F427698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 377 | 170 | 374 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10022999|Ga0157376_100229996 |
| Length | 367 |
| Sequence | MAFYVSIGPIFTVQLIILNTQFDSMKKWIVLTVLLIFLVAAFLVWKLFGPTVKQPEEKFLYIRTGSTYNAVVKDLQNRKIIKSAEGFNLISRALKYTIVKPGKYEIKKGMNLFNLVRMLKNGRQTPIDLVIIKFRTKEEFAGRIGREFETDSLQMLNFLSNHDSLEHYHLDTNTWACAIIPDTYRYFWNSTPTRIFSKLYAVSEGFWTSERKQELKDNNLTPVQAYTLASIIEEETNLKTDKGKIASVYINRIDKGISLQADPTIKFALKDFGLKRIYEKYLAVQSPYNTYTNKGLPPGPICTPSVETLKEVINAPKTDYIYFVADSDLNGSSVFTSNYKDHMKYAKLYQQALNKQDSIKQARENMQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 128 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 142 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 143 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 144 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 145 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 146 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 147 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 148 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 164 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 167 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 168 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 169 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 170 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.2 |
| Metatranscriptomes | 0 |
| Isolates | 0.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.33 |
| Nodule | 0 |
| Rhizoplane | 0.27 |
| Rhizosphere | 96.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10021375 | 3300003323 | Bacteria | 11386 |
| 2 | Ga0065714_10076655 | 3300005288 | Bacteria | 2769 |
| 3 | Ga0065704_10114337 | 3300005289 | Bacteria | 1893 |
| 4 | Ga0065712_10005108 | 3300005290 | Bacteria | 3959 |
| 5 | Ga0070658_10008410 | 3300005327 | Bacteria | 8297 |
| 6 | Ga0070658_10036387 | 3300005327 | Bacteria | 3968 |
| 7 | Ga0070658_10043984 | 3300005327 | Bacteria | 3608 |
| 8 | Ga0070658_10079891 | 3300005327 | Bacteria | 2686 |
| 9 | Ga0070658_10344770 | 3300005327 | Unclassified | 1274 |
| 10 | Ga0070683_100000211 | 3300005329 | Bacteria | 39486 |
| 11 | Ga0070683_100003981 | 3300005329 | Bacteria | 12096 |
| 12 | Ga0070683_100125343 | 3300005329 | Bacteria | 2428 |
| 13 | Ga0070690_100019967 | 3300005330 | Bacteria | 4077 |
| 14 | Ga0070690_100143780 | 3300005330 | Bacteria | 1621 |
| 15 | Ga0070690_100146515 | 3300005330 | Unclassified | 1607 |
| 16 | Ga0070670_100043976 | 3300005331 | Bacteria | 3840 |
| 17 | Ga0070670_100094499 | 3300005331 | Bacteria | 2571 |
| 18 | Ga0070670_100094938 | 3300005331 | Bacteria | 2565 |
| 19 | Ga0070670_100102221 | 3300005331 | Bacteria | 2468 |
| 20 | Ga0068869_100016129 | 3300005334 | Bacteria | 5031 |
| 21 | Ga0068869_100043864 | 3300005334 | Unclassified | 3215 |
| 22 | Ga0068869_100235880 | 3300005334 | Bacteria | 1455 |
| 23 | Ga0070666_10002600 | 3300005335 | Bacteria | 10892 |
| 24 | Ga0070680_100016888 | 3300005336 | Bacteria | 5745 |
| 25 | Ga0070680_100025265 | 3300005336 | Bacteria | 4746 |
| 26 | Ga0070680_100041019 | 3300005336 | Bacteria | 3752 |
| 27 | Ga0070682_100001184 | 3300005337 | Bacteria | 14886 |
| 28 | Ga0070682_100091336 | 3300005337 | Unclassified | 1993 |
| 29 | Ga0068868_100008958 | 3300005338 | Bacteria | 7180 |
| 30 | Ga0068868_100012580 | 3300005338 | Bacteria | 6188 |
| 31 | Ga0070660_100023036 | 3300005339 | Bacteria | 4611 |
| 32 | Ga0070660_100089040 | 3300005339 | Bacteria | 2432 |
| 33 | Ga0070660_100152552 | 3300005339 | Bacteria | 1858 |
| 34 | Ga0070689_100004082 | 3300005340 | Bacteria | 9834 |
| 35 | Ga0070689_100262164 | 3300005340 | Bacteria | 1429 |
| 36 | Ga0070689_100292646 | 3300005340 | Bacteria | 1353 |
| 37 | Ga0070691_10032536 | 3300005341 | Unclassified | 2450 |
| 38 | Ga0070661_100004977 | 3300005344 | Bacteria | 9153 |
| 39 | Ga0070669_100043293 | 3300005353 | Bacteria | 3278 |
| 40 | Ga0070675_100005185 | 3300005354 | Bacteria | 9936 |
| 41 | Ga0070675_100078766 | 3300005354 | Bacteria | 2745 |
| 42 | Ga0070675_100359161 | 3300005354 | Bacteria | 1293 |
| 43 | Ga0070671_100073189 | 3300005355 | Bacteria | 2862 |
| 44 | Ga0070671_100102273 | 3300005355 | Bacteria | 2404 |
| 45 | Ga0070674_100151917 | 3300005356 | Bacteria | 1748 |
| 46 | Ga0070673_100041322 | 3300005364 | Bacteria | 3546 |
| 47 | Ga0070673_100061030 | 3300005364 | Bacteria | 2989 |
| 48 | Ga0070673_100210194 | 3300005364 | Bacteria | 1680 |
| 49 | Ga0070688_100003172 | 3300005365 | Bacteria | 8420 |
| 50 | Ga0070688_100025164 | 3300005365 | Bacteria | 3522 |
| 51 | Ga0070688_100054822 | 3300005365 | Bacteria | 2498 |
| 52 | Ga0070688_100055470 | 3300005365 | Bacteria | 2485 |
| 53 | Ga0070659_100017471 | 3300005366 | Bacteria | 5402 |
| 54 | Ga0070659_100029805 | 3300005366 | Bacteria | 4218 |
| 55 | Ga0070659_100083202 | 3300005366 | Bacteria | 2558 |
| 56 | Ga0070659_100160579 | 3300005366 | Bacteria | 1837 |
| 57 | Ga0070667_100267922 | 3300005367 | Bacteria | 1531 |
| 58 | Ga0070663_100014614 | 3300005455 | Bacteria | 5044 |
| 59 | Ga0070678_100159763 | 3300005456 | Unclassified | 1824 |
| 60 | Ga0070662_100002740 | 3300005457 | Bacteria | 10892 |
| 61 | Ga0070662_100032018 | 3300005457 | Bacteria | 3695 |
| 62 | Ga0070681_10038610 | 3300005458 | Bacteria | 4787 |
| 63 | Ga0068867_100012240 | 3300005459 | Bacteria | 6064 |
| 64 | Ga0068867_100057445 | 3300005459 | Bacteria | 2882 |
| 65 | Ga0070685_10038976 | 3300005466 | Bacteria | 2697 |
| 66 | Ga0070685_10155728 | 3300005466 | Bacteria | 1452 |
| 67 | Ga0070707_100466875 | 3300005468 | Bacteria | 1223 |
| 68 | Ga0070679_100008525 | 3300005530 | Bacteria | 9657 |
| 69 | Ga0070679_100035544 | 3300005530 | Bacteria | 4943 |
| 70 | Ga0070679_100043059 | 3300005530 | Bacteria | 4497 |
| 71 | Ga0070679_100059125 | 3300005530 | Bacteria | 3820 |
| 72 | Ga0070679_100094989 | 3300005530 | Bacteria | 2969 |
| 73 | Ga0070684_100000568 | 3300005535 | Bacteria | 25497 |
| 74 | Ga0070684_100304437 | 3300005535 | Unclassified | 1463 |
| 75 | Ga0068853_100007326 | 3300005539 | Bacteria | 8830 |
| 76 | Ga0068853_100031245 | 3300005539 | Unclassified | 4504 |
| 77 | Ga0068853_100077770 | 3300005539 | Bacteria | 2899 |
| 78 | Ga0068853_100291035 | 3300005539 | Bacteria | 1508 |
| 79 | Ga0068853_100452645 | 3300005539 | Bacteria | 1207 |
| 80 | Ga0070693_100003857 | 3300005547 | Bacteria | 7026 |
| 81 | Ga0070665_100073574 | 3300005548 | Bacteria | 3423 |
| 82 | Ga0068855_100020250 | 3300005563 | Bacteria | 7985 |
| 83 | Ga0068855_100021324 | 3300005563 | Bacteria | 7770 |
| 84 | Ga0068855_100071679 | 3300005563 | Bacteria | 4028 |
