F427669
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 377 | 230 | 348 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10027230|Ga0111539_100272302 |
| Length | 174 |
| Sequence | LRHLVAIQIQDLPLNGLRLIEPPVHTDPRGYFFELHHQARFEQLGLDVTLVQDNVSRSRRDVLRGLHFQAPAWQGKLVSVLQGEIFDVAVDLRRDSPTFGQWHGVCLSEENHRQLWVPPGFAVLYKCSAFYDPAHEHTLLWNDPDLGISWPVARPLVSEKDARGKRLRELPLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 3 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 4 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 5 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 6 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 7 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 8 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 9 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 10 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 11 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 12 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 13 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 14 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 15 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 16 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 17 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 18 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 19 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 20 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 21 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 22 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 23 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 24 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 25 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 26 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 27 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 28 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 29 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 30 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 31 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 43 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 44 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 150 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 152 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 159 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 161 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 162 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 163 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 187 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 188 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 189 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 190 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 191 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 192 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 193 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 194 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 195 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 196 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 197 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 198 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 199 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 223 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 227 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 229 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 230 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.04 |
| Metatranscriptomes | 0.27 |
| Isolates | 7.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.08 |
| Nodule | 0.27 |
| Rhizoplane | 2.65 |
| Rhizosphere | 66.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1859639 | 2162886007 | Bacteria | 933 |
| 2 | SwRhRL2b_contig_1921671 | 2162886007 | Bacteria | 6761 |
| 3 | SwRhRL2b_contig_2034220 | 2162886007 | Bacteria | 2070 |
| 4 | SwRhRL2b_contig_268782 | 2162886007 | Bacteria | 6287 |
| 5 | JGI24741J21665_1006669 | 3300001915 | Bacteria | 2299 |
| 6 | JGI24740J21852_10030076 | 3300001979 | Bacteria | 1774 |
| 7 | rootH2_10067962 | 3300003320 | Bacteria | 2255 |
| 8 | Ga0055527_1004526 | 3300003760 | Bacteria | 1900 |
| 9 | Ga0055535_1000809 | 3300003761 | Bacteria | 22652 |
| 10 | Ga0055542_1000285 | 3300003762 | Bacteria | 56650 |
| 11 | Ga0055529_1000304 | 3300003763 | Bacteria | 56650 |
| 12 | Ga0055526_1000218 | 3300003771 | Bacteria | 49706 |
| 13 | Ga0055537_1000196 | 3300003773 | Bacteria | 45345 |
| 14 | Ga0055536_1000357 | 3300003781 | Bacteria | 33928 |
| 15 | Ga0055534_1000061 | 3300003784 | Bacteria | 82050 |
| 16 | Ga0055528_1000332 | 3300003790 | Bacteria | 39798 |
| 17 | Ga0055530_10002004 | 3300003791 | Bacteria | 13800 |
| 18 | Ga0055531_10000512 | 3300003794 | Bacteria | 34953 |
| 19 | Ga0055531_10000741 | 3300003794 | Bacteria | 27490 |
| 20 | Ga0058692_1000026 | 3300003856 | Bacteria | 203096 |
| 21 | Ga0065165_1000093 | 3300005262 | Bacteria | 146751 |
| 22 | Ga0065714_10077704 | 3300005288 | Bacteria | 2666 |
| 23 | Ga0065704_10070252 | 3300005289 | Bacteria | 48050 |
| 24 | Ga0065704_10237693 | 3300005289 | Bacteria | 1024 |
| 25 | Ga0065715_10005422 | 3300005293 | Bacteria | 4194 |
| 26 | Ga0065715_10118500 | 3300005293 | Bacteria | 2314 |
| 27 | Ga0070670_100003611 | 3300005331 | Bacteria | 12874 |
| 28 | Ga0070680_100047853 | 3300005336 | Bacteria | 3483 |
| 29 | Ga0070680_100130753 | 3300005336 | Bacteria | 2100 |
| 30 | Ga0070680_100671907 | 3300005336 | Bacteria | 891 |
| 31 | Ga0070682_100915641 | 3300005337 | Bacteria | 722 |
| 32 | Ga0068868_100650897 | 3300005338 | Bacteria | 938 |
| 33 | Ga0070660_100619337 | 3300005339 | Bacteria | 906 |
| 34 | Ga0070691_10004997 | 3300005341 | Bacteria | 6033 |
| 35 | Ga0070691_10047971 | 3300005341 | Bacteria | 2031 |
| 36 | Ga0070691_10344665 | 3300005341 | Bacteria | 826 |
| 37 | Ga0070691_10345013 | 3300005341 | Bacteria | 825 |
| 38 | Ga0070661_100118110 | 3300005344 | Bacteria | 1984 |
| 39 | Ga0070661_100243895 | 3300005344 | Bacteria | 1384 |
| 40 | Ga0070661_100593680 | 3300005344 | Bacteria | 895 |
| 41 | Ga0070692_10069574 | 3300005345 | Bacteria | 1872 |
| 42 | Ga0070668_100019998 | 3300005347 | Bacteria | 5048 |
| 43 | Ga0070669_101215442 | 3300005353 | Bacteria | 651 |
| 44 | Ga0070673_100102682 | 3300005364 | Bacteria | 2358 |
| 45 | Ga0070659_100331677 | 3300005366 | Bacteria | 1273 |
| 46 | Ga0070663_100066073 | 3300005455 | Bacteria | 2620 |
| 47 | Ga0070663_100075254 | 3300005455 | Bacteria | 2467 |
| 48 | Ga0070663_100218751 | 3300005455 | Bacteria | 1494 |
| 49 | Ga0070678_101230018 | 3300005456 | Bacteria | 695 |
| 50 | Ga0070662_100176202 | 3300005457 | Bacteria | 1683 |
| 51 | Ga0070681_10001533 | 3300005458 | Bacteria | 20461 |
| 52 | Ga0070681_10037603 | 3300005458 | Bacteria | 4856 |
| 53 | Ga0070681_10038032 | 3300005458 | Bacteria | 4825 |
| 54 | Ga0070679_100001575 | 3300005530 | Bacteria | 20436 |
| 55 | Ga0070679_100040789 | 3300005530 | Bacteria | 4618 |
| 56 | Ga0070679_100233878 | 3300005530 | Bacteria | 1797 |
| 57 | Ga0070679_100459093 | 3300005530 | Bacteria | 1218 |
| 58 | Ga0070684_100290711 | 3300005535 | Bacteria | 1498 |
| 59 | Ga0070693_100018430 | 3300005547 | Bacteria | 3646 |
| 60 | Ga0070665_100247458 | 3300005548 | Bacteria | 1783 |
| 61 | Ga0070665_100249583 | 3300005548 | Bacteria | 1775 |
| 62 | Ga0070664_100052570 | 3300005564 | Bacteria | 3451 |
| 63 | Ga0068857_100242282 | 3300005577 | Bacteria | 1651 |
| 64 | Ga0068857_100439528 | 3300005577 | Bacteria | 1218 |
| 65 | Ga0068854_100069968 | 3300005578 | Bacteria | 2564 |
| 66 | Ga0068854_100105640 | 3300005578 | Bacteria | 2117 |
| 67 | Ga0068854_100180416 | 3300005578 | Bacteria | 1649 |
| 68 | Ga0068854_100294159 | 3300005578 | Bacteria | 1311 |
| 69 | Ga0068859_100248701 | 3300005617 | Bacteria | 1868 |
| 70 | Ga0068864_100554191 | 3300005618 | Bacteria | 1111 |
| 71 | Ga0068858_100209786 | 3300005842 | Bacteria | 1843 |
| 72 | Ga0081539_10007810 | 3300005985 | Bacteria | 9567 |
| 73 | Ga0075364_10374325 | 3300006051 | Bacteria | 971 |
| 74 | Ga0075362_10164430 | 3300006177 | Bacteria | 1070 |
| 75 | Ga0097621_100120579 | 3300006237 | Bacteria | 2224 |
| 76 | Ga0075428_101413269 | 3300006844 | Bacteria | 730 |
| 77 | Ga0097620_100248706 | 3300006931 | Bacteria | 1868 |
| 78 | Ga0105251_10000137 | 3300009011 | Bacteria | 74569 |
| 79 | Ga0105244_10036613 | 3300009036 | Bacteria | 2569 |
| 80 | Ga0105240_10785646 | 3300009093 | Bacteria | 1032 |
| 81 | Ga0105240_10888806 | 3300009093 | Bacteria | 959 |
| 82 | Ga0111539_10027230 | 3300009094 | Bacteria | 6981 |
| 83 | Ga0111539_10215866 | 3300009094 | Bacteria | 2235 |
| 84 | Ga0111539_10631023 | 3300009094 | Bacteria | 1248 |
| 85 | Ga0105237_10663254 | 3300009545 | Bacteria | 1050 |
| 86 | Ga0105237_10741441 | 3300009545 | Bacteria | 989 |
| 87 | Ga0105238_10423370 | 3300009551 | Bacteria | 1326 |
| 88 | Ga0105249_11243949 | 3300009553 | Bacteria | 816 |
| 89 | Ga0157373_10003377 | 3300013100 | Bacteria | 12076 |
| 90 | Ga0157373_10004558 | 3300013100 | Bacteria | 10420 |
| 91 | Ga0157373_10028173 | 3300013100 | Bacteria | 4053 |
| 92 | Ga0157373_10114559 | 3300013100 | Bacteria | 1895 |
| 93 | Ga0157371_10000450 | 3300013102 | Bacteria | 50419 |
| 94 | Ga0157371_10000679 | 3300013102 | Bacteria | 40240 |
| 95 | Ga0157371_10045094 | 3300013102 | Bacteria | 3138 |
| 96 | Ga0157370_10011689 | 3300013104 | Bacteria | 9162 |
| 97 | Ga0157370_10151660 | 3300013104 | Bacteria | 2157 |
| 98 | Ga0157370_10196348 | 3300013104 | Bacteria | 1873 |
| 99 | Ga0157370_10319541 | 3300013104 | Bacteria | 1432 |
| 100 | Ga0157369_10019802 | 3300013105 | Bacteria | 7531 |
| 101 | Ga0157369_10239087 | 3300013105 | Bacteria | 1897 |
| 102 | Ga0157369_10383940 | 3300013105 | Bacteria | 1458 |
| 103 | Ga0157378_10078085 | 3300013297 | Bacteria | 2986 |
| 104 | Ga0157372_10110968 | 3300013307 | Bacteria | 3141 |
| 105 | Ga0157372_10545264 | 3300013307 | Bacteria | 1352 |
| 106 | Ga0157372_11005085 | 3300013307 | Bacteria | 966 |
| 107 | Ga0157380_10585977 | 3300014326 | Bacteria | 1101 |
| 108 | Ga0157379_10364972 | 3300014968 | Bacteria | 1324 |
| 109 | Ga0157379_10429396 | 3300014968 | Bacteria | 1217 |
| 110 | Ga0157376_10864323 | 3300014969 | Bacteria | 920 |
| 111 | Ga0182006_1010931 | 3300015261 | Bacteria | 4014 |
| 112 | Ga0182007_10000190 | 3300015262 | Bacteria | 41334 |
| 113 | Ga0182007_10001819 | 3300015262 | Bacteria | 11136 |
| 114 | Ga0182005_1007698 | 3300015265 | Bacteria | 3217 |
| 115 | Ga0163161_10006770 | 3300017792 | Bacteria | 7917 |
| 116 | Ga0163161_10016174 | 3300017792 | Bacteria | 5207 |
| 117 | Ga0163161_10022036 | 3300017792 | Bacteria | 4482 |
| 118 | Ga0154015_1289840 | 3300020610 | Bacteria | 1056 |
| 119 | Ga0209672_100109 | 3300025228 | Bacteria | 96247 |
| 120 | Ga0209258_100185 | 3300025242 | Bacteria | 132820 |
| 121 | Ga0209148_1000042 | 3300025254 | Bacteria | 464111 |
| 122 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 123 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 124 | Ga0209673_1000032 | 3300025273 | Bacteria | 339956 |
| 125 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 126 | Ga0209675_1012937 | 3300025291 | Bacteria | 2649 |
| 127 | Ga0209676_1000149 | 3300025292 | Bacteria | 167854 |
| 128 | Ga0209676_1000199 | 3300025292 | Bacteria | 134270 |
| 129 | Ga0209676_1000775 | 3300025292 | Bacteria | 42707 |
| 130 | Ga0209564_1000210 | 3300025295 | Bacteria | 133323 |
| 131 | Ga0209050_1000199 | 3300025298 | Bacteria | 134682 |
| 132 | Ga0209050_1023620 | 3300025298 | Bacteria | 2156 |
| 133 | Ga0209256_1003064 | 3300025299 | Bacteria | 12303 |
| 134 | Ga0209051_1052122 | 3300025303 | Bacteria | 1355 |
| 135 | Ga0209257_1000067 | 3300025304 | Bacteria | 342468 |
| 136 | Ga0209257_1000086 | 3300025304 | Bacteria | 287437 |
| 137 | Ga0209257_1000664 | 3300025304 | Bacteria | 54069 |
| 138 | Ga0209257_1000734 | 3300025304 | Bacteria | 49703 |
| 139 | Ga0209257_1049179 | 3300025304 | Bacteria | 1202 |
| 140 | Ga0207655_1031255 | 3300025728 | Bacteria | 2457 |
| 141 | Ga0207713_1000253 | 3300025735 | Bacteria | 66728 |
| 142 | Ga0207647_10026132 | 3300025904 | Bacteria | 3823 |
| 143 | Ga0207705_10015664 | 3300025909 | Bacteria | 5444 |
| 144 | Ga0207705_10056114 | 3300025909 | Bacteria | 2840 |
| 145 | Ga0207705_10091355 | 3300025909 | Bacteria | 2230 |
| 146 | Ga0207705_10225179 | 3300025909 | Bacteria | 1425 |
| 147 | Ga0207705_10531314 | 3300025909 | Bacteria | 914 |
| 148 | Ga0207707_10000548 | 3300025912 | Bacteria | 38306 |
| 149 | Ga0207707_10006627 | 3300025912 | Bacteria | 10103 |
| 150 | Ga0207707_10108634 | 3300025912 | Bacteria | 2425 |
| 151 | Ga0207695_10013042 | 3300025913 | Bacteria | 9926 |
| 152 | Ga0207695_10170558 | 3300025913 | Bacteria | 2102 |
| 153 | Ga0207695_10576456 | 3300025913 | Bacteria | 1007 |
| 154 | Ga0207695_10935068 | 3300025913 | Bacteria | 747 |
| 155 | Ga0207660_10017076 | 3300025917 | Bacteria | 4815 |
| 156 | Ga0207660_10034567 | 3300025917 | Bacteria | 3504 |
| 157 | Ga0207660_10046786 | 3300025917 | Bacteria | 3055 |
| 158 | Ga0207660_10495893 | 3300025917 | Bacteria | 991 |
| 159 | Ga0207660_10635121 | 3300025917 | Bacteria | 870 |
| 160 | Ga0207660_10774501 | 3300025917 | Bacteria | 783 |
| 161 | Ga0207657_10225600 | 3300025919 | Bacteria | 1500 |
| 162 | Ga0207657_10433108 | 3300025919 | Bacteria | 1033 |
| 163 | Ga0207649_10242985 | 3300025920 | Bacteria | 1293 |
| 164 | Ga0207652_10000565 | 3300025921 | Bacteria | 37414 |
| 165 | Ga0207652_10002262 | 3300025921 | Bacteria | 16333 |
| 166 | Ga0207652_10042402 | 3300025921 | Bacteria | 3873 |
| 167 | Ga0207652_10439024 | 3300025921 | Bacteria | 1177 |
| 168 | Ga0207652_10849263 | 3300025921 | Bacteria | 808 |
| 169 | Ga0207650_10002871 | 3300025925 | Bacteria | 11898 |
| 170 | Ga0207650_10067301 | 3300025925 | Bacteria | 2688 |
| 171 | Ga0207644_10361701 | 3300025931 | Bacteria | 1180 |
| 172 | Ga0207690_10152508 | 3300025932 | Bacteria | 1714 |
| 173 | Ga0207690_10341231 | 3300025932 | Bacteria | 1182 |
| 174 | Ga0207667_10045157 | 3300025949 | Bacteria | 4667 |
| 175 | Ga0207667_10077501 | 3300025949 | Bacteria | 3447 |
| 176 | Ga0207667_10102662 | 3300025949 | Bacteria | 2949 |
| 177 | Ga0207667_10400127 | 3300025949 | Bacteria | 1398 |
| 178 | Ga0207668_10019457 | 3300025972 | Bacteria | 4293 |
| 179 | Ga0207640_10050550 | 3300025981 | Bacteria | 2698 |
| 180 | Ga0207658_10681701 | 3300025986 | Bacteria | 928 |
| 181 | Ga0207639_10269239 | 3300026041 | Bacteria | 1493 |
| 182 | Ga0207678_10007269 | 3300026067 | Bacteria | 9817 |
| 183 | Ga0207678_10116078 | 3300026067 | Bacteria | 2284 |
| 184 | Ga0207702_10449310 | 3300026078 | Bacteria | 1250 |
| 185 | Ga0207676_10131975 | 3300026095 | Bacteria | 2125 |
| 186 | Ga0207674_10145451 | 3300026116 | Bacteria | 2329 |
| 187 | Ga0207683_10633991 | 3300026121 | Bacteria | 990 |
| 188 | Ga0209371_1000028 | 3300027312 | Bacteria | 429688 |
| 189 | Ga0209995_1010204 | 3300027471 | Bacteria | 1521 |
| 190 | Ga0207428_10363444 | 3300027907 | Bacteria | 1064 |
| 191 | Ga0268266_10271496 | 3300028379 | Bacteria | 1574 |
| 192 | Ga0268266_10901139 | 3300028379 | Bacteria | 855 |
| 193 | Ga0268264_10158414 | 3300028381 | Bacteria | 2037 |
| 194 | Ga0307515_10284016 | 3300028794 | Bacteria | 1359 |
| 195 | Ga0268256_1000030 | 3300030500 | Bacteria | 429688 |
| 196 | Ga0316181_1085609 | 3300030744 | Bacteria | 1991 |
| 197 | Ga0307513_10082278 | 3300031456 | Bacteria | 3315 |
| 198 | Ga0307408_100062318 | 3300031548 | Bacteria | 2725 |
| 199 | Ga0307516_10066109 | 3300031730 | Bacteria | 3489 |
| 200 | Ga0307410_10251731 | 3300031852 | Bacteria | 1374 |
| 201 | Ga0307410_10395715 | 3300031852 | Bacteria | 1115 |
| 202 | Ga0307406_10554364 | 3300031901 | Bacteria | 941 |
| 203 | Ga0307412_10000422 | 3300031911 | Bacteria | 25696 |
| 204 | Ga0307412_10002851 | 3300031911 | Bacteria | 9591 |
| 205 | Ga0307416_100019631 | 3300032002 | Bacteria | 4799 |
| 206 | Ga0307414_10049987 | 3300032004 | Bacteria | 2894 |
| 207 | Ga0307414_10123148 | 3300032004 | Bacteria | 1997 |
| 208 | Ga0307411_10151745 | 3300032005 | Bacteria | 1723 |
| 209 | Ga0307411_10578049 | 3300032005 | Bacteria | 963 |
| 210 | Ga0395899_0028130 | 3300037312 | Bacteria | 4234 |
| 211 | Ga0395899_0035682 | 3300037312 | Bacteria | 3732 |
| 212 | Ga0395899_0052601 | 3300037312 | Bacteria | 3018 |
| 213 | Ga0395900_0010565 | 3300037418 | Bacteria | 9442 |
| 214 | Ga0395900_0030936 | 3300037418 | Bacteria | 5497 |
| 215 | Ga0395900_0137822 | 3300037418 | Bacteria | 2500 |
| 216 | Ga0395900_0653251 | 3300037418 | Bacteria | 988 |
| 217 | Ga0395898_0030025 | 3300037466 | Bacteria | 5442 |
| 218 | Ga0395898_0376727 | 3300037466 | Bacteria | 1353 |
| 219 | Ga0395905_0001195 | 3300037471 | Bacteria | 32485 |
| 220 | Ga0395905_0099463 | 3300037471 | Bacteria | 2731 |
| 221 | Ga0395905_0113121 | 3300037471 | Bacteria | 2550 |
| 222 | Ga0395901_0023786 | 3300038443 | Bacteria | 6282 |
| 223 | Ga0395901_0296001 | 3300038443 | Bacteria | 1678 |
| 224 | Ga0395901_0656583 | 3300038443 | Bacteria | 1051 |
| 225 | Ga0395901_1311231 | 3300038443 | Bacteria | 685 |
| 226 | Ga0439436_0000066 | 3300041404 | Bacteria | 29532 |
| 227 | Ga0451807_1491765 | 3300041486 | Bacteria | 992 |
| 228 | Ga0451833_0426302 | 3300041491 | Bacteria | 1299 |
| 229 | Ga0451843_0080570 | 3300041509 | Bacteria | 1455 |
| 230 | Ga0451853_0209765 | 3300041512 | Bacteria | 766 |
| 231 | Ga0450901_007188 | 3300042533 | Bacteria | 1146 |
| 232 | Ga0466966_0008551 | 3300044684 | Bacteria | 6776 |
| 233 | Ga0466971_0207052 | 3300044719 | Bacteria | 927 |
| 234 | Ga0466959_0577283 | 3300045049 | Bacteria | 757 |
| 235 | Ga0495638_0001623 | 3300046460 | Bacteria | 20015 |
| 236 | Ga0495606_0119493 | 3300046507 | Bacteria | 1579 |
| 237 | Ga0495610_0001987 | 3300046512 | Bacteria | 17452 |
| 238 | Ga0495610_0231041 | 3300046512 | Bacteria | 742 |
| 239 | Ga0495644_0121598 | 3300046523 | Bacteria | 993 |
| 240 | Ga0495663_0005381 | 3300046525 | Bacteria | 3553 |
| 241 | Ga0495598_0008269 | 3300046537 | Bacteria | 2417 |
| 242 | Ga0495633_0028625 | 3300046558 | Bacteria | 2713 |
| 243 | Ga0495668_0001955 | 3300046616 | Bacteria | 18282 |
| 244 | Ga0495668_0056429 | 3300046616 | Bacteria | 2168 |
| 245 | Ga0495625_0014458 | 3300046660 | Bacteria | 6297 |
| 246 | Ga0495660_0000348 | 3300046810 | Bacteria | 40994 |
| 247 | Ga0495636_0052584 | 3300047318 | Bacteria | 1709 |
| 248 | Ga0495677_0037116 | 3300047445 | Bacteria | 1780 |
| 249 | Ga0495673_0000036 | 3300047469 | Bacteria | 311035 |
| 250 | Ga0495686_0000033 | 3300047472 | Bacteria | 342031 |
| 251 | Ga0496100_0231345 | 3300048903 | Bacteria | 1360 |
| 252 | Ga0496104_0325546 | 3300048907 | Bacteria | 1450 |
| 253 | Ga0496104_0334400 | 3300048907 | Bacteria | 1427 |
| 254 | Ga0496105_0079477 | 3300048908 | Bacteria | 2708 |
| 255 | Ga0496108_0375936 | 3300048911 | Bacteria | 1240 |
| 256 | Ga0496109_0015915 | 3300048912 | Bacteria | 6569 |
| 257 | Ga0496109_0464971 | 3300048912 | Bacteria | 1194 |
| 258 | Ga0496112_0182950 | 3300048915 | Bacteria | 2059 |
| 259 | Ga0496113_0030158 | 3300048916 | Bacteria | 3923 |
| 260 | Ga0496116_0004829 | 3300048919 | Bacteria | 12718 |
| 261 | Ga0496116_0054466 | 3300048919 | Bacteria | 2635 |
| 262 | Ga0496117_0002697 | 3300048920 | Bacteria | 21945 |
| 263 | Ga0496117_0003170 | 3300048920 | Bacteria | 19550 |
| 264 | Ga0496117_0027591 | 3300048920 | Bacteria | 4418 |
| 265 | Ga0496117_0041272 | 3300048920 | Bacteria | 3383 |
| 266 | Ga0496118_0000646 | 3300048921 | Bacteria | 57111 |
| 267 | Ga0496118_0003380 | 3300048921 | Bacteria | 20165 |
| 268 | Ga0496118_0099320 | 3300048921 | Bacteria | 1973 |
| 269 | Ga0496118_0144429 | 3300048921 | Bacteria | 1501 |
| 270 | Ga0496119_0000113 | 3300048922 | Bacteria | 114626 |
| 271 | Ga0496119_0000583 | 3300048922 | Bacteria | 49314 |
| 272 | Ga0496119_0014798 | 3300048922 | Bacteria | 6070 |
| 273 | Ga0496119_0044094 | 3300048922 | Bacteria | 2811 |
| 274 | Ga0496119_0079833 | 3300048922 | Bacteria | 1888 |
| 275 | Ga0496119_0241983 | 3300048922 | Bacteria | 914 |
| 276 | Ga0496119_0425722 | 3300048922 | Bacteria | 629 |
| 277 | Ga0496120_0000187 | 3300048923 | Bacteria | 105936 |
| 278 | Ga0496120_0000262 | 3300048923 | Bacteria | 88205 |
| 279 | Ga0496120_0000450 | 3300048923 | Bacteria | 65290 |
| 280 | Ga0496120_0036229 | 3300048923 | Bacteria | 2939 |
| 281 | Ga0496120_0039025 | 3300048923 | Bacteria | 2805 |
| 282 | Ga0496121_0008306 | 3300048924 | Bacteria | 12277 |
| 283 | Ga0496121_0070895 | 3300048924 | Bacteria | 2804 |
| 284 | Ga0496121_0107578 | 3300048924 | Bacteria | 2135 |
| 285 | Ga0496121_0356469 | 3300048924 | Bacteria | 972 |
| 286 | Ga0496122_0000537 | 3300048925 | Bacteria | 78505 |
| 287 | Ga0496122_0002036 | 3300048925 | Bacteria | 30007 |
| 288 | Ga0496122_0037580 | 3300048925 | Bacteria | 3894 |
| 289 | Ga0496122_0041311 | 3300048925 | Bacteria | 3649 |
| 290 | Ga0496122_0194159 | 3300048925 | Bacteria | 1194 |
| 291 | Ga0496123_0000987 | 3300048926 | Bacteria | 43765 |
| 292 | Ga0496123_0001380 | 3300048926 | Bacteria | 34009 |
| 293 | Ga0496123_0021304 | 3300048926 | Bacteria | 5042 |
| 294 | Ga0496123_0191995 | 3300048926 | Bacteria | 1055 |
| 295 | Ga0496124_0001915 | 3300048927 | Bacteria | 28557 |
| 296 | Ga0496124_0003734 | 3300048927 | Bacteria | 18364 |
| 297 | Ga0496124_0058029 | 3300048927 | Bacteria | 3257 |
| 298 | Ga0496124_0059823 | 3300048927 | Bacteria | 3198 |
| 299 | Ga0496124_0071265 | 3300048927 | Bacteria | 2881 |
| 300 | Ga0496124_0132961 | 3300048927 | Bacteria | 1974 |
| 301 | Ga0496124_0156229 | 3300048927 | Bacteria | 1783 |
| 302 | Ga0496125_0005866 | 3300048928 | Bacteria | 13482 |
| 303 | Ga0496125_0011875 | 3300048928 | Bacteria | 8676 |
| 304 | Ga0496125_0019366 | 3300048928 | Bacteria | 6422 |
| 305 | Ga0496125_0027008 | 3300048928 | Bacteria | 5212 |
| 306 | Ga0496125_0097216 | 3300048928 | Bacteria | 2182 |
| 307 | Ga0496125_0100999 | 3300048928 | Bacteria | 2124 |
| 308 | Ga0496125_0128129 | 3300048928 | Bacteria | 1793 |
| 309 | Ga0496126_0000847 | 3300048929 | Bacteria | 54109 |
| 310 | Ga0496126_0032108 | 3300048929 | Bacteria | 4951 |
| 311 | Ga0496126_0108026 | 3300048929 | Bacteria | 2426 |
| 312 | Ga0496126_0280172 | 3300048929 | Bacteria | 1381 |
| 313 | Ga0496126_0423308 | 3300048929 | Bacteria | 1076 |
| 314 | Ga0501031_0107632 | 3300049568 | Bacteria | 1820 |
| 315 | Ga0501032_0155673 | 3300049569 | Bacteria | 1501 |
| 316 | Ga0501032_0570401 | 3300049569 | Bacteria | 721 |
| 317 | Ga0501033_0029226 | 3300049570 | Bacteria | 4141 |
| 318 | Ga0501034_0401326 | 3300049571 | Bacteria | 1294 |
| 319 | Ga0501036_0086517 | 3300049572 | Bacteria | 2649 |
| 320 | Ga0501038_0583799 | 3300049574 | Bacteria | 847 |
| 321 | Ga0501039_0129487 | 3300049575 | Bacteria | 1980 |
| 322 | Ga0501042_0362034 | 3300049578 | Bacteria | 1050 |
| 323 | Ga0501043_0453966 | 3300049579 | Bacteria | 962 |
| 324 | Ga0501046_0191258 | 3300049580 | Bacteria | 1526 |
| 325 | Ga0501047_0016575 | 3300049581 | Bacteria | 7035 |
| 326 | Ga0501047_0409533 | 3300049581 | Bacteria | 1188 |
| 327 | Ga0501047_0696003 | 3300049581 | Bacteria | 834 |
| 328 | Ga0501048_0261139 | 3300049582 | Bacteria | 1230 |
| 329 | Ga0501067_0007762 | 3300049583 | Bacteria | 5968 |
| 330 | Ga0501069_0386167 | 3300049585 | Bacteria | 827 |
| 331 | Ga0501070_0000265 | 3300049586 | Bacteria | 49246 |
| 332 | Ga0501070_0722463 | 3300049586 | Bacteria | 786 |
| 333 | Ga0501071_0266833 | 3300049587 | Bacteria | 1293 |
| 334 | Ga0501073_0005054 | 3300049589 | Bacteria | 9890 |
| 335 | Ga0501073_0124892 | 3300049589 | Bacteria | 1784 |
| 336 | Ga0501074_0660216 | 3300049590 | Bacteria | 738 |
| 337 | Ga0501077_0228395 | 3300049593 | Bacteria | 1183 |
| 338 | Ga0501080_0133810 | 3300049742 | Bacteria | 2295 |
| 339 | Ga0501083_0075217 | 3300049744 | Bacteria | 2243 |
| 340 | Ga0501035_0286705 | 3300049822 | Bacteria | 1390 |
| 341 | Ga0501035_0491104 | 3300049822 | Bacteria | 1011 |
| 342 | Ga0501045_0175858 | 3300049824 | Bacteria | 1595 |
| 343 | nmdc:mga00v17_214037_c1 | 3300050491 | Bacteria | 1247 |
| 344 | nmdc:mga06r32_1361867_c1 | 3300050510 | Bacteria | 652 |
| 345 | nmdc:mga08y16_87289_c1 | 3300050511 | Bacteria | 3250 |
| 346 | nmdc:mga0rr50_1071374_c1 | 3300050513 | Bacteria | 686 |
| 347 | Ga0500651_0000120 | 3300053093 | Bacteria | 48678 |
| 348 | Ga0501082_0248092 | 3300060353 | Bacteria | 1550 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10027230 | Ga0111539_100272302 | 168 |
| 2 | 3300027907 | Ga0207428_10363444 | Ga0207428_103634442 | 168 |
| 3 | 3300050511 | nmdc:mga08y16_87289_c1 | nmdc:mga08y16_87289_c1_2282_2839 | 168 |
| 4 | iso_pu_bacteria | 2919130084 | 2919132062 | 169 |
| 5 | iso_pu_bacteria | 2929195423 | 2929199199 | 169 |
| 6 | iso_pu_bacteria | 2977247770 | 2977250926 | 170 |
| 7 | 3300003771 | Ga0055526_1000218 | Ga0055526_100021831 | 174 |
| 8 | 3300003773 | Ga0055537_1000196 | Ga0055537_100019637 | 174 |
| 9 | 3300003784 | Ga0055534_1000061 | Ga0055534_100006160 | 174 |
| 10 | 3300003790 | Ga0055528_1000332 | Ga0055528_100033219 | 174 |
| 11 | 3300005288 | Ga0065714_10077704 | Ga0065714_100777043 | 174 |
| 12 | 3300005293 | Ga0065715_10005422 | Ga0065715_100054223 | 174 |
| 13 | 3300009553 | Ga0105249_11243949 | Ga0105249_112439491 | 174 |
| 14 | 3300017792 | Ga0163161_10022036 | Ga0163161_100220363 | 174 |
| 15 | 3300025263 | Ga0209565_1000037 | Ga0209565_100003768 | 174 |
| 16 | 3300025273 | Ga0209673_1000032 | Ga0209673_1000032172 | 174 |
| 17 | 3300025291 | Ga0209675_1000020 | Ga0209675_1000020103 | 174 |
| 18 | 3300025295 | Ga0209564_1000210 | Ga0209564_100021020 | 174 |
| 19 | 3300048922 | Ga0496119_0425722 | Ga0496119_0425722_85_609 | 174 |
| 20 | 3300048923 | Ga0496120_0036229 | Ga0496120_0036229_800_1324 | 174 |
| 21 | 3300048924 | Ga0496121_0008306 | Ga0496121_0008306_10814_11338 | 174 |
| 22 | 3300048928 | Ga0496125_0005866 | Ga0496125_0005866_9919_10443 | 174 |
| 23 | 3300048929 | Ga0496126_0000847 | Ga0496126_0000847_27656_28180 | 174 |
| 24 | 3300050491 | nmdc:mga00v17_214037_c1 | nmdc:mga00v17_214037_c1_609_1133 | 174 |
| 25 | 3300049586 | Ga0501070_0722463 | Ga0501070_0722463_248_775 | 175 |
| 26 | 3300003781 | Ga0055536_1000357 | Ga0055536_10003575 | 177 |
| 27 | 3300003791 | Ga0055530_10002004 | Ga0055530_1000200412 | 177 |
| 28 | 3300003794 | Ga0055531_10000512 | Ga0055531_1000051227 | 177 |
| 29 | 3300025292 | Ga0209676_1000199 | Ga0209676_100019956 | 177 |
| 30 | 3300025298 | Ga0209050_1000199 | Ga0209050_100019955 | 177 |
| 31 | 3300025303 | Ga0209051_1052122 | Ga0209051_10521222 | 177 |
| 32 | 3300025304 | Ga0209257_1000086 | Ga0209257_1000086198 | 177 |
| 33 | 3300005338 | Ga0068868_100650897 | Ga0068868_1006508971 | 179 |
| 34 | 3300005617 | Ga0068859_100248701 | Ga0068859_1002487012 | 179 |
| 35 | 3300005842 | Ga0068858_100209786 | Ga0068858_1002097862 | 179 |
| 36 | 3300006177 | Ga0075362_10164430 | Ga0075362_101644302 | 179 |
| 37 | 3300006931 | Ga0097620_100248706 | Ga0097620_1002487062 | 179 |
| 38 | 3300014968 | Ga0157379_10364972 | Ga0157379_103649722 | 179 |
| 39 | 3300028381 | Ga0268264_10158414 | Ga0268264_101584142 | 179 |
| 40 | 3300048919 | Ga0496116_0004829 | Ga0496116_0004829_9225_9782 | 179 |
| 41 | 3300050510 | nmdc:mga06r32_1361867_c1 | nmdc:mga06r32_1361867_c1_20_580 | 179 |
| 42 | 3300050513 | nmdc:mga0rr50_1071374_c1 | nmdc:mga0rr50_1071374_c1_43_588 | 179 |
| 43 | 3300006237 | Ga0097621_100120579 | Ga0097621_1001205792 | 181 |
| 44 | 3300014969 | Ga0157376_10864323 | Ga0157376_108643232 | 181 |
| 45 | iso_pu_bacteria | 2747842428 | 2747949615 | 181 |
| 46 | iso_pu_bacteria | 2747842501 | 2748019021 | 181 |
| 47 | iso_pu_bacteria | 2765235840 | 2765577552 | 181 |
| 48 | iso_pu_bacteria | 2816332141 | 2816519319 | 181 |
| 49 | iso_pu_bacteria | 2818991457 | 2819662504 | 181 |
| 50 | iso_pu_bacteria | 2842391507 | 2842392540 | 181 |
| 51 | iso_pu_bacteria | 2842757796 | 2842759511 | 181 |
| 52 | iso_pu_bacteria | 2874220319 | 2874224398 | 181 |
| 53 | iso_pu_bacteria | 2895498888 | 2895501417 | 181 |
| 54 | iso_pu_bacteria | 2895511927 | 2895514560 | 181 |
| 55 | iso_pu_bacteria | 2895522137 | 2895523958 | 181 |
| 56 | iso_pu_bacteria | 2895525241 | 2895527447 | 181 |
| 57 | iso_pu_bacteria | 2919089067 | 2919091410 | 181 |
| 58 | iso_pu_bacteria | 2919134579 | 2919135183 | 181 |
| 59 | iso_pu_bacteria | 2928496128 | 2928499543 | 181 |
| 60 | iso_pu_bacteria | 2931380184 | 2931382197 | 181 |
| 61 | iso_pu_bacteria | 2937610967 | 2937611015 | 181 |
| 62 | iso_pu_bacteria | 2939622612 | 2939624774 | 181 |
| 63 | iso_pu_bacteria | 2939626828 | 2939628889 | 181 |
| 64 | iso_pu_bacteria | 2961047084 | 2961051162 | 181 |
| 65 | iso_pu_bacteria | 2961064222 | 2961065474 | 181 |
| 66 | iso_pu_bacteria | 2987605356 | 2987608859 | 181 |
| 67 | iso_pu_bacteria | 8021622325 | 8021625226 | 181 |
| 68 | iso_pu_bacteria | 8021626552 | 8021627502 | 181 |
| 69 | iso_pu_bacteria | 8021648035 | 8021649247 | 181 |
| 70 | 3300005336 | Ga0070680_100130753 | Ga0070680_1001307532 | 182 |
| 71 | 3300005344 | Ga0070661_100118110 | Ga0070661_1001181102 | 182 |
| 72 | 3300005345 | Ga0070692_10069574 | Ga0070692_100695742 | 182 |
| 73 | 3300005455 | Ga0070663_100218751 | Ga0070663_1002187512 | 182 |
| 74 | 3300005578 | Ga0068854_100105640 | Ga0068854_1001056402 | 182 |
| 75 | 3300013105 | Ga0157369_10383940 | Ga0157369_103839402 | 182 |
| 76 | 3300013307 | Ga0157372_10545264 | Ga0157372_105452641 | 182 |
| 77 | 3300025909 | Ga0207705_10531314 | Ga0207705_105313141 | 182 |
| 78 | 3300025913 | Ga0207695_10170558 | Ga0207695_101705582 | 182 |
| 79 | 3300025917 | Ga0207660_10017076 | Ga0207660_100170764 | 182 |
| 80 | 3300025919 | Ga0207657_10225600 | Ga0207657_102256002 | 182 |
| 81 | 3300025932 | Ga0207690_10152508 | Ga0207690_101525081 | 182 |
| 82 | 3300025949 | Ga0207667_10400127 | Ga0207667_104001271 | 182 |
| 83 | 3300026041 | Ga0207639_10269239 | Ga0207639_102692392 | 182 |
| 84 | iso_pu_bacteria | 2842918807 | 2842920363 | 182 |
| 85 | 3300009094 | Ga0111539_10631023 | Ga0111539_106310232 | 183 |
| 86 | 3300009094 | Ga0111539_10215866 | Ga0111539_102158663 | 184 |
| 87 | 3300041491 | Ga0451833_0426302 | Ga0451833_0426302_136_690 | 184 |
| 88 | 3300053093 | Ga0500651_0000120 | Ga0500651_0000120_44030_44584 | 184 |
| 89 | 2162886007 | SwRhRL2b_contig_1859639 | SwRhRL2b_0159.00006960 | 185 |
| 90 | 2162886007 | SwRhRL2b_contig_1921671 | SwRhRL2b_0817.00002780 | 185 |
| 91 | 2162886007 | SwRhRL2b_contig_2034220 | SwRhRL2b_0947.00006110 | 185 |
| 92 | 2162886007 | SwRhRL2b_contig_268782 | SwRhRL2b_0396.00002500 | 185 |
| 93 | 3300001915 | JGI24741J21665_1006669 | JGI24741J21665_10066692 | 185 |
| 94 | 3300001979 | JGI24740J21852_10030076 | JGI24740J21852_100300762 | 185 |
| 95 | 3300003320 | rootH2_10067962 | rootH2_100679622 | 185 |
| 96 | 3300003760 | Ga0055527_1004526 | Ga0055527_10045262 | 185 |
| 97 | 3300003761 | Ga0055535_1000809 | Ga0055535_10008093 | 185 |
| 98 | 3300003762 | Ga0055542_1000285 | Ga0055542_100028531 | 185 |
| 99 | 3300003763 | Ga0055529_1000304 | Ga0055529_100030431 | 185 |
| 100 | 3300003794 | Ga0055531_10000741 | Ga0055531_100007413 | 185 |
| 101 | 3300003856 | Ga0058692_1000026 | Ga0058692_1000026161 | 185 |
| 102 | 3300005262 | Ga0065165_1000093 | Ga0065165_1000093116 | 185 |
| 103 | 3300005289 | Ga0065704_10070252 | Ga0065704_1007025219 | 185 |
| 104 | 3300005289 | Ga0065704_10237693 | Ga0065704_102376932 | 185 |
| 105 | 3300005293 | Ga0065715_10118500 | Ga0065715_101185003 | 185 |
| 106 | 3300005331 | Ga0070670_100003611 | Ga0070670_1000036118 | 185 |
| 107 | 3300005336 | Ga0070680_100047853 | Ga0070680_1000478532 | 185 |
| 108 | 3300005336 | Ga0070680_100671907 | Ga0070680_1006719071 | 185 |
| 109 | 3300005337 | Ga0070682_100915641 | Ga0070682_1009156411 | 185 |
| 110 | 3300005339 | Ga0070660_100619337 | Ga0070660_1006193371 | 185 |
| 111 | 3300005341 | Ga0070691_10004997 | Ga0070691_100049976 | 185 |
| 112 | 3300005341 | Ga0070691_10047971 | Ga0070691_100479712 | 185 |
| 113 | 3300005341 | Ga0070691_10344665 | Ga0070691_103446651 | 185 |
| 114 | 3300005341 | Ga0070691_10345013 | Ga0070691_103450132 | 185 |
| 115 | 3300005344 | Ga0070661_100243895 | Ga0070661_1002438952 | 185 |
| 116 | 3300005344 | Ga0070661_100593680 | Ga0070661_1005936802 | 185 |
| 117 | 3300005347 | Ga0070668_100019998 | Ga0070668_1000199983 | 185 |
| 118 | 3300005353 | Ga0070669_101215442 | Ga0070669_1012154421 | 185 |
| 119 | 3300005364 | Ga0070673_100102682 | Ga0070673_1001026822 | 185 |
| 120 | 3300005366 | Ga0070659_100331677 | Ga0070659_1003316772 | 185 |
| 121 | 3300005455 | Ga0070663_100066073 | Ga0070663_1000660731 | 185 |
| 122 | 3300005455 | Ga0070663_100075254 | Ga0070663_1000752543 | 185 |
| 123 | 3300005456 | Ga0070678_101230018 | Ga0070678_1012300181 | 185 |
| 124 | 3300005457 | Ga0070662_100176202 | Ga0070662_1001762022 | 185 |
| 125 | 3300005458 | Ga0070681_10001533 | Ga0070681_100015333 | 185 |
| 126 | 3300005458 | Ga0070681_10037603 | Ga0070681_100376033 | 185 |
| 127 | 3300005458 | Ga0070681_10038032 | Ga0070681_100380323 | 185 |
| 128 | 3300005530 | Ga0070679_100001575 | Ga0070679_1000015753 | 185 |
| 129 | 3300005530 | Ga0070679_100040789 | Ga0070679_1000407895 | 185 |
| 130 | 3300005530 | Ga0070679_100233878 | Ga0070679_1002338782 | 185 |
| 131 | 3300005530 | Ga0070679_100459093 | Ga0070679_1004590931 | 185 |
| 132 | 3300005535 | Ga0070684_100290711 | Ga0070684_1002907111 | 185 |
| 133 | 3300005547 | Ga0070693_100018430 | Ga0070693_1000184302 | 185 |
| 134 | 3300005548 | Ga0070665_100247458 | Ga0070665_1002474582 | 185 |
| 135 | 3300005548 | Ga0070665_100249583 | Ga0070665_1002495833 | 185 |
| 136 | 3300005564 | Ga0070664_100052570 | Ga0070664_1000525702 | 185 |
| 137 | 3300005577 | Ga0068857_100242282 | Ga0068857_1002422822 | 185 |
| 138 | 3300005577 | Ga0068857_100439528 | Ga0068857_1004395282 | 185 |
| 139 | 3300005578 | Ga0068854_100069968 | Ga0068854_1000699681 | 185 |
| 140 | 3300005578 | Ga0068854_100180416 | Ga0068854_1001804162 | 185 |
| 141 | 3300005578 | Ga0068854_100294159 | Ga0068854_1002941592 | 185 |
| 142 | 3300005618 | Ga0068864_100554191 | Ga0068864_1005541912 | 185 |
| 143 | 3300005985 | Ga0081539_10007810 | Ga0081539_100078106 | 185 |
| 144 | 3300006051 | Ga0075364_10374325 | Ga0075364_103743252 | 185 |
| 145 | 3300006844 | Ga0075428_101413269 | Ga0075428_1014132691 | 185 |
| 146 | 3300009011 | Ga0105251_10000137 | Ga0105251_1000013737 | 185 |
| 147 | 3300009036 | Ga0105244_10036613 | Ga0105244_100366132 | 185 |
| 148 | 3300009093 | Ga0105240_10785646 | Ga0105240_107856462 | 185 |
| 149 | 3300009093 | Ga0105240_10888806 | Ga0105240_108888061 | 185 |
| 150 | 3300009545 | Ga0105237_10663254 | Ga0105237_106632542 | 185 |
| 151 | 3300009545 | Ga0105237_10741441 | Ga0105237_107414411 | 185 |
| 152 | 3300009551 | Ga0105238_10423370 | Ga0105238_104233702 | 185 |
| 153 | 3300013100 | Ga0157373_10003377 | Ga0157373_1000337711 | 185 |
| 154 | 3300013100 | Ga0157373_10004558 | Ga0157373_100045582 | 185 |
| 155 | 3300013100 | Ga0157373_10028173 | Ga0157373_100281732 | 185 |
| 156 | 3300013100 | Ga0157373_10114559 | Ga0157373_101145592 | 185 |
| 157 | 3300013102 | Ga0157371_10000450 | Ga0157371_1000045015 | 185 |
| 158 | 3300013102 | Ga0157371_10000679 | Ga0157371_1000067915 | 185 |
| 159 | 3300013102 | Ga0157371_10045094 | Ga0157371_100450943 | 185 |
| 160 | 3300013104 | Ga0157370_10011689 | Ga0157370_100116894 | 185 |
| 161 | 3300013104 | Ga0157370_10151660 | Ga0157370_101516602 | 185 |
| 162 | 3300013104 | Ga0157370_10196348 | Ga0157370_101963482 | 185 |
| 163 | 3300013104 | Ga0157370_10319541 | Ga0157370_103195412 | 185 |
| 164 | 3300013105 | Ga0157369_10019802 | Ga0157369_100198022 | 185 |
| 165 | 3300013105 | Ga0157369_10239087 | Ga0157369_102390873 | 185 |
| 166 | 3300013297 | Ga0157378_10078085 | Ga0157378_100780853 | 185 |
| 167 | 3300013307 | Ga0157372_10110968 | Ga0157372_101109682 | 185 |
| 168 | 3300013307 | Ga0157372_11005085 | Ga0157372_110050852 | 185 |
| 169 | 3300014326 | Ga0157380_10585977 | Ga0157380_105859772 | 185 |
| 170 | 3300014968 | Ga0157379_10429396 | Ga0157379_104293962 | 185 |
| 171 | 3300015261 | Ga0182006_1010931 | Ga0182006_10109312 | 185 |
| 172 | 3300015262 | Ga0182007_10000190 | Ga0182007_1000019023 | 185 |
| 173 | 3300015262 | Ga0182007_10001819 | Ga0182007_100018197 | 185 |
| 174 | 3300015265 | Ga0182005_1007698 | Ga0182005_10076983 | 185 |
| 175 | 3300017792 | Ga0163161_10006770 | Ga0163161_100067706 | 185 |
| 176 | 3300017792 | Ga0163161_10016174 | Ga0163161_100161743 | 185 |
| 177 | 3300020610 | Ga0154015_1289840 | Ga0154015_12898402 | 185 |
| 178 | 3300025228 | Ga0209672_100109 | Ga0209672_10010916 | 185 |
| 179 | 3300025242 | Ga0209258_100185 | Ga0209258_10018564 | 185 |
| 180 | 3300025254 | Ga0209148_1000042 | Ga0209148_1000042340 | 185 |
| 181 | 3300025272 | Ga0209455_1000016 | Ga0209455_1000016595 | 185 |
| 182 | 3300025291 | Ga0209675_1012937 | Ga0209675_10129372 | 185 |
| 183 | 3300025292 | Ga0209676_1000149 | Ga0209676_100014964 | 185 |
| 184 | 3300025292 | Ga0209676_1000775 | Ga0209676_100077515 | 185 |
| 185 | 3300025298 | Ga0209050_1023620 | Ga0209050_10236202 | 185 |
| 186 | 3300025299 | Ga0209256_1003064 | Ga0209256_10030649 | 185 |
| 187 | 3300025304 | Ga0209257_1000067 | Ga0209257_100006777 | 185 |
| 188 | 3300025304 | Ga0209257_1000664 | Ga0209257_100066432 | 185 |
| 189 | 3300025304 | Ga0209257_1000734 | Ga0209257_100073415 | 185 |
| 190 | 3300025304 | Ga0209257_1049179 | Ga0209257_10491792 | 185 |
| 191 | 3300025728 | Ga0207655_1031255 | Ga0207655_10312552 | 185 |
| 192 | 3300025735 | Ga0207713_1000253 | Ga0207713_100025349 | 185 |
| 193 | 3300025904 | Ga0207647_10026132 | Ga0207647_100261322 | 185 |
| 194 | 3300025909 | Ga0207705_10015664 | Ga0207705_100156642 | 185 |
| 195 | 3300025909 | Ga0207705_10056114 | Ga0207705_100561143 | 185 |
| 196 | 3300025909 | Ga0207705_10091355 | Ga0207705_100913553 | 185 |
| 197 | 3300025909 | Ga0207705_10225179 | Ga0207705_102251792 | 185 |
| 198 | 3300025912 | Ga0207707_10000548 | Ga0207707_1000054817 | 185 |
| 199 | 3300025912 | Ga0207707_10006627 | Ga0207707_100066277 | 185 |
| 200 | 3300025912 | Ga0207707_10108634 | Ga0207707_101086342 | 185 |
| 201 | 3300025913 | Ga0207695_10013042 | Ga0207695_100130427 | 185 |
| 202 | 3300025913 | Ga0207695_10576456 | Ga0207695_105764562 | 185 |
| 203 | 3300025913 | Ga0207695_10935068 | Ga0207695_109350681 | 185 |
| 204 | 3300025917 | Ga0207660_10034567 | Ga0207660_100345673 | 185 |
| 205 | 3300025917 | Ga0207660_10046786 | Ga0207660_100467863 | 185 |
| 206 | 3300025917 | Ga0207660_10495893 | Ga0207660_104958932 | 185 |
| 207 | 3300025917 | Ga0207660_10635121 | Ga0207660_106351211 | 185 |
| 208 | 3300025917 | Ga0207660_10774501 | Ga0207660_107745012 | 185 |
| 209 | 3300025919 | Ga0207657_10433108 | Ga0207657_104331081 | 185 |
| 210 | 3300025920 | Ga0207649_10242985 | Ga0207649_102429852 | 185 |
| 211 | 3300025921 | Ga0207652_10000565 | Ga0207652_1000056518 | 185 |
| 212 | 3300025921 | Ga0207652_10002262 | Ga0207652_1000226211 | 185 |
| 213 | 3300025921 | Ga0207652_10042402 | Ga0207652_100424022 | 185 |
| 214 | 3300025921 | Ga0207652_10439024 | Ga0207652_104390242 | 185 |
| 215 | 3300025921 | Ga0207652_10849263 | Ga0207652_108492632 | 185 |
| 216 | 3300025925 | Ga0207650_10002871 | Ga0207650_100028715 | 185 |
| 217 | 3300025925 | Ga0207650_10067301 | Ga0207650_100673013 | 185 |
| 218 | 3300025931 | Ga0207644_10361701 | Ga0207644_103617012 | 185 |
| 219 | 3300025932 | Ga0207690_10341231 | Ga0207690_103412312 | 185 |
| 220 | 3300025949 | Ga0207667_10045157 | Ga0207667_100451574 | 185 |
| 221 | 3300025949 | Ga0207667_10077501 | Ga0207667_100775014 | 185 |
| 222 | 3300025949 | Ga0207667_10102662 | Ga0207667_101026624 | 185 |
| 223 | 3300025972 | Ga0207668_10019457 | Ga0207668_100194574 | 185 |
| 224 | 3300025981 | Ga0207640_10050550 | Ga0207640_100505502 | 185 |
| 225 | 3300025986 | Ga0207658_10681701 | Ga0207658_106817011 | 185 |
| 226 | 3300026067 | Ga0207678_10007269 | Ga0207678_100072697 | 185 |
| 227 | 3300026067 | Ga0207678_10116078 | Ga0207678_101160782 | 185 |
| 228 | 3300026078 | Ga0207702_10449310 | Ga0207702_104493101 | 185 |
| 229 | 3300026095 | Ga0207676_10131975 | Ga0207676_101319753 | 185 |
| 230 | 3300026116 | Ga0207674_10145451 | Ga0207674_101454512 | 185 |
| 231 | 3300026121 | Ga0207683_10633991 | Ga0207683_106339912 | 185 |
| 232 | 3300027312 | Ga0209371_1000028 | Ga0209371_1000028183 | 185 |
| 233 | 3300027471 | Ga0209995_1010204 | Ga0209995_10102042 | 185 |
| 234 | 3300028379 | Ga0268266_10271496 | Ga0268266_102714962 | 185 |
| 235 | 3300028379 | Ga0268266_10901139 | Ga0268266_109011392 | 185 |
| 236 | 3300028794 | Ga0307515_10284016 | Ga0307515_102840162 | 185 |
| 237 | 3300030500 | Ga0268256_1000030 | Ga0268256_1000030211 | 185 |
| 238 | 3300030744 | Ga0316181_1085609 | Ga0316181_10856093 | 185 |
| 239 | 3300031456 | Ga0307513_10082278 | Ga0307513_100822783 | 185 |
| 240 | 3300031548 | Ga0307408_100062318 | Ga0307408_1000623183 | 185 |
| 241 | 3300031730 | Ga0307516_10066109 | Ga0307516_100661092 | 185 |
| 242 | 3300031852 | Ga0307410_10251731 | Ga0307410_102517312 | 185 |
| 243 | 3300031852 | Ga0307410_10395715 | Ga0307410_103957152 | 185 |
| 244 | 3300031901 | Ga0307406_10554364 | Ga0307406_105543641 | 185 |
| 245 | 3300031911 | Ga0307412_10000422 | Ga0307412_1000042221 | 185 |
| 246 | 3300031911 | Ga0307412_10002851 | Ga0307412_100028513 | 185 |
| 247 | 3300032002 | Ga0307416_100019631 | Ga0307416_1000196312 | 185 |
| 248 | 3300032004 | Ga0307414_10049987 | Ga0307414_100499873 | 185 |
| 249 | 3300032004 | Ga0307414_10123148 | Ga0307414_101231482 | 185 |
| 250 | 3300032005 | Ga0307411_10151745 | Ga0307411_101517452 | 185 |
| 251 | 3300032005 | Ga0307411_10578049 | Ga0307411_105780491 | 185 |
| 252 | 3300037312 | Ga0395899_0028130 | Ga0395899_0028130_294_851 | 185 |
| 253 | 3300037312 | Ga0395899_0035682 | Ga0395899_0035682_27_584 | 185 |
| 254 | 3300037312 | Ga0395899_0052601 | Ga0395899_0052601_2023_2598 | 185 |
| 255 | 3300037418 | Ga0395900_0010565 | Ga0395900_0010565_4764_5321 | 185 |
| 256 | 3300037418 | Ga0395900_0030936 | Ga0395900_0030936_1167_1742 | 185 |
| 257 | 3300037418 | Ga0395900_0137822 | Ga0395900_0137822_1368_1946 | 185 |
| 258 | 3300037418 | Ga0395900_0653251 | Ga0395900_0653251_309_866 | 185 |
| 259 | 3300037466 | Ga0395898_0030025 | Ga0395898_0030025_4126_4683 | 185 |
| 260 | 3300037466 | Ga0395898_0376727 | Ga0395898_0376727_762_1337 | 185 |
| 261 | 3300037471 | Ga0395905_0001195 | Ga0395905_0001195_16391_16948 | 185 |
| 262 | 3300037471 | Ga0395905_0099463 | Ga0395905_0099463_860_1417 | 185 |
| 263 | 3300037471 | Ga0395905_0113121 | Ga0395905_0113121_1815_2372 | 185 |
| 264 | 3300038443 | Ga0395901_0023786 | Ga0395901_0023786_3291_3848 | 185 |
| 265 | 3300038443 | Ga0395901_0296001 | Ga0395901_0296001_857_1432 | 185 |
| 266 | 3300038443 | Ga0395901_0656583 | Ga0395901_0656583_170_727 | 185 |
| 267 | 3300038443 | Ga0395901_1311231 | Ga0395901_1311231_54_611 | 185 |
| 268 | 3300041404 | Ga0439436_0000066 | Ga0439436_0000066_10993_11553 | 185 |
| 269 | 3300041486 | Ga0451807_1491765 | Ga0451807_1491765_309_866 | 185 |
| 270 | 3300041509 | Ga0451843_0080570 | Ga0451843_0080570_329_886 | 185 |
| 271 | 3300041512 | Ga0451853_0209765 | Ga0451853_0209765_47_616 | 185 |
| 272 | 3300042533 | Ga0450901_007188 | Ga0450901_007188_15_572 | 185 |
| 273 | 3300044684 | Ga0466966_0008551 | Ga0466966_0008551_1536_2093 | 185 |
| 274 | 3300044719 | Ga0466971_0207052 | Ga0466971_0207052_90_647 | 185 |
| 275 | 3300045049 | Ga0466959_0577283 | Ga0466959_0577283_49_606 | 185 |
| 276 | 3300046460 | Ga0495638_0001623 | Ga0495638_0001623_2290_2847 | 185 |
| 277 | 3300046507 | Ga0495606_0119493 | Ga0495606_0119493_20_580 | 185 |
| 278 | 3300046512 | Ga0495610_0001987 | Ga0495610_0001987_10984_11544 | 185 |
| 279 | 3300046512 | Ga0495610_0231041 | Ga0495610_0231041_37_594 | 185 |
| 280 | 3300046523 | Ga0495644_0121598 | Ga0495644_0121598_259_816 | 185 |
| 281 | 3300046525 | Ga0495663_0005381 | Ga0495663_0005381_1279_1836 | 185 |
| 282 | 3300046537 | Ga0495598_0008269 | Ga0495598_0008269_873_1430 | 185 |
| 283 | 3300046558 | Ga0495633_0028625 | Ga0495633_0028625_1257_1814 | 185 |
| 284 | 3300046616 | Ga0495668_0001955 | Ga0495668_0001955_6796_7356 | 185 |
| 285 | 3300046616 | Ga0495668_0056429 | Ga0495668_0056429_93_653 | 185 |
| 286 | 3300046660 | Ga0495625_0014458 | Ga0495625_0014458_3664_4221 | 185 |
| 287 | 3300046810 | Ga0495660_0000348 | Ga0495660_0000348_30588_31148 | 185 |
| 288 | 3300047318 | Ga0495636_0052584 | Ga0495636_0052584_953_1510 | 185 |
| 289 | 3300047445 | Ga0495677_0037116 | Ga0495677_0037116_219_779 | 185 |
| 290 | 3300047469 | Ga0495673_0000036 | Ga0495673_0000036_273968_274528 | 185 |
| 291 | 3300047472 | Ga0495686_0000033 | Ga0495686_0000033_119998_120558 | 185 |
| 292 | 3300048903 | Ga0496100_0231345 | Ga0496100_0231345_489_1046 | 185 |
| 293 | 3300048907 | Ga0496104_0325546 | Ga0496104_0325546_141_698 | 185 |
| 294 | 3300048907 | Ga0496104_0334400 | Ga0496104_0334400_542_1099 | 185 |
| 295 | 3300048908 | Ga0496105_0079477 | Ga0496105_0079477_969_1526 | 185 |
| 296 | 3300048911 | Ga0496108_0375936 | Ga0496108_0375936_497_1054 | 185 |
| 297 | 3300048912 | Ga0496109_0015915 | Ga0496109_0015915_4705_5262 | 185 |
| 298 | 3300048912 | Ga0496109_0464971 | Ga0496109_0464971_187_744 | 185 |
| 299 | 3300048915 | Ga0496112_0182950 | Ga0496112_0182950_780_1337 | 185 |
| 300 | 3300048916 | Ga0496113_0030158 | Ga0496113_0030158_509_1066 | 185 |
| 301 | 3300048919 | Ga0496116_0054466 | Ga0496116_0054466_1937_2494 | 185 |
| 302 | 3300048920 | Ga0496117_0002697 | Ga0496117_0002697_4593_5150 | 185 |
| 303 | 3300048920 | Ga0496117_0003170 | Ga0496117_0003170_9281_9838 | 185 |
| 304 | 3300048920 | Ga0496117_0027591 | Ga0496117_0027591_1508_2065 | 185 |
| 305 | 3300048920 | Ga0496117_0041272 | Ga0496117_0041272_2112_2669 | 185 |
| 306 | 3300048921 | Ga0496118_0000646 | Ga0496118_0000646_7660_8217 | 185 |
| 307 | 3300048921 | Ga0496118_0003380 | Ga0496118_0003380_17290_17847 | 185 |
| 308 | 3300048921 | Ga0496118_0099320 | Ga0496118_0099320_497_1054 | 185 |
| 309 | 3300048921 | Ga0496118_0144429 | Ga0496118_0144429_296_853 | 185 |
| 310 | 3300048922 | Ga0496119_0000113 | Ga0496119_0000113_69837_70394 | 185 |
| 311 | 3300048922 | Ga0496119_0000583 | Ga0496119_0000583_44293_44850 | 185 |
| 312 | 3300048922 | Ga0496119_0014798 | Ga0496119_0014798_2908_3465 | 185 |
| 313 | 3300048922 | Ga0496119_0044094 | Ga0496119_0044094_1233_1790 | 185 |
| 314 | 3300048922 | Ga0496119_0079833 | Ga0496119_0079833_776_1333 | 185 |
| 315 | 3300048922 | Ga0496119_0241983 | Ga0496119_0241983_55_612 | 185 |
| 316 | 3300048923 | Ga0496120_0000187 | Ga0496120_0000187_24787_25344 | 185 |
| 317 | 3300048923 | Ga0496120_0000262 | Ga0496120_0000262_61977_62534 | 185 |
| 318 | 3300048923 | Ga0496120_0000450 | Ga0496120_0000450_15674_16231 | 185 |
| 319 | 3300048923 | Ga0496120_0039025 | Ga0496120_0039025_1230_1787 | 185 |
| 320 | 3300048924 | Ga0496121_0070895 | Ga0496121_0070895_725_1282 | 185 |
| 321 | 3300048924 | Ga0496121_0107578 | Ga0496121_0107578_839_1396 | 185 |
| 322 | 3300048924 | Ga0496121_0356469 | Ga0496121_0356469_78_635 | 185 |
| 323 | 3300048925 | Ga0496122_0000537 | Ga0496122_0000537_20309_20866 | 185 |
| 324 | 3300048925 | Ga0496122_0002036 | Ga0496122_0002036_2953_3510 | 185 |
| 325 | 3300048925 | Ga0496122_0037580 | Ga0496122_0037580_3132_3689 | 185 |
| 326 | 3300048925 | Ga0496122_0041311 | Ga0496122_0041311_1583_2140 | 185 |
| 327 | 3300048925 | Ga0496122_0194159 | Ga0496122_0194159_165_722 | 185 |
| 328 | 3300048926 | Ga0496123_0000987 | Ga0496123_0000987_20160_20717 | 185 |
| 329 | 3300048926 | Ga0496123_0001380 | Ga0496123_0001380_2967_3524 | 185 |
| 330 | 3300048926 | Ga0496123_0021304 | Ga0496123_0021304_1763_2320 | 185 |
| 331 | 3300048926 | Ga0496123_0191995 | Ga0496123_0191995_317_874 | 185 |
| 332 | 3300048927 | Ga0496124_0001915 | Ga0496124_0001915_2547_3104 | 185 |
| 333 | 3300048927 | Ga0496124_0003734 | Ga0496124_0003734_2333_2890 | 185 |
| 334 | 3300048927 | Ga0496124_0058029 | Ga0496124_0058029_87_644 | 185 |
| 335 | 3300048927 | Ga0496124_0059823 | Ga0496124_0059823_1413_1970 | 185 |
| 336 | 3300048927 | Ga0496124_0071265 | Ga0496124_0071265_788_1345 | 185 |
| 337 | 3300048927 | Ga0496124_0132961 | Ga0496124_0132961_95_652 | 185 |
| 338 | 3300048927 | Ga0496124_0156229 | Ga0496124_0156229_941_1498 | 185 |
| 339 | 3300048928 | Ga0496125_0011875 | Ga0496125_0011875_6815_7372 | 185 |
| 340 | 3300048928 | Ga0496125_0019366 | Ga0496125_0019366_1181_1738 | 185 |
| 341 | 3300048928 | Ga0496125_0027008 | Ga0496125_0027008_1270_1827 | 185 |
| 342 | 3300048928 | Ga0496125_0097216 | Ga0496125_0097216_1306_1863 | 185 |
| 343 | 3300048928 | Ga0496125_0100999 | Ga0496125_0100999_1256_1813 | 185 |
| 344 | 3300048928 | Ga0496125_0128129 | Ga0496125_0128129_764_1321 | 185 |
| 345 | 3300048929 | Ga0496126_0032108 | Ga0496126_0032108_277_834 | 185 |
| 346 | 3300048929 | Ga0496126_0108026 | Ga0496126_0108026_636_1193 | 185 |
| 347 | 3300048929 | Ga0496126_0280172 | Ga0496126_0280172_612_1169 | 185 |
| 348 | 3300048929 | Ga0496126_0423308 | Ga0496126_0423308_502_1059 | 185 |
| 349 | 3300049568 | Ga0501031_0107632 | Ga0501031_0107632_515_1072 | 185 |
| 350 | 3300049569 | Ga0501032_0155673 | Ga0501032_0155673_168_725 | 185 |
| 351 | 3300049569 | Ga0501032_0570401 | Ga0501032_0570401_134_709 | 185 |
| 352 | 3300049570 | Ga0501033_0029226 | Ga0501033_0029226_161_718 | 185 |
| 353 | 3300049571 | Ga0501034_0401326 | Ga0501034_0401326_343_918 | 185 |
| 354 | 3300049572 | Ga0501036_0086517 | Ga0501036_0086517_1974_2531 | 185 |
| 355 | 3300049574 | Ga0501038_0583799 | Ga0501038_0583799_142_717 | 185 |
| 356 | 3300049575 | Ga0501039_0129487 | Ga0501039_0129487_669_1226 | 185 |
| 357 | 3300049578 | Ga0501042_0362034 | Ga0501042_0362034_102_662 | 185 |
| 358 | 3300049579 | Ga0501043_0453966 | Ga0501043_0453966_387_944 | 185 |
| 359 | 3300049580 | Ga0501046_0191258 | Ga0501046_0191258_403_960 | 185 |
| 360 | 3300049581 | Ga0501047_0016575 | Ga0501047_0016575_3881_4438 | 185 |
| 361 | 3300049581 | Ga0501047_0409533 | Ga0501047_0409533_418_996 | 185 |
| 362 | 3300049581 | Ga0501047_0696003 | Ga0501047_0696003_226_804 | 185 |
| 363 | 3300049582 | Ga0501048_0261139 | Ga0501048_0261139_622_1179 | 185 |
| 364 | 3300049583 | Ga0501067_0007762 | Ga0501067_0007762_5161_5727 | 185 |
| 365 | 3300049585 | Ga0501069_0386167 | Ga0501069_0386167_125_703 | 185 |
| 366 | 3300049586 | Ga0501070_0000265 | Ga0501070_0000265_48530_49108 | 185 |
| 367 | 3300049587 | Ga0501071_0266833 | Ga0501071_0266833_204_779 | 185 |
| 368 | 3300049589 | Ga0501073_0005054 | Ga0501073_0005054_339_914 | 185 |
| 369 | 3300049589 | Ga0501073_0124892 | Ga0501073_0124892_969_1526 | 185 |
| 370 | 3300049590 | Ga0501074_0660216 | Ga0501074_0660216_50_625 | 185 |
| 371 | 3300049593 | Ga0501077_0228395 | Ga0501077_0228395_133_711 | 185 |
| 372 | 3300049742 | Ga0501080_0133810 | Ga0501080_0133810_1204_1761 | 185 |
| 373 | 3300049744 | Ga0501083_0075217 | Ga0501083_0075217_1116_1673 | 185 |
| 374 | 3300049822 | Ga0501035_0286705 | Ga0501035_0286705_72_650 | 185 |
| 375 | 3300049822 | Ga0501035_0491104 | Ga0501035_0491104_424_999 | 185 |
| 376 | 3300049824 | Ga0501045_0175858 | Ga0501045_0175858_414_971 | 185 |
| 377 | 3300060353 | Ga0501082_0248092 | Ga0501082_0248092_639_1196 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ndr-assembly1.cif.gz_B | crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose | 0.9767 | 2 | 185 |
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.971 | 2 | 173 |
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9705 | 2 | 171 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9699 | 2 | 174 |
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.9673 | 2 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9624 | 2 | 174 | 2.60.120.10 |
| af_Q17993_17_190_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9609 | 8 | 175 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.957 | 1 | 183 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9527 | 2 | 176 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9479 | 2 | 171 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V5V3A3-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.998 | 60 | 185 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A380THG7-F1-model_v4 | dTDP-4-deoxyrhamnose-3,5-epimerase (EC 5.1.3.13) | 0.9952 | 61 | 185 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A382ZPS9-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase | 0.9951 | 52 | 175 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A4U9HCF6-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9947 | 43 | 176 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A3D4TKL0-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9946 | 17 | 185 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar