194 3300025909 Ga0207705_10015664 Ga0207705_100156642 185
195 3300025909 Ga0207705_10056114 Ga0207705_100561143 185
196 3300025909 Ga0207705_10091355 Ga0207705_100913553 185
197 3300025909 Ga0207705_10225179 Ga0207705_102251792 185
198 3300025912 Ga0207707_10000548 Ga0207707_1000054817 185
199 3300025912 Ga0207707_10006627 Ga0207707_100066277 185
200 3300025912 Ga0207707_10108634 Ga0207707_101086342 185
201 3300025913 Ga0207695_10013042 Ga0207695_100130427 185
202 3300025913 Ga0207695_10576456 Ga0207695_105764562 185
203 3300025913 Ga0207695_10935068 Ga0207695_109350681 185
204 3300025917 Ga0207660_10034567 Ga0207660_100345673 185
205 3300025917 Ga0207660_10046786 Ga0207660_100467863 185
206 3300025917 Ga0207660_10495893 Ga0207660_104958932 185
207 3300025917 Ga0207660_10635121 Ga0207660_106351211 185
208 3300025917 Ga0207660_10774501 Ga0207660_107745012 185
209 3300025919 Ga0207657_10433108 Ga0207657_104331081 185
210 3300025920 Ga0207649_10242985 Ga0207649_102429852 185
211 3300025921 Ga0207652_10000565 Ga0207652_1000056518 185
212 3300025921 Ga0207652_10002262 Ga0207652_1000226211 185
213 3300025921 Ga0207652_10042402 Ga0207652_100424022 185
214 3300025921 Ga0207652_10439024 Ga0207652_104390242 185
215 3300025921 Ga0207652_10849263 Ga0207652_108492632 185
216 3300025925 Ga0207650_10002871 Ga0207650_100028715 185
217 3300025925 Ga0207650_10067301 Ga0207650_100673013 185
218 3300025931 Ga0207644_10361701 Ga0207644_103617012 185
219 3300025932 Ga0207690_10341231 Ga0207690_103412312 185
220 3300025949 Ga0207667_10045157 Ga0207667_100451574 185
221 3300025949 Ga0207667_10077501 Ga0207667_100775014 185
222 3300025949 Ga0207667_10102662 Ga0207667_101026624 185
223 3300025972 Ga0207668_10019457 Ga0207668_100194574 185
224 3300025981 Ga0207640_10050550 Ga0207640_100505502 185
225 3300025986 Ga0207658_10681701 Ga0207658_106817011 185
226 3300026067 Ga0207678_10007269 Ga0207678_100072697 185
227 3300026067 Ga0207678_10116078 Ga0207678_101160782 185
228 3300026078 Ga0207702_10449310 Ga0207702_104493101 185
229 3300026095 Ga0207676_10131975 Ga0207676_101319753 185
230 3300026116 Ga0207674_10145451 Ga0207674_101454512 185
231 3300026121 Ga0207683_10633991 Ga0207683_106339912 185
232 3300027312 Ga0209371_1000028 Ga0209371_1000028183 185
233 3300027471 Ga0209995_1010204 Ga0209995_10102042 185
234 3300028379 Ga0268266_10271496 Ga0268266_102714962 185
235 3300028379 Ga0268266_10901139 Ga0268266_109011392 185
236 3300028794 Ga0307515_10284016 Ga0307515_102840162 185
237 3300030500 Ga0268256_1000030 Ga0268256_1000030211 185
238 3300030744 Ga0316181_1085609 Ga0316181_10856093 185
239 3300031456 Ga0307513_10082278 Ga0307513_100822783 185
240 3300031548 Ga0307408_100062318 Ga0307408_1000623183 185
241 3300031730 Ga0307516_10066109 Ga0307516_100661092 185
242 3300031852 Ga0307410_10251731 Ga0307410_102517312 185
243 3300031852 Ga0307410_10395715 Ga0307410_103957152 185
244 3300031901 Ga0307406_10554364 Ga0307406_105543641 185
245 3300031911 Ga0307412_10000422 Ga0307412_1000042221 185
246 3300031911 Ga0307412_10002851 Ga0307412_100028513 185
247 3300032002 Ga0307416_100019631 Ga0307416_1000196312 185
248 3300032004 Ga0307414_10049987 Ga0307414_100499873 185
249 3300032004 Ga0307414_10123148 Ga0307414_101231482 185
250 3300032005 Ga0307411_10151745 Ga0307411_101517452 185
251 3300032005 Ga0307411_10578049 Ga0307411_105780491 185
252 3300037312 Ga0395899_0028130 Ga0395899_0028130_294_851 185
253 3300037312 Ga0395899_0035682 Ga0395899_0035682_27_584 185
254 3300037312 Ga0395899_0052601 Ga0395899_0052601_2023_2598 185
255 3300037418 Ga0395900_0010565 Ga0395900_0010565_4764_5321 185
256 3300037418 Ga0395900_0030936 Ga0395900_0030936_1167_1742 185
257 3300037418 Ga0395900_0137822 Ga0395900_0137822_1368_1946 185
258 3300037418 Ga0395900_0653251 Ga0395900_0653251_309_866 185
259 3300037466 Ga0395898_0030025 Ga0395898_0030025_4126_4683 185
260 3300037466 Ga0395898_0376727 Ga0395898_0376727_762_1337 185
261 3300037471 Ga0395905_0001195 Ga0395905_0001195_16391_16948 185
262 3300037471 Ga0395905_0099463 Ga0395905_0099463_860_1417 185
263 3300037471 Ga0395905_0113121 Ga0395905_0113121_1815_2372 185
264 3300038443 Ga0395901_0023786 Ga0395901_0023786_3291_3848 185
265 3300038443 Ga0395901_0296001 Ga0395901_0296001_857_1432 185
266 3300038443 Ga0395901_0656583 Ga0395901_0656583_170_727 185
267 3300038443 Ga0395901_1311231 Ga0395901_1311231_54_611 185
268 3300041404 Ga0439436_0000066 Ga0439436_0000066_10993_11553 185
269 3300041486 Ga0451807_1491765 Ga0451807_1491765_309_866 185
270 3300041509 Ga0451843_0080570 Ga0451843_0080570_329_886 185
271 3300041512 Ga0451853_0209765 Ga0451853_0209765_47_616 185
272 3300042533 Ga0450901_007188 Ga0450901_007188_15_572 185
273 3300044684 Ga0466966_0008551 Ga0466966_0008551_1536_2093 185
274 3300044719 Ga0466971_0207052 Ga0466971_0207052_90_647 185
275 3300045049 Ga0466959_0577283 Ga0466959_0577283_49_606 185
276 3300046460 Ga0495638_0001623 Ga0495638_0001623_2290_2847 185
277 3300046507 Ga0495606_0119493 Ga0495606_0119493_20_580 185
278 3300046512 Ga0495610_0001987 Ga0495610_0001987_10984_11544 185
279 3300046512 Ga0495610_0231041 Ga0495610_0231041_37_594 185
280 3300046523 Ga0495644_0121598 Ga0495644_0121598_259_816 185
281 3300046525 Ga0495663_0005381 Ga0495663_0005381_1279_1836 185
282 3300046537 Ga0495598_0008269 Ga0495598_0008269_873_1430 185
283 3300046558 Ga0495633_0028625 Ga0495633_0028625_1257_1814 185
284 3300046616 Ga0495668_0001955 Ga0495668_0001955_6796_7356 185
285 3300046616 Ga0495668_0056429 Ga0495668_0056429_93_653 185
286 3300046660 Ga0495625_0014458 Ga0495625_0014458_3664_4221 185
287 3300046810 Ga0495660_0000348 Ga0495660_0000348_30588_31148 185
288 3300047318 Ga0495636_0052584 Ga0495636_0052584_953_1510 185
289 3300047445 Ga0495677_0037116 Ga0495677_0037116_219_779 185
290 3300047469 Ga0495673_0000036 Ga0495673_0000036_273968_274528 185
291 3300047472 Ga0495686_0000033 Ga0495686_0000033_119998_120558 185
292 3300048903 Ga0496100_0231345 Ga0496100_0231345_489_1046 185
293 3300048907 Ga0496104_0325546 Ga0496104_0325546_141_698 185
294 3300048907 Ga0496104_0334400 Ga0496104_0334400_542_1099 185
295 3300048908 Ga0496105_0079477 Ga0496105_0079477_969_1526 185
296 3300048911 Ga0496108_0375936 Ga0496108_0375936_497_1054 185
297 3300048912 Ga0496109_0015915 Ga0496109_0015915_4705_5262 185
298 3300048912 Ga0496109_0464971 Ga0496109_0464971_187_744 185
299 3300048915 Ga0496112_0182950 Ga0496112_0182950_780_1337 185
300 3300048916 Ga0496113_0030158 Ga0496113_0030158_509_1066 185
301 3300048919 Ga0496116_0054466 Ga0496116_0054466_1937_2494 185
302 3300048920 Ga0496117_0002697 Ga0496117_0002697_4593_5150 185
303 3300048920 Ga0496117_0003170 Ga0496117_0003170_9281_9838 185
304 3300048920 Ga0496117_0027591 Ga0496117_0027591_1508_2065 185
305 3300048920 Ga0496117_0041272 Ga0496117_0041272_2112_2669 185
306 3300048921 Ga0496118_0000646 Ga0496118_0000646_7660_8217 185
307 3300048921 Ga0496118_0003380 Ga0496118_0003380_17290_17847 185
308 3300048921 Ga0496118_0099320 Ga0496118_0099320_497_1054 185
309 3300048921 Ga0496118_0144429 Ga0496118_0144429_296_853 185
310 3300048922 Ga0496119_0000113 Ga0496119_0000113_69837_70394 185
311 3300048922 Ga0496119_0000583 Ga0496119_0000583_44293_44850 185
312 3300048922 Ga0496119_0014798 Ga0496119_0014798_2908_3465 185
313 3300048922 Ga0496119_0044094 Ga0496119_0044094_1233_1790 185
314 3300048922 Ga0496119_0079833 Ga0496119_0079833_776_1333 185
315 3300048922 Ga0496119_0241983 Ga0496119_0241983_55_612 185
316 3300048923 Ga0496120_0000187 Ga0496120_0000187_24787_25344 185
317 3300048923 Ga0496120_0000262 Ga0496120_0000262_61977_62534 185
318 3300048923 Ga0496120_0000450 Ga0496120_0000450_15674_16231 185
319 3300048923 Ga0496120_0039025 Ga0496120_0039025_1230_1787 185
320 3300048924 Ga0496121_0070895 Ga0496121_0070895_725_1282 185
321 3300048924 Ga0496121_0107578 Ga0496121_0107578_839_1396 185
322 3300048924 Ga0496121_0356469 Ga0496121_0356469_78_635 185
323 3300048925 Ga0496122_0000537 Ga0496122_0000537_20309_20866 185
324 3300048925 Ga0496122_0002036 Ga0496122_0002036_2953_3510 185
325 3300048925 Ga0496122_0037580 Ga0496122_0037580_3132_3689 185
326 3300048925 Ga0496122_0041311 Ga0496122_0041311_1583_2140 185
327 3300048925 Ga0496122_0194159 Ga0496122_0194159_165_722 185
328 3300048926 Ga0496123_0000987 Ga0496123_0000987_20160_20717 185
329 3300048926 Ga0496123_0001380 Ga0496123_0001380_2967_3524 185
330 3300048926 Ga0496123_0021304 Ga0496123_0021304_1763_2320 185
331 3300048926 Ga0496123_0191995 Ga0496123_0191995_317_874 185
332 3300048927 Ga0496124_0001915 Ga0496124_0001915_2547_3104 185
333 3300048927 Ga0496124_0003734 Ga0496124_0003734_2333_2890 185
334 3300048927 Ga0496124_0058029 Ga0496124_0058029_87_644 185
335 3300048927 Ga0496124_0059823 Ga0496124_0059823_1413_1970 185
336 3300048927 Ga0496124_0071265 Ga0496124_0071265_788_1345 185
337 3300048927 Ga0496124_0132961 Ga0496124_0132961_95_652 185
338 3300048927 Ga0496124_0156229 Ga0496124_0156229_941_1498 185
339 3300048928 Ga0496125_0011875 Ga0496125_0011875_6815_7372 185
340 3300048928 Ga0496125_0019366 Ga0496125_0019366_1181_1738 185
341 3300048928 Ga0496125_0027008 Ga0496125_0027008_1270_1827 185
342 3300048928 Ga0496125_0097216 Ga0496125_0097216_1306_1863 185
343 3300048928 Ga0496125_0100999 Ga0496125_0100999_1256_1813 185
344 3300048928 Ga0496125_0128129 Ga0496125_0128129_764_1321 185
345 3300048929 Ga0496126_0032108 Ga0496126_0032108_277_834 185
346 3300048929 Ga0496126_0108026 Ga0496126_0108026_636_1193 185
347 3300048929 Ga0496126_0280172 Ga0496126_0280172_612_1169 185
348 3300048929 Ga0496126_0423308 Ga0496126_0423308_502_1059 185
349 3300049568 Ga0501031_0107632 Ga0501031_0107632_515_1072 185
350 3300049569 Ga0501032_0155673 Ga0501032_0155673_168_725 185
351 3300049569 Ga0501032_0570401 Ga0501032_0570401_134_709 185
352 3300049570 Ga0501033_0029226 Ga0501033_0029226_161_718 185
353 3300049571 Ga0501034_0401326 Ga0501034_0401326_343_918 185
354 3300049572 Ga0501036_0086517 Ga0501036_0086517_1974_2531 185
355 3300049574 Ga0501038_0583799 Ga0501038_0583799_142_717 185
356 3300049575 Ga0501039_0129487 Ga0501039_0129487_669_1226 185
357 3300049578 Ga0501042_0362034 Ga0501042_0362034_102_662 185
358 3300049579 Ga0501043_0453966 Ga0501043_0453966_387_944 185
359 3300049580 Ga0501046_0191258 Ga0501046_0191258_403_960 185
360 3300049581 Ga0501047_0016575 Ga0501047_0016575_3881_4438 185
361 3300049581 Ga0501047_0409533 Ga0501047_0409533_418_996 185
362 3300049581 Ga0501047_0696003 Ga0501047_0696003_226_804 185
363 3300049582 Ga0501048_0261139 Ga0501048_0261139_622_1179 185
364 3300049583 Ga0501067_0007762 Ga0501067_0007762_5161_5727 185
365 3300049585 Ga0501069_0386167 Ga0501069_0386167_125_703 185
366 3300049586 Ga0501070_0000265 Ga0501070_0000265_48530_49108 185
367 3300049587 Ga0501071_0266833 Ga0501071_0266833_204_779 185
368 3300049589 Ga0501073_0005054 Ga0501073_0005054_339_914 185
369 3300049589 Ga0501073_0124892 Ga0501073_0124892_969_1526 185
370 3300049590 Ga0501074_0660216 Ga0501074_0660216_50_625 185
371 3300049593 Ga0501077_0228395 Ga0501077_0228395_133_711 185
372 3300049742 Ga0501080_0133810 Ga0501080_0133810_1204_1761 185
373 3300049744 Ga0501083_0075217 Ga0501083_0075217_1116_1673 185
374 3300049822 Ga0501035_0286705 Ga0501035_0286705_72_650 185
375 3300049822 Ga0501035_0491104 Ga0501035_0491104_424_999 185
376 3300049824 Ga0501045_0175858 Ga0501045_0175858_414_971 185
377 3300060353 Ga0501082_0248092 Ga0501082_0248092_639_1196 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

11

169

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9767 2 185
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.971 2 173
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9705 2 171
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9699 2 174
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9673 2 174
ID Description Score Start End Superfamily
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9624 2 174 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9609 8 175 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.957 1 183 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9527 2 176 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9479 2 171 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V5V3A3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.998 60 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A380THG7-F1-model_v4 dTDP-4-deoxyrhamnose-3,5-epimerase (EC 5.1.3.13) 0.9952 61 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A382ZPS9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9951 52 175 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4U9HCF6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9947 43 176 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3D4TKL0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9946 17 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
97.22 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map