| 85 | Ga0068855_100448395 | 3300005563 | Bacteria | 1408 |
| 86 | Ga0070664_100001475 | 3300005564 | Bacteria | 18739 |
| 87 | Ga0070664_100029557 | 3300005564 | Bacteria | 4569 |
| 88 | Ga0070664_100044587 | 3300005564 | Bacteria | 3745 |
| 89 | Ga0068857_100001702 | 3300005577 | Bacteria | 17680 |
| 90 | Ga0068857_100186025 | 3300005577 | Unclassified | 1891 |
| 91 | Ga0068857_100201748 | 3300005577 | Bacteria | 1813 |
| 92 | Ga0068857_100202271 | 3300005577 | Unclassified | 1811 |
| 93 | Ga0068854_100074676 | 3300005578 | Bacteria | 2487 |
| 94 | Ga0068856_100031637 | 3300005614 | Bacteria | 5178 |
| 95 | Ga0068856_100341322 | 3300005614 | Bacteria | 1516 |
| 96 | Ga0068852_100002617 | 3300005616 | Bacteria | 12436 |
| 97 | Ga0068852_100027499 | 3300005616 | Bacteria | 4636 |
| 98 | Ga0068859_100000186 | 3300005617 | Bacteria | 60206 |
| 99 | Ga0068859_100012688 | 3300005617 | Bacteria | 8472 |
| 100 | Ga0068859_100015578 | 3300005617 | Bacteria | 7640 |
| 101 | Ga0068859_100062636 | 3300005617 | Bacteria | 3750 |
| 102 | Ga0068859_100070605 | 3300005617 | Bacteria | 3528 |
| 103 | Ga0068859_100101819 | 3300005617 | Bacteria | 2929 |
| 104 | Ga0068864_100021211 | 3300005618 | Bacteria | 5441 |
| 105 | Ga0068866_10164939 | 3300005718 | Unclassified | 1295 |
| 106 | Ga0068861_100003143 | 3300005719 | Bacteria | 10914 |
| 107 | Ga0068861_100050719 | 3300005719 | Bacteria | 3148 |
| 108 | Ga0068863_100002992 | 3300005841 | Bacteria | 16703 |
| 109 | Ga0068863_100133973 | 3300005841 | Bacteria | 2366 |
| 110 | Ga0068863_100234916 | 3300005841 | Bacteria | 1769 |
| 111 | Ga0068863_100381478 | 3300005841 | Bacteria | 1376 |
| 112 | Ga0068858_100006813 | 3300005842 | Bacteria | 11115 |
| 113 | Ga0068858_100009912 | 3300005842 | Bacteria | 9050 |
| 114 | Ga0068858_100033527 | 3300005842 | Bacteria | 4764 |
| 115 | Ga0068860_100007278 | 3300005843 | Bacteria | 11071 |
| 116 | Ga0068860_100109905 | 3300005843 | Bacteria | 2634 |
| 117 | Ga0068860_100236193 | 3300005843 | Bacteria | 1777 |
| 118 | Ga0068862_100235784 | 3300005844 | Unclassified | 1661 |
| 119 | Ga0097621_100026043 | 3300006237 | Bacteria | 4584 |
| 120 | Ga0097621_100027647 | 3300006237 | Bacteria | 4463 |
| 121 | Ga0097621_100032016 | 3300006237 | Bacteria | 4177 |
| 122 | Ga0097621_100264799 | 3300006237 | Bacteria | 1509 |
| 123 | Ga0068871_100011135 | 3300006358 | Bacteria | 6594 |
| 124 | Ga0068871_100036404 | 3300006358 | Bacteria | 3919 |
| 125 | Ga0068865_100053974 | 3300006881 | Unclassified | 2790 |
| 126 | Ga0068865_100154890 | 3300006881 | Bacteria | 1742 |
| 127 | Ga0097620_100000186 | 3300006931 | Bacteria | 60206 |
| 128 | Ga0097620_100012688 | 3300006931 | Bacteria | 8472 |
| 129 | Ga0097620_100015579 | 3300006931 | Bacteria | 7640 |
| 130 | Ga0097620_100062636 | 3300006931 | Bacteria | 3750 |
| 131 | Ga0097620_100070605 | 3300006931 | Bacteria | 3528 |
| 132 | Ga0097620_100101815 | 3300006931 | Bacteria | 2929 |
| 133 | Ga0105240_10002244 | 3300009093 | Bacteria | 31388 |
| 134 | Ga0105240_10077907 | 3300009093 | Bacteria | 4083 |
| 135 | Ga0111539_10003454 | 3300009094 | Bacteria | 20812 |
| 136 | Ga0105247_10008274 | 3300009101 | Bacteria | 6347 |
| 137 | Ga0105247_10008423 | 3300009101 | Bacteria | 6283 |
| 138 | Ga0105241_10006152 | 3300009174 | Bacteria | 8848 |
| 139 | Ga0105241_10121601 | 3300009174 | Unclassified | 2103 |
| 140 | Ga0105242_10046111 | 3300009176 | Unclassified | 3535 |
| 141 | Ga0105242_10077363 | 3300009176 | Bacteria | 2775 |
| 142 | Ga0105237_10017999 | 3300009545 | Bacteria | 7320 |
| 143 | Ga0105249_10029458 | 3300009553 | Bacteria | 4958 |
| 144 | Ga0105249_10035187 | 3300009553 | Bacteria | 4541 |
| 145 | Ga0105249_10215614 | 3300009553 | Bacteria | 1886 |
| 146 | Ga0105239_10046154 | 3300010375 | Bacteria | 4773 |
| 147 | Ga0105239_10055013 | 3300010375 | Bacteria | 4364 |
| 148 | Ga0105239_10204231 | 3300010375 | Bacteria | 2214 |
| 149 | Ga0105246_10010026 | 3300011119 | Bacteria | 5845 |
| 150 | Ga0157373_10017978 | 3300013100 | Bacteria | 5148 |
| 151 | Ga0157373_10127293 | 3300013100 | Bacteria | 1791 |
| 152 | Ga0157371_10000318 | 3300013102 | Bacteria | 62463 |
| 153 | Ga0157371_10000656 | 3300013102 | Bacteria | 40997 |
| 154 | Ga0157371_10002847 | 3300013102 | Bacteria | 16159 |
| 155 | Ga0157371_10014831 | 3300013102 | Bacteria | 5867 |
| 156 | Ga0157371_10016729 | 3300013102 | Bacteria | 5464 |
| 157 | Ga0157371_10018394 | 3300013102 | Bacteria | 5166 |
| 158 | Ga0157371_10033147 | 3300013102 | Bacteria | 3713 |
| 159 | Ga0157371_10041477 | 3300013102 | Bacteria | 3283 |
| 160 | Ga0157371_10075890 | 3300013102 | Bacteria | 2380 |
| 161 | Ga0157371_10081834 | 3300013102 | Unclassified | 2286 |
| 162 | Ga0157371_10255264 | 3300013102 | Bacteria | 1263 |
| 163 | Ga0157370_10000795 | 3300013104 | Bacteria | 39727 |
| 164 | Ga0157370_10000916 | 3300013104 | Bacteria | 37388 |
| 165 | Ga0157370_10001221 | 3300013104 | Bacteria | 32173 |
| 166 | Ga0157370_10001314 | 3300013104 | Bacteria | 30974 |
| 167 | Ga0157369_10018092 | 3300013105 | Bacteria | 7904 |
| 168 | Ga0157369_10107989 | 3300013105 | Unclassified | 2960 |
| 169 | Ga0157374_10012169 | 3300013296 | Bacteria | 7476 |
| 170 | Ga0157374_10083999 | 3300013296 | Bacteria | 3026 |
| 171 | Ga0157374_10113242 | 3300013296 | Bacteria | 2611 |
| 172 | Ga0157374_10147054 | 3300013296 | Bacteria | 2289 |
| 173 | Ga0157378_10033743 | 3300013297 | Bacteria | 4526 |
| 174 | Ga0157378_10098293 | 3300013297 | Bacteria | 2669 |
| 175 | Ga0157378_10255949 | 3300013297 | Bacteria | 1678 |
| 176 | Ga0157378_10530638 | 3300013297 | Bacteria | 1180 |
| 177 | Ga0163162_10004586 | 3300013306 | Bacteria | 13309 |
| 178 | Ga0163162_10006332 | 3300013306 | Bacteria | 11462 |
| 179 | Ga0163162_10032092 | 3300013306 | Bacteria | 5214 |
| 180 | Ga0163162_10065552 | 3300013306 | Bacteria | 3679 |
| 181 | Ga0163162_10153822 | 3300013306 | Bacteria | 2419 |
| 182 | Ga0163162_10213237 | 3300013306 | Bacteria | 2061 |
| 183 | Ga0163162_10416009 | 3300013306 | Bacteria | 1476 |
| 184 | Ga0157372_10009417 | 3300013307 | Bacteria | 10391 |
| 185 | Ga0157372_10027286 | 3300013307 | Bacteria | 6217 |
| 186 | Ga0157372_10028710 | 3300013307 | Bacteria | 6073 |
| 187 | Ga0157372_10052136 | 3300013307 | Bacteria | 4554 |
| 188 | Ga0157372_10056081 | 3300013307 | Bacteria | 4402 |
| 189 | Ga0157372_10076899 | 3300013307 | Bacteria | 3769 |
| 190 | Ga0157372_10085072 | 3300013307 | Bacteria | 3586 |
| 191 | Ga0157372_10092796 | 3300013307 | Bacteria | 3435 |
| 192 | Ga0157372_10239553 | 3300013307 | Bacteria | 2105 |
| 193 | Ga0157375_10005137 | 3300013308 | Bacteria | 11365 |
| 194 | Ga0157375_10008784 | 3300013308 | Bacteria | 8854 |
| 195 | Ga0157375_10012199 | 3300013308 | Bacteria | 7617 |
| 196 | Ga0157375_10038974 | 3300013308 | Bacteria | 4568 |
| 197 | Ga0157375_10153458 | 3300013308 | Bacteria | 2440 |
| 198 | Ga0163163_10000462 | 3300014325 | Bacteria | 37124 |
| 199 | Ga0163163_10281234 | 3300014325 | Bacteria | 1715 |
| 200 | Ga0157380_10001175 | 3300014326 | Bacteria | 16963 |
| 201 | Ga0157377_10012210 | 3300014745 | Bacteria | 4314 |
| 202 | Ga0157377_10014418 | 3300014745 | Bacteria | 4022 |
| 203 | Ga0157377_10133567 | 3300014745 | Bacteria | 1518 |
| 204 | Ga0157379_10083882 | 3300014968 | Unclassified | 2856 |
| 205 | Ga0157376_10019448 | 3300014969 | Bacteria | 5235 |
| 206 | Ga0157376_10022999 | 3300014969 | Bacteria | 4870 |
| 207 | Ga0157376_10084675 | 3300014969 | Bacteria | 2730 |
| 208 | Ga0157376_10108796 | 3300014969 | Bacteria | 2436 |
| 209 | Ga0157376_10166843 | 3300014969 | Unclassified | 2001 |
| 210 | Ga0157376_10308551 | 3300014969 | Bacteria | 1500 |
| 211 | Ga0163161_10055618 | 3300017792 | Bacteria | 2873 |
| 212 | Ga0163161_10061115 | 3300017792 | Unclassified | 2742 |
| 213 | Ga0163161_10062533 | 3300017792 | Unclassified | 2712 |
| 214 | Ga0163161_10317990 | 3300017792 | Bacteria | 1230 |
| 215 | Ga0207710_10003698 | 3300025900 | Bacteria | 6780 |
| 216 | Ga0207710_10012990 | 3300025900 | Bacteria | 3507 |
| 217 | Ga0207680_10104297 | 3300025903 | Bacteria | 1827 |
| 218 | Ga0207647_10013381 | 3300025904 | Bacteria | 5690 |
| 219 | Ga0207647_10058434 | 3300025904 | Bacteria | 2362 |
| 220 | Ga0207705_10018554 | 3300025909 | Bacteria | 4973 |
| 221 | Ga0207705_10039922 | 3300025909 | Bacteria | 3364 |
| 222 | Ga0207705_10059637 | 3300025909 | Bacteria | 2754 |
| 223 | Ga0207705_10142231 | 3300025909 | Bacteria | 1792 |
| 224 | Ga0207705_10143214 | 3300025909 | Bacteria | 1786 |
| 225 | Ga0207707_10012595 | 3300025912 | Bacteria | 7349 |
| 226 | Ga0207707_10090822 | 3300025912 | Bacteria | 2669 |
| 227 | Ga0207695_10011412 | 3300025913 | Bacteria | 10769 |
| 228 | Ga0207695_10078177 | 3300025913 | Bacteria | 3357 |
| 229 | Ga0207695_10195741 | 3300025913 | Unclassified | 1937 |
| 230 | Ga0207671_10184078 | 3300025914 | Unclassified | 1626 |
| 231 | Ga0207660_10008625 | 3300025917 | Bacteria | 6593 |
| 232 | Ga0207660_10030171 | 3300025917 | Bacteria | 3726 |
| 233 | Ga0207660_10033634 | 3300025917 | Bacteria | 3548 |
| 234 | Ga0207660_10035020 | 3300025917 | Bacteria | 3483 |
| 235 | Ga0207660_10120136 | 3300025917 | Bacteria | 1989 |
| 236 | Ga0207657_10005296 | 3300025919 | Bacteria | 13515 |
| 237 | Ga0207657_10053889 | 3300025919 | Bacteria | 3482 |
| 238 | Ga0207657_10097533 | 3300025919 | Bacteria | 2444 |
| 239 | Ga0207657_10208763 | 3300025919 | Bacteria | 1568 |
| 240 | Ga0207657_10220101 | 3300025919 | Unclassified | 1521 |
| 241 | Ga0207649_10001781 | 3300025920 | Bacteria | 12322 |
| 242 | Ga0207652_10000016 | 3300025921 | Bacteria | 188815 |
| 243 | Ga0207652_10000171 | 3300025921 | Bacteria | 69902 |
| 244 | Ga0207652_10000739 | 3300025921 | Bacteria | 31538 |
| 245 | Ga0207652_10014701 | 3300025921 | Bacteria | 6344 |
| 246 | Ga0207652_10021964 | 3300025921 | Bacteria | 5272 |
| 247 | Ga0207652_10029365 | 3300025921 | Bacteria | 4596 |
| 248 | Ga0207681_10031304 | 3300025923 | Bacteria | 3474 |
| 249 | Ga0207650_10040821 | 3300025925 | Unclassified | 3397 |
| 250 | Ga0207659_10058014 | 3300025926 | Bacteria | 2778 |
| 251 | Ga0207659_10098247 | 3300025926 | Bacteria | 2201 |
| 252 | Ga0207687_10200472 | 3300025927 | Bacteria | 1559 |
| 253 | Ga0207690_10016583 | 3300025932 | Bacteria | 4486 |
| 254 | Ga0207690_10065477 | 3300025932 | Bacteria | 2485 |
| 255 | Ga0207690_10122942 | 3300025932 | Bacteria | 1888 |
| 256 | Ga0207706_10003848 | 3300025933 | Bacteria | 14295 |
| 257 | Ga0207670_10011502 | 3300025936 | Bacteria | 5143 |
| 258 | Ga0207670_10021624 | 3300025936 | Bacteria | 3973 |
| 259 | Ga0207670_10102251 | 3300025936 | Unclassified | 2048 |
| 260 | Ga0207704_10029667 | 3300025938 | Bacteria | 3055 |
| 261 | Ga0207691_10050518 | 3300025940 | Bacteria | 3806 |
| 262 | Ga0207689_10003166 | 3300025942 | Bacteria | 15084 |
| 263 | Ga0207689_10003496 | 3300025942 | Bacteria | 14357 |
| 264 | Ga0207689_10005595 | 3300025942 | Bacteria | 11200 |
| 265 | Ga0207689_10056265 | 3300025942 | Bacteria | 3236 |
| 266 | Ga0207689_10058714 | 3300025942 | Unclassified | 3164 |
| 267 | Ga0207661_10000688 | 3300025944 | Bacteria | 21928 |
| 268 | Ga0207661_10094009 | 3300025944 | Bacteria | 2503 |
| 269 | Ga0207661_10164698 | 3300025944 | Bacteria | 1926 |
| 270 | Ga0207679_10000391 | 3300025945 | Bacteria | 31474 |
| 271 | Ga0207667_10000539 | 3300025949 | Bacteria | 49978 |
| 272 | Ga0207667_10020979 | 3300025949 | Bacteria | 7246 |
| 273 | Ga0207667_10023424 | 3300025949 | Bacteria | 6799 |
| 274 | Ga0207667_10026698 | 3300025949 | Bacteria | 6303 |
| 275 | Ga0207712_10008681 | 3300025961 | Bacteria | 6427 |
| 276 | Ga0207712_10018495 | 3300025961 | Bacteria | 4540 |
| 277 | Ga0207712_10158219 | 3300025961 | Bacteria | 1757 |
| 278 | Ga0207668_10214169 | 3300025972 | Bacteria | 1542 |
| 279 | Ga0207640_10040775 | 3300025981 | Unclassified | 2948 |
| 280 | Ga0207658_10103401 | 3300025986 | Bacteria | 2236 |
| 281 | Ga0207658_10187250 | 3300025986 | Bacteria | 1718 |
| 282 | Ga0207658_10203834 | 3300025986 | Bacteria | 1653 |
| 283 | Ga0207677_10008332 | 3300026023 | Bacteria | 5783 |
| 284 | Ga0207677_10159513 | 3300026023 | Bacteria | 1751 |
| 285 | Ga0207639_10003619 | 3300026041 | Bacteria | 10380 |
| 286 | Ga0207639_10023014 | 3300026041 | Unclassified | 4494 |
| 287 | Ga0207639_10345180 | 3300026041 | Bacteria | 1328 |
| 288 | Ga0207678_10055656 | 3300026067 | Bacteria | 3407 |
| 289 | Ga0207678_10112120 | 3300026067 | Bacteria | 2326 |
| 290 | Ga0207702_10033398 | 3300026078 | Bacteria | 4297 |
| 291 | Ga0207641_10000194 | 3300026088 | Bacteria | 82153 |
| 292 | Ga0207641_10190241 | 3300026088 | Bacteria | 1886 |
| 293 | Ga0207648_10028275 | 3300026089 | Bacteria | 4972 |
| 294 | Ga0207648_10044593 | 3300026089 | Unclassified | 3890 |
| 295 | Ga0207648_10110406 | 3300026089 | Bacteria | 2414 |
| 296 | Ga0207648_10151774 | 3300026089 | Bacteria | 2044 |
| 297 | Ga0207676_10002355 | 3300026095 | Bacteria | 13499 |
| 298 | Ga0207676_10035863 | 3300026095 | Bacteria | 3769 |
| 299 | Ga0207676_10038323 | 3300026095 | Unclassified | 3657 |
| 300 | Ga0207674_10001890 | 3300026116 | Bacteria | 26652 |
| 301 | Ga0207674_10011135 | 3300026116 | Bacteria | 10115 |
| 302 | Ga0207674_10024390 | 3300026116 | Bacteria | 6465 |
| 303 | Ga0207674_10038548 | 3300026116 | Bacteria | 4957 |
| 304 | Ga0207674_10331552 | 3300026116 | Unclassified | 1471 |
| 305 | Ga0207675_100000359 | 3300026118 | Bacteria | 43729 |
| 306 | Ga0207675_100066529 | 3300026118 | Bacteria | 3369 |
| 307 | Ga0207683_10019477 | 3300026121 | Bacteria | 5794 |
| 308 | Ga0207698_10001651 | 3300026142 | Bacteria | 13013 |
| 309 | Ga0207428_10008958 | 3300027907 | Bacteria | 9014 |
| 310 | Ga0268266_10026586 | 3300028379 | Unclassified | 4925 |
| 311 | Ga0268266_10099447 | 3300028379 | Bacteria | 2561 |
| 312 | Ga0268265_10009168 | 3300028380 | Bacteria | 6688 |
| 313 | Ga0268264_10005141 | 3300028381 | Bacteria | 11086 |
| 314 | Ga0268264_10006854 | 3300028381 | Bacteria | 9564 |
| 315 | Ga0268264_10034681 | 3300028381 | Bacteria | 4152 |
| 316 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 317 | Ga0307512_10044885 | 3300030522 | Bacteria | 3627 |
| 318 | Ga0265327_10000440 | 3300031251 | Bacteria | 75453 |
| 319 | Ga0307509_10044028 | 3300031507 | Bacteria | 4824 |
| 320 | Ga0307414_10127422 | 3300032004 | Bacteria | 1970 |
| 321 | Ga0373943_0061252 | 3300035170 | Bacteria | 1881 |
| 322 | Ga0373955_0043158 | 3300035172 | Bacteria | 2425 |
| 323 | Ga0373947_0121752 | 3300035725 | Bacteria | 1658 |
| 324 | Ga0373937_0405762 | 3300036401 | Unclassified | 1293 |
| 325 | Ga0373925_0079620 | 3300037068 | Unclassified | 2490 |
| 326 | Ga0395899_0011529 | 3300037312 | Bacteria | 6767 |
| 327 | Ga0395899_0013887 | 3300037312 | Bacteria | 6152 |
| 328 | Ga0395899_0247487 | 3300037312 | Bacteria | 1224 |
| 329 | Ga0395900_0018416 | 3300037418 | Bacteria | 7122 |
| 330 | Ga0395900_0032385 | 3300037418 | Bacteria | 5376 |
| 331 | Ga0395900_0038608 | 3300037418 | Bacteria | 4922 |
| 332 | Ga0395900_0148974 | 3300037418 | Unclassified | 2391 |
| 333 | Ga0395900_0194673 | 3300037418 | Bacteria | 2054 |
| 334 | Ga0395900_0586786 | 3300037418 | Bacteria | 1056 |
| 335 | Ga0395898_0007047 | 3300037466 | Bacteria | 11946 |
| 336 | Ga0395898_0029934 | 3300037466 | Bacteria | 5450 |
| 337 | Ga0395898_0118591 | 3300037466 | Bacteria | 2535 |
| 338 | Ga0395898_0224326 | 3300037466 | Bacteria | 1792 |
| 339 | Ga0395905_0005098 | 3300037471 | Bacteria | 13502 |
| 340 | Ga0395901_0012025 | 3300038443 | Bacteria | 8780 |
| 341 | Ga0395901_0016817 | 3300038443 | Bacteria | 7454 |
| 342 | Ga0395901_0112626 | 3300038443 | Bacteria | 2857 |
| 343 | Ga0439436_0014476 | 3300041404 | Bacteria | 2378 |
| 344 | Ga0439466_0028479 | 3300041411 | Bacteria | 1929 |
| 345 | Ga0451843_1472935 | 3300041509 | Bacteria | 1129 |
| 346 | Ga0451853_1888965 | 3300041512 | Bacteria | 2104 |
| 347 | Ga0439442_009487 | 3300042002 | Bacteria | 1969 |
| 348 | Ga0439457_000268 | 3300042014 | Bacteria | 14301 |
| 349 | Ga0439434_0030213 | 3300042435 | Bacteria | 1644 |
| 350 | Ga0466969_0000091 | 3300044656 | Bacteria | 46523 |
| 351 | Ga0466964_0005934 | 3300044706 | Bacteria | 4549 |
| 352 | Ga0466968_0049820 | 3300044735 | Unclassified | 1785 |
| 353 | Ga0466957_0000460 | 3300044842 | Bacteria | 20175 |
| 354 | Ga0495653_0070640 | 3300046463 | Bacteria | 2613 |
| 355 | Ga0495628_0006489 | 3300046516 | Bacteria | 10215 |
| 356 | Ga0495630_0038442 | 3300046517 | Bacteria | 3579 |
| 357 | Ga0495587_0085501 | 3300046536 | Unclassified | 1826 |
| 358 | Ga0495668_0001051 | 3300046616 | Bacteria | 29297 |
| 359 | Ga0495635_0137088 | 3300046663 | Bacteria | 1668 |
| 360 | Ga0495604_0097861 | 3300047317 | Bacteria | 2163 |
| 361 | Ga0495676_0120553 | 3300047321 | Bacteria | 1909 |
| 362 | Ga0495676_0165621 | 3300047321 | Bacteria | 1560 |
| 363 | Ga0496110_0274859 | 3300048913 | Bacteria | 1534 |
| 364 | Ga0501034_0000017 | 3300049571 | Bacteria | 285938 |
| 365 | Ga0501034_0162787 | 3300049571 | Bacteria | 2201 |
| 366 | Ga0501070_0143939 | 3300049586 | Bacteria | 1968 |
| 367 | Ga0501225_0001093 | 3300049705 | Bacteria | 8507 |
| 368 | Ga0501044_0060128 | 3300049823 | Bacteria | 3892 |
| 369 | nmdc:mga08y16_3350_c1 | 3300050511 | Bacteria | 16593 |
| 370 | Ga0500578_0000019 | 3300053086 | Bacteria | 169042 |
| 371 | Ga0500644_0002938 | 3300053088 | Bacteria | 4231 |
| 372 | Ga0500646_0037618 | 3300053090 | Bacteria | 1352 |
| 373 | Ga0500650_0096128 | 3300053098 | Bacteria | 1387 |
| 374 | Ga0500611_000092 | 3300053727 | Bacteria | 25966 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013100 | Ga0157373_10127293 | Ga0157373_101272931 | 303 |
| 2 | 3300013102 | Ga0157371_10002847 | Ga0157371_100028475 | 303 |
| 3 | 3300013307 | Ga0157372_10056081 | Ga0157372_100560812 | 303 |
| 4 | 3300026089 | Ga0207648_10044593 | Ga0207648_100445935 | 308 |
| 5 | 3300037418 | Ga0395900_0586786 | Ga0395900_0586786_53_1030 | 312 |
| 6 | 3300013296 | Ga0157374_10147054 | Ga0157374_101470542 | 317 |
| 7 | 3300037312 | Ga0395899_0247487 | Ga0395899_0247487_129_1154 | 318 |
| 8 | 3300037418 | Ga0395900_0194673 | Ga0395900_0194673_21_1046 | 318 |
| 9 | 3300013306 | Ga0163162_10213237 | Ga0163162_102132371 | 320 |
| 10 | 3300047321 | Ga0495676_0120553 | Ga0495676_0120553_360_1391 | 320 |
| 11 | 3300005539 | Ga0068853_100452645 | Ga0068853_1004526451 | 322 |
| 12 | 3300026041 | Ga0207639_10345180 | Ga0207639_103451801 | 322 |
| 13 | 3300035170 | Ga0373943_0061252 | Ga0373943_0061252_116_1147 | 323 |
| 14 | 3300035725 | Ga0373947_0121752 | Ga0373947_0121752_68_1099 | 323 |
| 15 | 3300013102 | Ga0157371_10014831 | Ga0157371_100148314 | 325 |
| 16 | 3300005539 | Ga0068853_100291035 | Ga0068853_1002910351 | 326 |
| 17 | 3300053090 | Ga0500646_0037618 | Ga0500646_0037618_210_1199 | 326 |
| 18 | 3300005458 | Ga0070681_10038610 | Ga0070681_100386103 | 328 |
| 19 | 3300035172 | Ga0373955_0043158 | Ga0373955_0043158_613_1719 | 328 |
| 20 | 3300037068 | Ga0373925_0079620 | Ga0373925_0079620_263_1369 | 328 |
| 21 | 3300046463 | Ga0495653_0070640 | Ga0495653_0070640_1120_2226 | 328 |
| 22 | 3300046516 | Ga0495628_0006489 | Ga0495628_0006489_5817_6923 | 328 |
| 23 | 3300046517 | Ga0495630_0038442 | Ga0495630_0038442_608_1714 | 328 |
| 24 | 3300046536 | Ga0495587_0085501 | Ga0495587_0085501_606_1712 | 328 |
| 25 | 3300046663 | Ga0495635_0137088 | Ga0495635_0137088_438_1544 | 328 |
| 26 | 3300005841 | Ga0068863_100381478 | Ga0068863_1003814782 | 329 |
| 27 | 3300005843 | Ga0068860_100007278 | Ga0068860_10000727810 | 329 |
| 28 | 3300009176 | Ga0105242_10077363 | Ga0105242_100773633 | 329 |
| 29 | 3300013307 | Ga0157372_10027286 | Ga0157372_100272864 | 329 |
| 30 | 3300026089 | Ga0207648_10110406 | Ga0207648_101104063 | 329 |
| 31 | 3300028381 | Ga0268264_10005141 | Ga0268264_1000514110 | 329 |
| 32 | 3300037418 | Ga0395900_0032385 | Ga0395900_0032385_878_1903 | 329 |
| 33 | 3300037466 | Ga0395898_0224326 | Ga0395898_0224326_64_1089 | 329 |
| 34 | 3300037471 | Ga0395905_0005098 | Ga0395905_0005098_11600_12625 | 329 |
| 35 | 3300038443 | Ga0395901_0012025 | Ga0395901_0012025_1268_2293 | 329 |
| 36 | 3300049571 | Ga0501034_0000017 | Ga0501034_0000017_39281_40309 | 329 |
| 37 | 3300005327 | Ga0070658_10008410 | Ga0070658_100084107 | 330 |
| 38 | 3300005366 | Ga0070659_100083202 | Ga0070659_1000832023 | 330 |
| 39 | 3300005459 | Ga0068867_100057445 | Ga0068867_1000574452 | 330 |
| 40 | 3300005618 | Ga0068864_100021211 | Ga0068864_1000212116 | 330 |
| 41 | 3300009545 | Ga0105237_10017999 | Ga0105237_100179997 | 330 |
| 42 | 3300025912 | Ga0207707_10090822 | Ga0207707_100908222 | 330 |
| 43 | 3300025932 | Ga0207690_10122942 | Ga0207690_101229422 | 330 |
| 44 | 3300026067 | Ga0207678_10112120 | Ga0207678_101121202 | 330 |
| 45 | 3300026095 | Ga0207676_10038323 | Ga0207676_100383231 | 330 |
| 46 | 3300005530 | Ga0070679_100094989 | Ga0070679_1000949892 | 331 |
| 47 | 3300006237 | Ga0097621_100264799 | Ga0097621_1002647991 | 331 |
| 48 | 3300006358 | Ga0068871_100036404 | Ga0068871_1000364043 | 331 |
| 49 | 3300006881 | Ga0068865_100053974 | Ga0068865_1000539742 | 331 |
| 50 | 3300009101 | Ga0105247_10008274 | Ga0105247_100082746 | 331 |
| 51 | 3300009553 | Ga0105249_10029458 | Ga0105249_100294584 | 331 |
| 52 | 3300010375 | Ga0105239_10055013 | Ga0105239_100550136 | 331 |
| 53 | 3300013102 | Ga0157371_10018394 | Ga0157371_100183944 | 331 |
| 54 | 3300013306 | Ga0163162_10006332 | Ga0163162_100063324 | 331 |
| 55 | 3300013307 | Ga0157372_10028710 | Ga0157372_100287105 | 331 |
| 56 | 3300013308 | Ga0157375_10038974 | Ga0157375_100389742 | 331 |
| 57 | 3300014969 | Ga0157376_10084675 | Ga0157376_100846752 | 331 |
| 58 | 3300014969 | Ga0157376_10308551 | Ga0157376_103085512 | 331 |
| 59 | 3300047321 | Ga0495676_0165621 | Ga0495676_0165621_290_1333 | 331 |
| 60 | 3300005336 | Ga0070680_100016888 | Ga0070680_1000168884 | 332 |
| 61 | 3300005339 | Ga0070660_100152552 | Ga0070660_1001525522 | 332 |
| 62 | 3300005366 | Ga0070659_100017471 | Ga0070659_1000174717 | 332 |
| 63 | 3300005457 | Ga0070662_100002740 | Ga0070662_1000027405 | 332 |
| 64 | 3300005530 | Ga0070679_100035544 | Ga0070679_1000355443 | 332 |
| 65 | 3300005563 | Ga0068855_100071679 | Ga0068855_1000716794 | 332 |
| 66 | 3300013100 | Ga0157373_10017978 | Ga0157373_100179785 | 332 |
| 67 | 3300013102 | Ga0157371_10075890 | Ga0157371_100758902 | 332 |
| 68 | 3300013307 | Ga0157372_10076899 | Ga0157372_100768993 | 332 |
| 69 | 3300025917 | Ga0207660_10033634 | Ga0207660_100336342 | 332 |
| 70 | 3300025919 | Ga0207657_10220101 | Ga0207657_102201012 | 332 |
| 71 | 3300025921 | Ga0207652_10029365 | Ga0207652_100293654 | 332 |
| 72 | 3300025949 | Ga0207667_10020979 | Ga0207667_100209794 | 332 |
| 73 | 3300026116 | Ga0207674_10024390 | Ga0207674_100243905 | 332 |
| 74 | 3300005289 | Ga0065704_10114337 | Ga0065704_101143373 | 333 |
| 75 | 3300005290 | Ga0065712_10005108 | Ga0065712_100051082 | 333 |
| 76 | 3300005330 | Ga0070690_100146515 | Ga0070690_1001465152 | 333 |
| 77 | 3300005331 | Ga0070670_100094499 | Ga0070670_1000944992 | 333 |
| 78 | 3300005353 | Ga0070669_100043293 | Ga0070669_1000432932 | 333 |
| 79 | 3300005354 | Ga0070675_100005185 | Ga0070675_10000518510 | 333 |
| 80 | 3300005365 | Ga0070688_100003172 | Ga0070688_1000031726 | 333 |
| 81 | 3300005366 | Ga0070659_100160579 | Ga0070659_1001605793 | 333 |
| 82 | 3300005563 | Ga0068855_100448395 | Ga0068855_1004483951 | 333 |
| 83 | 3300005577 | Ga0068857_100201748 | Ga0068857_1002017481 | 333 |
| 84 | 3300005577 | Ga0068857_100202271 | Ga0068857_1002022711 | 333 |
| 85 | 3300005617 | Ga0068859_100070605 | Ga0068859_1000706053 | 333 |
| 86 | 3300005719 | Ga0068861_100003143 | Ga0068861_1000031437 | 333 |
| 87 | 3300005844 | Ga0068862_100235784 | Ga0068862_1002357842 | 333 |
| 88 | 3300006931 | Ga0097620_100070605 | Ga0097620_1000706053 | 333 |
| 89 | 3300009094 | Ga0111539_10003454 | Ga0111539_1000345411 | 333 |
| 90 | 3300009553 | Ga0105249_10035187 | Ga0105249_100351875 | 333 |
| 91 | 3300013306 | Ga0163162_10065552 | Ga0163162_100655523 | 333 |
| 92 | 3300013308 | Ga0157375_10005137 | Ga0157375_1000513711 | 333 |
| 93 | 3300014326 | Ga0157380_10001175 | Ga0157380_100011758 | 333 |
| 94 | 3300025923 | Ga0207681_10031304 | Ga0207681_100313043 | 333 |
| 95 | 3300025925 | Ga0207650_10040821 | Ga0207650_100408214 | 333 |
| 96 | 3300025926 | Ga0207659_10098247 | Ga0207659_100982473 | 333 |
| 97 | 3300025961 | Ga0207712_10018495 | Ga0207712_100184952 | 333 |
| 98 | 3300026116 | Ga0207674_10011135 | Ga0207674_100111351 | 333 |
| 99 | 3300026118 | Ga0207675_100000359 | Ga0207675_10000035925 | 333 |
| 100 | 3300027907 | Ga0207428_10008958 | Ga0207428_100089586 | 333 |
| 101 | 3300028380 | Ga0268265_10009168 | Ga0268265_100091687 | 333 |
| 102 | 3300032004 | Ga0307414_10127422 | Ga0307414_101274222 | 333 |
| 103 | 3300041411 | Ga0439466_0028479 | Ga0439466_0028479_33_1043 | 333 |
| 104 | 3300042002 | Ga0439442_009487 | Ga0439442_009487_660_1670 | 333 |
| 105 | 3300042435 | Ga0439434_0030213 | Ga0439434_0030213_600_1610 | 333 |
| 106 | 3300050511 | nmdc:mga08y16_3350_c1 | nmdc:mga08y16_3350_c1_10221_11228 | 333 |
| 107 | iso_pu_bacteria | 2818991444 | 2819587164 | 333 |
| 108 | iso_pu_bacteria | 2914759650 | 2914763693 | 333 |
| 109 | 3300005330 | Ga0070690_100143780 | Ga0070690_1001437801 | 334 |
| 110 | 3300005337 | Ga0070682_100001184 | Ga0070682_10000118413 | 334 |
| 111 | 3300005455 | Ga0070663_100014614 | Ga0070663_1000146144 | 334 |
| 112 | 3300005530 | Ga0070679_100008525 | Ga0070679_1000085254 | 334 |
| 113 | 3300013297 | Ga0157378_10255949 | Ga0157378_102559492 | 334 |
| 114 | 3300017792 | Ga0163161_10317990 | Ga0163161_103179901 | 334 |
| 115 | 3300025909 | Ga0207705_10142231 | Ga0207705_101422312 | 334 |
| 116 | 3300025919 | Ga0207657_10097533 | Ga0207657_100975331 | 334 |
| 117 | 3300025921 | Ga0207652_10000739 | Ga0207652_1000073924 | 334 |
| 118 | 3300026142 | Ga0207698_10001651 | Ga0207698_1000165110 | 334 |
| 119 | 3300053727 | Ga0500611_000092 | Ga0500611_000092_4961_6004 | 334 |
| 120 | 3300005334 | Ga0068869_100235880 | Ga0068869_1002358802 | 335 |
| 121 | 3300005617 | Ga0068859_100000186 | Ga0068859_1000001867 | 335 |
| 122 | 3300005617 | Ga0068859_100062636 | Ga0068859_1000626362 | 335 |
| 123 | 3300005841 | Ga0068863_100002992 | Ga0068863_1000029923 | 335 |
| 124 | 3300005842 | Ga0068858_100006813 | Ga0068858_1000068139 | 335 |
| 125 | 3300005843 | Ga0068860_100109905 | Ga0068860_1001099052 | 335 |
| 126 | 3300006931 | Ga0097620_100000186 | Ga0097620_10000018654 | 335 |
| 127 | 3300006931 | Ga0097620_100062636 | Ga0097620_1000626362 | 335 |
| 128 | 3300009093 | Ga0105240_10077907 | Ga0105240_100779073 | 335 |
| 129 | 3300013297 | Ga0157378_10530638 | Ga0157378_105306381 | 335 |
| 130 | 3300025900 | Ga0207710_10012990 | Ga0207710_100129904 | 335 |
| 131 | 3300025913 | Ga0207695_10078177 | Ga0207695_100781773 | 335 |
| 132 | 3300025927 | Ga0207687_10200472 | Ga0207687_102004722 | 335 |
| 133 | 3300025936 | Ga0207670_10102251 | Ga0207670_101022512 | 335 |
| 134 | 3300025942 | Ga0207689_10005595 | Ga0207689_100055957 | 335 |
| 135 | 3300026088 | Ga0207641_10000194 | Ga0207641_100001947 | 335 |
| 136 | 3300028381 | Ga0268264_10034681 | Ga0268264_100346812 | 335 |
| 137 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011313 | 335 |
| 138 | 3300031251 | Ga0265327_10000440 | Ga0265327_1000044026 | 335 |
| 139 | 3300041404 | Ga0439436_0014476 | Ga0439436_0014476_959_1966 | 335 |
| 140 | 3300042014 | Ga0439457_000268 | Ga0439457_000268_7023_8030 | 335 |
| 141 | 3300053088 | Ga0500644_0002938 | Ga0500644_0002938_2235_3242 | 335 |
| 142 | 3300053098 | Ga0500650_0096128 | Ga0500650_0096128_234_1241 | 335 |
| 143 | 3300013104 | Ga0157370_10000795 | Ga0157370_1000079514 | 336 |
| 144 | 3300005718 | Ga0068866_10164939 | Ga0068866_101649391 | 337 |
| 145 | 3300025942 | Ga0207689_10056265 | Ga0207689_100562652 | 337 |
| 146 | 3300005617 | Ga0068859_100015578 | Ga0068859_1000155786 | 338 |
| 147 | 3300006931 | Ga0097620_100015579 | Ga0097620_1000155796 | 338 |
| 148 | 3300009101 | Ga0105247_10008423 | Ga0105247_100084237 | 338 |
| 149 | 3300025900 | Ga0207710_10003698 | Ga0207710_100036988 | 338 |
| 150 | 3300025961 | Ga0207712_10008681 | Ga0207712_100086814 | 338 |
| 151 | 3300026095 | Ga0207676_10035863 | Ga0207676_100358635 | 338 |
| 152 | 3300028381 | Ga0268264_10006854 | Ga0268264_100068546 | 338 |
| 153 | 3300005288 | Ga0065714_10076655 | Ga0065714_100766553 | 339 |
| 154 | 3300005327 | Ga0070658_10043984 | Ga0070658_100439843 | 339 |
| 155 | 3300005329 | Ga0070683_100125343 | Ga0070683_1001253433 | 339 |
| 156 | 3300005331 | Ga0070670_100094938 | Ga0070670_1000949382 | 339 |
| 157 | 3300005336 | Ga0070680_100041019 | Ga0070680_1000410194 | 339 |
| 158 | 3300005337 | Ga0070682_100091336 | Ga0070682_1000913362 | 339 |
| 159 | 3300005339 | Ga0070660_100023036 | Ga0070660_1000230363 | 339 |
| 160 | 3300005339 | Ga0070660_100089040 | Ga0070660_1000890401 | 339 |
| 161 | 3300005539 | Ga0068853_100077770 | Ga0068853_1000777703 | 339 |
| 162 | 3300005616 | Ga0068852_100002617 | Ga0068852_1000026173 | 339 |
| 163 | 3300013102 | Ga0157371_10000318 | Ga0157371_1000031848 | 339 |
| 164 | 3300013102 | Ga0157371_10016729 | Ga0157371_100167296 | 339 |
| 165 | 3300013102 | Ga0157371_10033147 | Ga0157371_100331473 | 339 |
| 166 | 3300013102 | Ga0157371_10255264 | Ga0157371_102552641 | 339 |
| 167 | 3300013105 | Ga0157369_10018092 | Ga0157369_100180924 | 339 |
| 168 | 3300013297 | Ga0157378_10098293 | Ga0157378_100982933 | 339 |
| 169 | 3300013307 | Ga0157372_10052136 | Ga0157372_100521365 | 339 |
| 170 | 3300013307 | Ga0157372_10239553 | Ga0157372_102395532 | 339 |
| 171 | 3300014325 | Ga0163163_10281234 | Ga0163163_102812342 | 339 |
| 172 | 3300025904 | Ga0207647_10058434 | Ga0207647_100584342 | 339 |
| 173 | 3300025917 | Ga0207660_10030171 | Ga0207660_100301715 | 339 |
| 174 | 3300025917 | Ga0207660_10120136 | Ga0207660_101201363 | 339 |
| 175 | 3300025919 | Ga0207657_10005296 | Ga0207657_100052963 | 339 |
| 176 | 3300025919 | Ga0207657_10053889 | Ga0207657_100538894 | 339 |
| 177 | 3300025921 | Ga0207652_10021964 | Ga0207652_100219642 | 339 |
| 178 | 3300025944 | Ga0207661_10164698 | Ga0207661_101646981 | 339 |
| 179 | 3300049571 | Ga0501034_0162787 | Ga0501034_0162787_27_1058 | 339 |
| 180 | 3300049586 | Ga0501070_0143939 | Ga0501070_0143939_16_1047 | 339 |
| 181 | 3300049823 | Ga0501044_0060128 | Ga0501044_0060128_845_1876 | 339 |
| 182 | 3300005327 | Ga0070658_10344770 | Ga0070658_103447701 | 340 |
| 183 | 3300005329 | Ga0070683_100000211 | Ga0070683_10000021123 | 340 |
| 184 | 3300005329 | Ga0070683_100003981 | Ga0070683_10000398111 | 340 |
| 185 | 3300005330 | Ga0070690_100019967 | Ga0070690_1000199673 | 340 |
| 186 | 3300005331 | Ga0070670_100102221 | Ga0070670_1001022213 | 340 |
| 187 | 3300005334 | Ga0068869_100016129 | Ga0068869_1000161293 | 340 |
| 188 | 3300005334 | Ga0068869_100043864 | Ga0068869_1000438643 | 340 |
| 189 | 3300005335 | Ga0070666_10002600 | Ga0070666_100026005 | 340 |
| 190 | 3300005336 | Ga0070680_100025265 | Ga0070680_1000252653 | 340 |
| 191 | 3300005338 | Ga0068868_100008958 | Ga0068868_1000089583 | 340 |
| 192 | 3300005338 | Ga0068868_100012580 | Ga0068868_1000125804 | 340 |
| 193 | 3300005340 | Ga0070689_100004082 | Ga0070689_1000040823 | 340 |
| 194 | 3300005340 | Ga0070689_100262164 | Ga0070689_1002621641 | 340 |
| 195 | 3300005340 | Ga0070689_100292646 | Ga0070689_1002926461 | 340 |
| 196 | 3300005344 | Ga0070661_100004977 | Ga0070661_1000049776 | 340 |
| 197 | 3300005354 | Ga0070675_100078766 | Ga0070675_1000787662 | 340 |
| 198 | 3300005354 | Ga0070675_100359161 | Ga0070675_1003591611 | 340 |
| 199 | 3300005355 | Ga0070671_100073189 | Ga0070671_1000731893 | 340 |
| 200 | 3300005355 | Ga0070671_100102273 | Ga0070671_1001022733 | 340 |
| 201 | 3300005364 | Ga0070673_100041322 | Ga0070673_1000413221 | 340 |
| 202 | 3300005364 | Ga0070673_100061030 | Ga0070673_1000610303 | 340 |
| 203 | 3300005364 | Ga0070673_100210194 | Ga0070673_1002101942 | 340 |
| 204 | 3300005365 | Ga0070688_100025164 | Ga0070688_1000251644 | 340 |
| 205 | 3300005365 | Ga0070688_100054822 | Ga0070688_1000548223 | 340 |
| 206 | 3300005365 | Ga0070688_100055470 | Ga0070688_1000554703 | 340 |
| 207 | 3300005366 | Ga0070659_100029805 | Ga0070659_1000298053 | 340 |
| 208 | 3300005367 | Ga0070667_100267922 | Ga0070667_1002679221 | 340 |
| 209 | 3300005456 | Ga0070678_100159763 | Ga0070678_1001597632 | 340 |
| 210 | 3300005457 | Ga0070662_100032018 | Ga0070662_1000320183 | 340 |
| 211 | 3300005459 | Ga0068867_100012240 | Ga0068867_1000122406 | 340 |
| 212 | 3300005466 | Ga0070685_10038976 | Ga0070685_100389762 | 340 |
| 213 | 3300005466 | Ga0070685_10155728 | Ga0070685_101557282 | 340 |
| 214 | 3300005530 | Ga0070679_100043059 | Ga0070679_1000430594 | 340 |
| 215 | 3300005535 | Ga0070684_100000568 | Ga0070684_10000056815 | 340 |
| 216 | 3300005535 | Ga0070684_100304437 | Ga0070684_1003044371 | 340 |
| 217 | 3300005539 | Ga0068853_100007326 | Ga0068853_1000073265 | 340 |
| 218 | 3300005548 | Ga0070665_100073574 | Ga0070665_1000735743 | 340 |
| 219 | 3300005563 | Ga0068855_100021324 | Ga0068855_1000213243 | 340 |
| 220 | 3300005564 | Ga0070664_100001475 | Ga0070664_1000014756 | 340 |
| 221 | 3300005564 | Ga0070664_100029557 | Ga0070664_1000295573 | 340 |
| 222 | 3300005564 | Ga0070664_100044587 | Ga0070664_1000445873 | 340 |
| 223 | 3300005577 | Ga0068857_100001702 | Ga0068857_1000017024 | 340 |
| 224 | 3300005577 | Ga0068857_100186025 | Ga0068857_1001860252 | 340 |
| 225 | 3300005578 | Ga0068854_100074676 | Ga0068854_1000746763 | 340 |
| 226 | 3300005614 | Ga0068856_100031637 | Ga0068856_1000316378 | 340 |
| 227 | 3300005614 | Ga0068856_100341322 | Ga0068856_1003413221 | 340 |
| 228 | 3300005616 | Ga0068852_100027499 | Ga0068852_1000274993 | 340 |
| 229 | 3300005617 | Ga0068859_100012688 | Ga0068859_1000126886 | 340 |
| 230 | 3300005617 | Ga0068859_100101819 | Ga0068859_1001018193 | 340 |
| 231 | 3300005841 | Ga0068863_100133973 | Ga0068863_1001339732 | 340 |
| 232 | 3300005841 | Ga0068863_100234916 | Ga0068863_1002349162 | 340 |
| 233 | 3300005842 | Ga0068858_100009912 | Ga0068858_1000099126 | 340 |
| 234 | 3300005842 | Ga0068858_100033527 | Ga0068858_1000335275 | 340 |
| 235 | 3300006237 | Ga0097621_100026043 | Ga0097621_1000260435 | 340 |
| 236 | 3300006237 | Ga0097621_100032016 | Ga0097621_1000320165 | 340 |
| 237 | 3300006881 | Ga0068865_100154890 | Ga0068865_1001548902 | 340 |
| 238 | 3300006931 | Ga0097620_100012688 | Ga0097620_1000126886 | 340 |
| 239 | 3300006931 | Ga0097620_100101815 | Ga0097620_1001018152 | 340 |
| 240 | 3300009174 | Ga0105241_10121601 | Ga0105241_101216012 | 340 |
| 241 | 3300009176 | Ga0105242_10046111 | Ga0105242_100461113 | 340 |
| 242 | 3300009553 | Ga0105249_10215614 | Ga0105249_102156141 | 340 |
| 243 | 3300010375 | Ga0105239_10046154 | Ga0105239_100461543 | 340 |
| 244 | 3300010375 | Ga0105239_10204231 | Ga0105239_102042313 | 340 |
| 245 | 3300013102 | Ga0157371_10041477 | Ga0157371_100414773 | 340 |
| 246 | 3300013104 | Ga0157370_10001314 | Ga0157370_1000131427 | 340 |
| 247 | 3300013105 | Ga0157369_10107989 | Ga0157369_101079892 | 340 |
| 248 | 3300013296 | Ga0157374_10083999 | Ga0157374_100839993 | 340 |
| 249 | 3300013296 | Ga0157374_10113242 | Ga0157374_101132421 | 340 |
| 250 | 3300013297 | Ga0157378_10033743 | Ga0157378_100337433 | 340 |
| 251 | 3300013306 | Ga0163162_10004586 | Ga0163162_100045863 | 340 |
| 252 | 3300013306 | Ga0163162_10032092 | Ga0163162_100320925 | 340 |
| 253 | 3300013307 | Ga0157372_10085072 | Ga0157372_100850722 | 340 |
| 254 | 3300013307 | Ga0157372_10092796 | Ga0157372_100927964 | 340 |
| 255 | 3300013308 | Ga0157375_10008784 | Ga0157375_100087846 | 340 |
| 256 | 3300013308 | Ga0157375_10012199 | Ga0157375_100121995 | 340 |
| 257 | 3300013308 | Ga0157375_10153458 | Ga0157375_101534583 | 340 |
| 258 | 3300014745 | Ga0157377_10012210 | Ga0157377_100122104 | 340 |
| 259 | 3300014745 | Ga0157377_10014418 | Ga0157377_100144183 | 340 |
| 260 | 3300014745 | Ga0157377_10133567 | Ga0157377_101335672 | 340 |
| 261 | 3300014968 | Ga0157379_10083882 | Ga0157379_100838823 | 340 |
| 262 | 3300014969 | Ga0157376_10019448 | Ga0157376_100194484 | 340 |
| 263 | 3300014969 | Ga0157376_10108796 | Ga0157376_101087963 | 340 |
| 264 | 3300017792 | Ga0163161_10055618 | Ga0163161_100556183 | 340 |
| 265 | 3300017792 | Ga0163161_10062533 | Ga0163161_100625333 | 340 |
| 266 | 3300025903 | Ga0207680_10104297 | Ga0207680_101042972 | 340 |
| 267 | 3300025904 | Ga0207647_10013381 | Ga0207647_100133816 | 340 |
| 268 | 3300025909 | Ga0207705_10018554 | Ga0207705_100185548 | 340 |
| 269 | 3300025909 | Ga0207705_10039922 | Ga0207705_100399223 | 340 |
| 270 | 3300025913 | Ga0207695_10195741 | Ga0207695_101957412 | 340 |
| 271 | 3300025917 | Ga0207660_10008625 | Ga0207660_100086256 | 340 |
| 272 | 3300025920 | Ga0207649_10001781 | Ga0207649_1000178110 | 340 |
| 273 | 3300025921 | Ga0207652_10000171 | Ga0207652_1000017125 | 340 |
| 274 | 3300025926 | Ga0207659_10058014 | Ga0207659_100580143 | 340 |
| 275 | 3300025932 | Ga0207690_10016583 | Ga0207690_100165834 | 340 |
| 276 | 3300025933 | Ga0207706_10003848 | Ga0207706_100038486 | 340 |
| 277 | 3300025936 | Ga0207670_10011502 | Ga0207670_100115023 | 340 |
| 278 | 3300025936 | Ga0207670_10021624 | Ga0207670_100216245 | 340 |
| 279 | 3300025938 | Ga0207704_10029667 | Ga0207704_100296673 | 340 |
| 280 | 3300025940 | Ga0207691_10050518 | Ga0207691_100505183 | 340 |
| 281 | 3300025942 | Ga0207689_10003496 | Ga0207689_100034967 | 340 |
| 282 | 3300025942 | Ga0207689_10058714 | Ga0207689_100587143 | 340 |
| 283 | 3300025944 | Ga0207661_10000688 | Ga0207661_1000068817 | 340 |
| 284 | 3300025944 | Ga0207661_10094009 | Ga0207661_100940092 | 340 |
| 285 | 3300025945 | Ga0207679_10000391 | Ga0207679_1000039120 | 340 |
| 286 | 3300025949 | Ga0207667_10000539 | Ga0207667_1000053928 | 340 |
| 287 | 3300025949 | Ga0207667_10026698 | Ga0207667_100266986 | 340 |
| 288 | 3300025961 | Ga0207712_10158219 | Ga0207712_101582192 | 340 |
| 289 | 3300025981 | Ga0207640_10040775 | Ga0207640_100407752 | 340 |
| 290 | 3300025986 | Ga0207658_10103401 | Ga0207658_101034011 | 340 |
| 291 | 3300025986 | Ga0207658_10187250 | Ga0207658_101872501 | 340 |
| 292 | 3300025986 | Ga0207658_10203834 | Ga0207658_102038342 | 340 |
| 293 | 3300026023 | Ga0207677_10008332 | Ga0207677_100083325 | 340 |
| 294 | 3300026023 | Ga0207677_10159513 | Ga0207677_101595132 | 340 |
| 295 | 3300026041 | Ga0207639_10003619 | Ga0207639_100036197 | 340 |
| 296 | 3300026078 | Ga0207702_10033398 | Ga0207702_100333985 | 340 |
| 297 | 3300026088 | Ga0207641_10190241 | Ga0207641_101902412 | 340 |
| 298 | 3300026089 | Ga0207648_10028275 | Ga0207648_100282756 | 340 |
| 299 | 3300026095 | Ga0207676_10002355 | Ga0207676_1000235511 | 340 |
| 300 | 3300026116 | Ga0207674_10001890 | Ga0207674_1000189012 | 340 |
| 301 | 3300026116 | Ga0207674_10038548 | Ga0207674_100385483 | 340 |
| 302 | 3300026116 | Ga0207674_10331552 | Ga0207674_103315521 | 340 |
| 303 | 3300026121 | Ga0207683_10019477 | Ga0207683_100194776 | 340 |
| 304 | 3300028379 | Ga0268266_10026586 | Ga0268266_100265862 | 340 |
| 305 | 3300028379 | Ga0268266_10099447 | Ga0268266_100994472 | 340 |
| 306 | 3300037418 | Ga0395900_0148974 | Ga0395900_0148974_1278_2309 | 340 |
| 307 | 3300037466 | Ga0395898_0029934 | Ga0395898_0029934_2450_3481 | 340 |
| 308 | 3300037466 | Ga0395898_0118591 | Ga0395898_0118591_1324_2355 | 340 |
| 309 | 3300048913 | Ga0496110_0274859 | Ga0496110_0274859_249_1280 | 340 |
| 310 | 3300005327 | Ga0070658_10036387 | Ga0070658_100363874 | 341 |
| 311 | 3300005327 | Ga0070658_10079891 | Ga0070658_100798912 | 341 |
| 312 | 3300005331 | Ga0070670_100043976 | Ga0070670_1000439761 | 341 |
| 313 | 3300005341 | Ga0070691_10032536 | Ga0070691_100325363 | 341 |
| 314 | 3300005356 | Ga0070674_100151917 | Ga0070674_1001519172 | 341 |
| 315 | 3300005530 | Ga0070679_100059125 | Ga0070679_1000591254 | 341 |
| 316 | 3300005539 | Ga0068853_100031245 | Ga0068853_1000312454 | 341 |
| 317 | 3300005547 | Ga0070693_100003857 | Ga0070693_1000038575 | 341 |
| 318 | 3300005563 | Ga0068855_100020250 | Ga0068855_1000202506 | 341 |
| 319 | 3300005719 | Ga0068861_100050719 | Ga0068861_1000507194 | 341 |
| 320 | 3300006237 | Ga0097621_100027647 | Ga0097621_1000276475 | 341 |
| 321 | 3300006358 | Ga0068871_100011135 | Ga0068871_1000111353 | 341 |
| 322 | 3300009093 | Ga0105240_10002244 | Ga0105240_1000224419 | 341 |
| 323 | 3300009174 | Ga0105241_10006152 | Ga0105241_100061522 | 341 |
| 324 | 3300013102 | Ga0157371_10000656 | Ga0157371_1000065626 | 341 |
| 325 | 3300013102 | Ga0157371_10081834 | Ga0157371_100818342 | 341 |
| 326 | 3300013104 | Ga0157370_10000916 | Ga0157370_1000091628 | 341 |
| 327 | 3300013104 | Ga0157370_10001221 | Ga0157370_1000122125 | 341 |
| 328 | 3300013296 | Ga0157374_10012169 | Ga0157374_100121695 | 341 |
| 329 | 3300013306 | Ga0163162_10153822 | Ga0163162_101538223 | 341 |
| 330 | 3300013306 | Ga0163162_10416009 | Ga0163162_104160092 | 341 |
| 331 | 3300013307 | Ga0157372_10009417 | Ga0157372_100094172 | 341 |
| 332 | 3300014325 | Ga0163163_10000462 | Ga0163163_1000046210 | 341 |
| 333 | 3300014969 | Ga0157376_10022999 | Ga0157376_100229996 | 341 |
| 334 | 3300017792 | Ga0163161_10061115 | Ga0163161_100611152 | 341 |
| 335 | 3300025909 | Ga0207705_10059637 | Ga0207705_100596372 | 341 |
| 336 | 3300025909 | Ga0207705_10143214 | Ga0207705_101432142 | 341 |
| 337 | 3300025912 | Ga0207707_10012595 | Ga0207707_100125953 | 341 |
| 338 | 3300025913 | Ga0207695_10011412 | Ga0207695_100114128 | 341 |
| 339 | 3300025914 | Ga0207671_10184078 | Ga0207671_101840783 | 341 |
| 340 | 3300025917 | Ga0207660_10035020 | Ga0207660_100350203 | 341 |
| 341 | 3300025919 | Ga0207657_10208763 | Ga0207657_102087632 | 341 |
| 342 | 3300025921 | Ga0207652_10000016 | Ga0207652_10000016131 | 341 |
| 343 | 3300025921 | Ga0207652_10014701 | Ga0207652_100147017 | 341 |
| 344 | 3300025932 | Ga0207690_10065477 | Ga0207690_100654771 | 341 |
| 345 | 3300025942 | Ga0207689_10003166 | Ga0207689_100031663 | 341 |
| 346 | 3300025949 | Ga0207667_10023424 | Ga0207667_100234246 | 341 |
| 347 | 3300025972 | Ga0207668_10214169 | Ga0207668_102141692 | 341 |
| 348 | 3300026041 | Ga0207639_10023014 | Ga0207639_100230144 | 341 |
| 349 | 3300026067 | Ga0207678_10055656 | Ga0207678_100556563 | 341 |
| 350 | 3300026089 | Ga0207648_10151774 | Ga0207648_101517741 | 341 |
| 351 | 3300026118 | Ga0207675_100066529 | Ga0207675_1000665294 | 341 |
| 352 | 3300037312 | Ga0395899_0011529 | Ga0395899_0011529_473_1510 | 341 |
| 353 | 3300037312 | Ga0395899_0013887 | Ga0395899_0013887_4092_5129 | 341 |
| 354 | 3300037418 | Ga0395900_0018416 | Ga0395900_0018416_5391_6428 | 341 |
| 355 | 3300037418 | Ga0395900_0038608 | Ga0395900_0038608_2990_4027 | 341 |
| 356 | 3300037466 | Ga0395898_0007047 | Ga0395898_0007047_6678_7715 | 341 |
| 357 | 3300038443 | Ga0395901_0016817 | Ga0395901_0016817_1976_3013 | 341 |
| 358 | 3300038443 | Ga0395901_0112626 | Ga0395901_0112626_1558_2595 | 341 |
| 359 | 3300044842 | Ga0466957_0000460 | Ga0466957_0000460_3038_4093 | 341 |
| 360 | 3300046616 | Ga0495668_0001051 | Ga0495668_0001051_14594_15628 | 341 |
| 361 | 3300047317 | Ga0495604_0097861 | Ga0495604_0097861_845_1951 | 341 |
| 362 | 3300005843 | Ga0068860_100236193 | Ga0068860_1002361932 | 342 |
| 363 | 3300014969 | Ga0157376_10166843 | Ga0157376_101668432 | 342 |
| 364 | 3300036401 | Ga0373937_0405762 | Ga0373937_0405762_202_1239 | 342 |
| 365 | 3300011119 | Ga0105246_10010026 | Ga0105246_100100266 | 344 |
| 366 | iso_pu_bacteria | 2738541278 | 2738727818 | 344 |
| 367 | 3300003323 | rootH1_10021375 | rootH1_100213755 | 348 |
| 368 | 3300005468 | Ga0070707_100466875 | Ga0070707_1004668751 | 348 |
| 369 | 3300030522 | Ga0307512_10044885 | Ga0307512_100448851 | 348 |
| 370 | 3300031507 | Ga0307509_10044028 | Ga0307509_100440288 | 348 |
| 371 | 3300041509 | Ga0451843_1472935 | Ga0451843_1472935_46_1101 | 348 |
| 372 | 3300041512 | Ga0451853_1888965 | Ga0451853_1888965_261_1313 | 348 |
| 373 | 3300044656 | Ga0466969_0000091 | Ga0466969_0000091_16804_17859 | 348 |
| 374 | 3300044706 | Ga0466964_0005934 | Ga0466964_0005934_3422_4477 | 348 |
| 375 | 3300044735 | Ga0466968_0049820 | Ga0466968_0049820_163_1218 | 348 |
| 376 | 3300049705 | Ga0501225_0001093 | Ga0501225_0001093_3973_5019 | 348 |
| 377 | 3300053086 | Ga0500578_0000019 | Ga0500578_0000019_21393_22439 | 348 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r1f-assembly1.cif.gz_A | crystal structure of predicted aminodeoxychorismate lyase from escherichia coli | 0.7433 | 79 | 334 |
| 2r1f-assembly1.cif.gz_A | crystal structure of predicted aminodeoxychorismate lyase from escherichia coli | 0.7307 | 79 | 334 |
| 4iiw-assembly1.cif.gz_A-5 | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.6544 | 34 | 323 |
| 4iiw-assembly1.cif.gz_B | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.6332 | 32 | 322 |
| 4iiw-assembly1.cif.gz_A-5 | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.626 | 34 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r1fA03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.9336 | 298 | 334 | 3.30.160.60 |
| 2r1fB03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.9163 | 298 | 331 | 3.30.160.60 |
| 2r1fA03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.8253 | 298 | 334 | 3.30.160.60 |
| 2r1fB03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.7487 | 298 | 331 | 3.30.160.60 |
| 2o6iB02 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; | 0.1756 | 51 | 187 | 1.20.1250.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1N9R3-F1-model_v4 | Endolytic transglycosylase MltG | 0.9953 | 200 | 338 |
GO:0005886
GO:0016829 GO:0071555 |
| AF-A0A7V4BS14-F1-model_v4 | Endolytic transglycosylase MltG | 0.9947 | 216 | 340 |
GO:0005886
GO:0016829 GO:0071555 |
| AF-A0A1V5MSD2-F1-model_v4 | Putative aminodeoxychorismate lyase | 0.99 | 159 | 334 |
GO:0005886
GO:0016829 GO:0071555 |
| AF-A0A7C5YDZ3-F1-model_v4 | Endolytic transglycosylase MltG | 0.982 | 201 | 340 |
GO:0005886
GO:0016829 GO:0071555 |
| AF-A0A3M1N9R3-F1-model_v4 | Endolytic transglycosylase MltG | 0.9812 | 200 | 338 |
GO:0005886
GO:0016829 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar