F427698

General Info

Members Datasets Scaffolds Average Seq Length
377 170 374 341

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10022999|Ga0157376_100229996
Length 367
Sequence MAFYVSIGPIFTVQLIILNTQFDSMKKWIVLTVLLIFLVAAFLVWKLFGPTVKQPEEKFLYIRTGSTYNAVVKDLQNRKIIKSAEGFNLISRALKYTIVKPGKYEIKKGMNLFNLVRMLKNGRQTPIDLVIIKFRTKEEFAGRIGREFETDSLQMLNFLSNHDSLEHYHLDTNTWACAIIPDTYRYFWNSTPTRIFSKLYAVSEGFWTSERKQELKDNNLTPVQAYTLASIIEEETNLKTDKGKIASVYINRIDKGISLQADPTIKFALKDFGLKRIYEKYLAVQSPYNTYTNKGLPPGPICTPSVETLKEVINAPKTDYIYFVADSDLNGSSVFTSNYKDHMKYAKLYQQALNKQDSIKQARENMQ

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2914759650 Rhizosphaericola mali Isolate Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
170 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 0.27
Rhizosphere 96.29
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10021375 3300003323 Bacteria 11386
2 Ga0065714_10076655 3300005288 Bacteria 2769
3 Ga0065704_10114337 3300005289 Bacteria 1893
4 Ga0065712_10005108 3300005290 Bacteria 3959
5 Ga0070658_10008410 3300005327 Bacteria 8297
6 Ga0070658_10036387 3300005327 Bacteria 3968
7 Ga0070658_10043984 3300005327 Bacteria 3608
8 Ga0070658_10079891 3300005327 Bacteria 2686
9 Ga0070658_10344770 3300005327 Unclassified 1274
10 Ga0070683_100000211 3300005329 Bacteria 39486
11 Ga0070683_100003981 3300005329 Bacteria 12096
12 Ga0070683_100125343 3300005329 Bacteria 2428
13 Ga0070690_100019967 3300005330 Bacteria 4077
14 Ga0070690_100143780 3300005330 Bacteria 1621
15 Ga0070690_100146515 3300005330 Unclassified 1607
16 Ga0070670_100043976 3300005331 Bacteria 3840
17 Ga0070670_100094499 3300005331 Bacteria 2571
18 Ga0070670_100094938 3300005331 Bacteria 2565
19 Ga0070670_100102221 3300005331 Bacteria 2468
20 Ga0068869_100016129 3300005334 Bacteria 5031
21 Ga0068869_100043864 3300005334 Unclassified 3215
22 Ga0068869_100235880 3300005334 Bacteria 1455
23 Ga0070666_10002600 3300005335 Bacteria 10892
24 Ga0070680_100016888 3300005336 Bacteria 5745
25 Ga0070680_100025265 3300005336 Bacteria 4746
26 Ga0070680_100041019 3300005336 Bacteria 3752
27 Ga0070682_100001184 3300005337 Bacteria 14886
28 Ga0070682_100091336 3300005337 Unclassified 1993
29 Ga0068868_100008958 3300005338 Bacteria 7180
30 Ga0068868_100012580 3300005338 Bacteria 6188
31 Ga0070660_100023036 3300005339 Bacteria 4611
32 Ga0070660_100089040 3300005339 Bacteria 2432
33 Ga0070660_100152552 3300005339 Bacteria 1858
34 Ga0070689_100004082 3300005340 Bacteria 9834
35 Ga0070689_100262164 3300005340 Bacteria 1429
36 Ga0070689_100292646 3300005340 Bacteria 1353
37 Ga0070691_10032536 3300005341 Unclassified 2450
38 Ga0070661_100004977 3300005344 Bacteria 9153
39 Ga0070669_100043293 3300005353 Bacteria 3278
40 Ga0070675_100005185 3300005354 Bacteria 9936
41 Ga0070675_100078766 3300005354 Bacteria 2745
42 Ga0070675_100359161 3300005354 Bacteria 1293
43 Ga0070671_100073189 3300005355 Bacteria 2862
44 Ga0070671_100102273 3300005355 Bacteria 2404
45 Ga0070674_100151917 3300005356 Bacteria 1748
46 Ga0070673_100041322 3300005364 Bacteria 3546
47 Ga0070673_100061030 3300005364 Bacteria 2989
48 Ga0070673_100210194 3300005364 Bacteria 1680
49 Ga0070688_100003172 3300005365 Bacteria 8420
50 Ga0070688_100025164 3300005365 Bacteria 3522
51 Ga0070688_100054822 3300005365 Bacteria 2498
52 Ga0070688_100055470 3300005365 Bacteria 2485
53 Ga0070659_100017471 3300005366 Bacteria 5402
54 Ga0070659_100029805 3300005366 Bacteria 4218
55 Ga0070659_100083202 3300005366 Bacteria 2558
56 Ga0070659_100160579 3300005366 Bacteria 1837
57 Ga0070667_100267922 3300005367 Bacteria 1531
58 Ga0070663_100014614 3300005455 Bacteria 5044
59 Ga0070678_100159763 3300005456 Unclassified 1824
60 Ga0070662_100002740 3300005457 Bacteria 10892
61 Ga0070662_100032018 3300005457 Bacteria 3695
62 Ga0070681_10038610 3300005458 Bacteria 4787
63 Ga0068867_100012240 3300005459 Bacteria 6064
64 Ga0068867_100057445 3300005459 Bacteria 2882
65 Ga0070685_10038976 3300005466 Bacteria 2697
66 Ga0070685_10155728 3300005466 Bacteria 1452
67 Ga0070707_100466875 3300005468 Bacteria 1223
68 Ga0070679_100008525 3300005530 Bacteria 9657
69 Ga0070679_100035544 3300005530 Bacteria 4943
70 Ga0070679_100043059 3300005530 Bacteria 4497
71 Ga0070679_100059125 3300005530 Bacteria 3820
72 Ga0070679_100094989 3300005530 Bacteria 2969
73 Ga0070684_100000568 3300005535 Bacteria 25497
74 Ga0070684_100304437 3300005535 Unclassified 1463
75 Ga0068853_100007326 3300005539 Bacteria 8830
76 Ga0068853_100031245 3300005539 Unclassified 4504
77 Ga0068853_100077770 3300005539 Bacteria 2899
78 Ga0068853_100291035 3300005539 Bacteria 1508
79 Ga0068853_100452645 3300005539 Bacteria 1207
80 Ga0070693_100003857 3300005547 Bacteria 7026
81 Ga0070665_100073574 3300005548 Bacteria 3423
82 Ga0068855_100020250 3300005563 Bacteria 7985
83 Ga0068855_100021324 3300005563 Bacteria 7770
84 Ga0068855_100071679 3300005563 Bacteria 4028
85 Ga0068855_100448395 3300005563 Bacteria 1408
86 Ga0070664_100001475 3300005564 Bacteria 18739
87 Ga0070664_100029557 3300005564 Bacteria 4569
88 Ga0070664_100044587 3300005564 Bacteria 3745
89 Ga0068857_100001702 3300005577 Bacteria 17680
90 Ga0068857_100186025 3300005577 Unclassified 1891
91 Ga0068857_100201748 3300005577 Bacteria 1813
92 Ga0068857_100202271 3300005577 Unclassified 1811
93 Ga0068854_100074676 3300005578 Bacteria 2487
94 Ga0068856_100031637 3300005614 Bacteria 5178
95 Ga0068856_100341322 3300005614 Bacteria 1516
96 Ga0068852_100002617 3300005616 Bacteria 12436
97 Ga0068852_100027499 3300005616 Bacteria 4636
98 Ga0068859_100000186 3300005617 Bacteria 60206
99 Ga0068859_100012688 3300005617 Bacteria 8472
100 Ga0068859_100015578 3300005617 Bacteria 7640
101 Ga0068859_100062636 3300005617 Bacteria 3750
102 Ga0068859_100070605 3300005617 Bacteria 3528
103 Ga0068859_100101819 3300005617 Bacteria 2929
104 Ga0068864_100021211 3300005618 Bacteria 5441
105 Ga0068866_10164939 3300005718 Unclassified 1295
106 Ga0068861_100003143 3300005719 Bacteria 10914
107 Ga0068861_100050719 3300005719 Bacteria 3148
108 Ga0068863_100002992 3300005841 Bacteria 16703
109 Ga0068863_100133973 3300005841 Bacteria 2366
110 Ga0068863_100234916 3300005841 Bacteria 1769
111 Ga0068863_100381478 3300005841 Bacteria 1376
112 Ga0068858_100006813 3300005842 Bacteria 11115
113 Ga0068858_100009912 3300005842 Bacteria 9050
114 Ga0068858_100033527 3300005842 Bacteria 4764
115 Ga0068860_100007278 3300005843 Bacteria 11071
116 Ga0068860_100109905 3300005843 Bacteria 2634
117 Ga0068860_100236193 3300005843 Bacteria 1777
118 Ga0068862_100235784 3300005844 Unclassified 1661
119 Ga0097621_100026043 3300006237 Bacteria 4584
120 Ga0097621_100027647 3300006237 Bacteria 4463
121 Ga0097621_100032016 3300006237 Bacteria 4177
122 Ga0097621_100264799 3300006237 Bacteria 1509
123 Ga0068871_100011135 3300006358 Bacteria 6594
124 Ga0068871_100036404 3300006358 Bacteria 3919
125 Ga0068865_100053974 3300006881 Unclassified 2790
126 Ga0068865_100154890 3300006881 Bacteria 1742
127 Ga0097620_100000186 3300006931 Bacteria 60206
128 Ga0097620_100012688 3300006931 Bacteria 8472
129 Ga0097620_100015579 3300006931 Bacteria 7640
130 Ga0097620_100062636 3300006931 Bacteria 3750
131 Ga0097620_100070605 3300006931 Bacteria 3528
132 Ga0097620_100101815 3300006931 Bacteria 2929
133 Ga0105240_10002244 3300009093 Bacteria 31388
134 Ga0105240_10077907 3300009093 Bacteria 4083
135 Ga0111539_10003454 3300009094 Bacteria 20812
136 Ga0105247_10008274 3300009101 Bacteria 6347
137 Ga0105247_10008423 3300009101 Bacteria 6283
138 Ga0105241_10006152 3300009174 Bacteria 8848
139 Ga0105241_10121601 3300009174 Unclassified 2103
140 Ga0105242_10046111 3300009176 Unclassified 3535
141 Ga0105242_10077363 3300009176 Bacteria 2775
142 Ga0105237_10017999 3300009545 Bacteria 7320
143 Ga0105249_10029458 3300009553 Bacteria 4958
144 Ga0105249_10035187 3300009553 Bacteria 4541
145 Ga0105249_10215614 3300009553 Bacteria 1886
146 Ga0105239_10046154 3300010375 Bacteria 4773
147 Ga0105239_10055013 3300010375 Bacteria 4364
148 Ga0105239_10204231 3300010375 Bacteria 2214
149 Ga0105246_10010026 3300011119 Bacteria 5845
150 Ga0157373_10017978 3300013100 Bacteria 5148
151 Ga0157373_10127293 3300013100 Bacteria 1791
152 Ga0157371_10000318 3300013102 Bacteria 62463
153 Ga0157371_10000656 3300013102 Bacteria 40997
154 Ga0157371_10002847 3300013102 Bacteria 16159
155 Ga0157371_10014831 3300013102 Bacteria 5867
156 Ga0157371_10016729 3300013102 Bacteria 5464
157 Ga0157371_10018394 3300013102 Bacteria 5166
158 Ga0157371_10033147 3300013102 Bacteria 3713
159 Ga0157371_10041477 3300013102 Bacteria 3283
160 Ga0157371_10075890 3300013102 Bacteria 2380
161 Ga0157371_10081834 3300013102 Unclassified 2286
162 Ga0157371_10255264 3300013102 Bacteria 1263
163 Ga0157370_10000795 3300013104 Bacteria 39727
164 Ga0157370_10000916 3300013104 Bacteria 37388
165 Ga0157370_10001221 3300013104 Bacteria 32173
166 Ga0157370_10001314 3300013104 Bacteria 30974
167 Ga0157369_10018092 3300013105 Bacteria 7904
168 Ga0157369_10107989 3300013105 Unclassified 2960
169 Ga0157374_10012169 3300013296 Bacteria 7476
170 Ga0157374_10083999 3300013296 Bacteria 3026
171 Ga0157374_10113242 3300013296 Bacteria 2611
172 Ga0157374_10147054 3300013296 Bacteria 2289
173 Ga0157378_10033743 3300013297 Bacteria 4526
174 Ga0157378_10098293 3300013297 Bacteria 2669
175 Ga0157378_10255949 3300013297 Bacteria 1678
176 Ga0157378_10530638 3300013297 Bacteria 1180
177 Ga0163162_10004586 3300013306 Bacteria 13309
178 Ga0163162_10006332 3300013306 Bacteria 11462
179 Ga0163162_10032092 3300013306 Bacteria 5214
180 Ga0163162_10065552 3300013306 Bacteria 3679
181 Ga0163162_10153822 3300013306 Bacteria 2419
182 Ga0163162_10213237 3300013306 Bacteria 2061
183 Ga0163162_10416009 3300013306 Bacteria 1476
184 Ga0157372_10009417 3300013307 Bacteria 10391
185 Ga0157372_10027286 3300013307 Bacteria 6217
186 Ga0157372_10028710 3300013307 Bacteria 6073
187 Ga0157372_10052136 3300013307 Bacteria 4554
188 Ga0157372_10056081 3300013307 Bacteria 4402
189 Ga0157372_10076899 3300013307 Bacteria 3769
190 Ga0157372_10085072 3300013307 Bacteria 3586
191 Ga0157372_10092796 3300013307 Bacteria 3435
192 Ga0157372_10239553 3300013307 Bacteria 2105
193 Ga0157375_10005137 3300013308 Bacteria 11365
194 Ga0157375_10008784 3300013308 Bacteria 8854
195 Ga0157375_10012199 3300013308 Bacteria 7617
196 Ga0157375_10038974 3300013308 Bacteria 4568
197 Ga0157375_10153458 3300013308 Bacteria 2440
198 Ga0163163_10000462 3300014325 Bacteria 37124
199 Ga0163163_10281234 3300014325 Bacteria 1715
200 Ga0157380_10001175 3300014326 Bacteria 16963
201 Ga0157377_10012210 3300014745 Bacteria 4314
202 Ga0157377_10014418 3300014745 Bacteria 4022
203 Ga0157377_10133567 3300014745 Bacteria 1518
204 Ga0157379_10083882 3300014968 Unclassified 2856
205 Ga0157376_10019448 3300014969 Bacteria 5235
206 Ga0157376_10022999 3300014969 Bacteria 4870
207 Ga0157376_10084675 3300014969 Bacteria 2730
208 Ga0157376_10108796 3300014969 Bacteria 2436
209 Ga0157376_10166843 3300014969 Unclassified 2001
210 Ga0157376_10308551 3300014969 Bacteria 1500
211 Ga0163161_10055618 3300017792 Bacteria 2873
212 Ga0163161_10061115 3300017792 Unclassified 2742
213 Ga0163161_10062533 3300017792 Unclassified 2712
214 Ga0163161_10317990 3300017792 Bacteria 1230
215 Ga0207710_10003698 3300025900 Bacteria 6780
216 Ga0207710_10012990 3300025900 Bacteria 3507
217 Ga0207680_10104297 3300025903 Bacteria 1827
218 Ga0207647_10013381 3300025904 Bacteria 5690
219 Ga0207647_10058434 3300025904 Bacteria 2362
220 Ga0207705_10018554 3300025909 Bacteria 4973
221 Ga0207705_10039922 3300025909 Bacteria 3364
222 Ga0207705_10059637 3300025909 Bacteria 2754
223 Ga0207705_10142231 3300025909 Bacteria 1792
224 Ga0207705_10143214 3300025909 Bacteria 1786
225 Ga0207707_10012595 3300025912 Bacteria 7349
226 Ga0207707_10090822 3300025912 Bacteria 2669
227 Ga0207695_10011412 3300025913 Bacteria 10769
228 Ga0207695_10078177 3300025913 Bacteria 3357
229 Ga0207695_10195741 3300025913 Unclassified 1937
230 Ga0207671_10184078 3300025914 Unclassified 1626
231 Ga0207660_10008625 3300025917 Bacteria 6593
232 Ga0207660_10030171 3300025917 Bacteria 3726
233 Ga0207660_10033634 3300025917 Bacteria 3548
234 Ga0207660_10035020 3300025917 Bacteria 3483
235 Ga0207660_10120136 3300025917 Bacteria 1989
236 Ga0207657_10005296 3300025919 Bacteria 13515
237 Ga0207657_10053889 3300025919 Bacteria 3482
238 Ga0207657_10097533 3300025919 Bacteria 2444
239 Ga0207657_10208763 3300025919 Bacteria 1568
240 Ga0207657_10220101 3300025919 Unclassified 1521
241 Ga0207649_10001781 3300025920 Bacteria 12322
242 Ga0207652_10000016 3300025921 Bacteria 188815
243 Ga0207652_10000171 3300025921 Bacteria 69902
244 Ga0207652_10000739 3300025921 Bacteria 31538
245 Ga0207652_10014701 3300025921 Bacteria 6344
246 Ga0207652_10021964 3300025921 Bacteria 5272
247 Ga0207652_10029365 3300025921 Bacteria 4596
248 Ga0207681_10031304 3300025923 Bacteria 3474
249 Ga0207650_10040821 3300025925 Unclassified 3397
250 Ga0207659_10058014 3300025926 Bacteria 2778
251 Ga0207659_10098247 3300025926 Bacteria 2201
252 Ga0207687_10200472 3300025927 Bacteria 1559
253 Ga0207690_10016583 3300025932 Bacteria 4486
254 Ga0207690_10065477 3300025932 Bacteria 2485
255 Ga0207690_10122942 3300025932 Bacteria 1888
256 Ga0207706_10003848 3300025933 Bacteria 14295
257 Ga0207670_10011502 3300025936 Bacteria 5143
258 Ga0207670_10021624 3300025936 Bacteria 3973
259 Ga0207670_10102251 3300025936 Unclassified 2048
260 Ga0207704_10029667 3300025938 Bacteria 3055
261 Ga0207691_10050518 3300025940 Bacteria 3806
262 Ga0207689_10003166 3300025942 Bacteria 15084
263 Ga0207689_10003496 3300025942 Bacteria 14357
264 Ga0207689_10005595 3300025942 Bacteria 11200
265 Ga0207689_10056265 3300025942 Bacteria 3236
266 Ga0207689_10058714 3300025942 Unclassified 3164
267 Ga0207661_10000688 3300025944 Bacteria 21928
268 Ga0207661_10094009 3300025944 Bacteria 2503
269 Ga0207661_10164698 3300025944 Bacteria 1926
270 Ga0207679_10000391 3300025945 Bacteria 31474
271 Ga0207667_10000539 3300025949 Bacteria 49978
272 Ga0207667_10020979 3300025949 Bacteria 7246
273 Ga0207667_10023424 3300025949 Bacteria 6799
274 Ga0207667_10026698 3300025949 Bacteria 6303
275 Ga0207712_10008681 3300025961 Bacteria 6427
276 Ga0207712_10018495 3300025961 Bacteria 4540
277 Ga0207712_10158219 3300025961 Bacteria 1757
278 Ga0207668_10214169 3300025972 Bacteria 1542
279 Ga0207640_10040775 3300025981 Unclassified 2948
280 Ga0207658_10103401 3300025986 Bacteria 2236
281 Ga0207658_10187250 3300025986 Bacteria 1718
282 Ga0207658_10203834 3300025986 Bacteria 1653
283 Ga0207677_10008332 3300026023 Bacteria 5783
284 Ga0207677_10159513 3300026023 Bacteria 1751
285 Ga0207639_10003619 3300026041 Bacteria 10380
286 Ga0207639_10023014 3300026041 Unclassified 4494
287 Ga0207639_10345180 3300026041 Bacteria 1328
288 Ga0207678_10055656 3300026067 Bacteria 3407
289 Ga0207678_10112120 3300026067 Bacteria 2326
290 Ga0207702_10033398 3300026078 Bacteria 4297
291 Ga0207641_10000194 3300026088 Bacteria 82153
292 Ga0207641_10190241 3300026088 Bacteria 1886
293 Ga0207648_10028275 3300026089 Bacteria 4972
294 Ga0207648_10044593 3300026089 Unclassified 3890
295 Ga0207648_10110406 3300026089 Bacteria 2414
296 Ga0207648_10151774 3300026089 Bacteria 2044
297 Ga0207676_10002355 3300026095 Bacteria 13499
298 Ga0207676_10035863 3300026095 Bacteria 3769
299 Ga0207676_10038323 3300026095 Unclassified 3657
300 Ga0207674_10001890 3300026116 Bacteria 26652
301 Ga0207674_10011135 3300026116 Bacteria 10115
302 Ga0207674_10024390 3300026116 Bacteria 6465
303 Ga0207674_10038548 3300026116 Bacteria 4957
304 Ga0207674_10331552 3300026116 Unclassified 1471
305 Ga0207675_100000359 3300026118 Bacteria 43729
306 Ga0207675_100066529 3300026118 Bacteria 3369
307 Ga0207683_10019477 3300026121 Bacteria 5794
308 Ga0207698_10001651 3300026142 Bacteria 13013
309 Ga0207428_10008958 3300027907 Bacteria 9014
310 Ga0268266_10026586 3300028379 Unclassified 4925
311 Ga0268266_10099447 3300028379 Bacteria 2561
312 Ga0268265_10009168 3300028380 Bacteria 6688
313 Ga0268264_10005141 3300028381 Bacteria 11086
314 Ga0268264_10006854 3300028381 Bacteria 9564
315 Ga0268264_10034681 3300028381 Bacteria 4152
316 Ga0307515_10000001 3300028794 Bacteria 4259510
317 Ga0307512_10044885 3300030522 Bacteria 3627
318 Ga0265327_10000440 3300031251 Bacteria 75453
319 Ga0307509_10044028 3300031507 Bacteria 4824
320 Ga0307414_10127422 3300032004 Bacteria 1970
321 Ga0373943_0061252 3300035170 Bacteria 1881
322 Ga0373955_0043158 3300035172 Bacteria 2425
323 Ga0373947_0121752 3300035725 Bacteria 1658
324 Ga0373937_0405762 3300036401 Unclassified 1293
325 Ga0373925_0079620 3300037068 Unclassified 2490
326 Ga0395899_0011529 3300037312 Bacteria 6767
327 Ga0395899_0013887 3300037312 Bacteria 6152
328 Ga0395899_0247487 3300037312 Bacteria 1224
329 Ga0395900_0018416 3300037418 Bacteria 7122
330 Ga0395900_0032385 3300037418 Bacteria 5376
331 Ga0395900_0038608 3300037418 Bacteria 4922
332 Ga0395900_0148974 3300037418 Unclassified 2391
333 Ga0395900_0194673 3300037418 Bacteria 2054
334 Ga0395900_0586786 3300037418 Bacteria 1056
335 Ga0395898_0007047 3300037466 Bacteria 11946
336 Ga0395898_0029934 3300037466 Bacteria 5450
337 Ga0395898_0118591 3300037466 Bacteria 2535
338 Ga0395898_0224326 3300037466 Bacteria 1792
339 Ga0395905_0005098 3300037471 Bacteria 13502
340 Ga0395901_0012025 3300038443 Bacteria 8780
341 Ga0395901_0016817 3300038443 Bacteria 7454
342 Ga0395901_0112626 3300038443 Bacteria 2857
343 Ga0439436_0014476 3300041404 Bacteria 2378
344 Ga0439466_0028479 3300041411 Bacteria 1929
345 Ga0451843_1472935 3300041509 Bacteria 1129
346 Ga0451853_1888965 3300041512 Bacteria 2104
347 Ga0439442_009487 3300042002 Bacteria 1969
348 Ga0439457_000268 3300042014 Bacteria 14301
349 Ga0439434_0030213 3300042435 Bacteria 1644
350 Ga0466969_0000091 3300044656 Bacteria 46523
351 Ga0466964_0005934 3300044706 Bacteria 4549
352 Ga0466968_0049820 3300044735 Unclassified 1785
353 Ga0466957_0000460 3300044842 Bacteria 20175
354 Ga0495653_0070640 3300046463 Bacteria 2613
355 Ga0495628_0006489 3300046516 Bacteria 10215
356 Ga0495630_0038442 3300046517 Bacteria 3579
357 Ga0495587_0085501 3300046536 Unclassified 1826
358 Ga0495668_0001051 3300046616 Bacteria 29297
359 Ga0495635_0137088 3300046663 Bacteria 1668
360 Ga0495604_0097861 3300047317 Bacteria 2163
361 Ga0495676_0120553 3300047321 Bacteria 1909
362 Ga0495676_0165621 3300047321 Bacteria 1560
363 Ga0496110_0274859 3300048913 Bacteria 1534
364 Ga0501034_0000017 3300049571 Bacteria 285938
365 Ga0501034_0162787 3300049571 Bacteria 2201
366 Ga0501070_0143939 3300049586 Bacteria 1968
367 Ga0501225_0001093 3300049705 Bacteria 8507
368 Ga0501044_0060128 3300049823 Bacteria 3892
369 nmdc:mga08y16_3350_c1 3300050511 Bacteria 16593
370 Ga0500578_0000019 3300053086 Bacteria 169042
371 Ga0500644_0002938 3300053088 Bacteria 4231
372 Ga0500646_0037618 3300053090 Bacteria 1352
373 Ga0500650_0096128 3300053098 Bacteria 1387
374 Ga0500611_000092 3300053727 Bacteria 25966

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10127293 Ga0157373_101272931 303
2 3300013102 Ga0157371_10002847 Ga0157371_100028475 303
3 3300013307 Ga0157372_10056081 Ga0157372_100560812 303
4 3300026089 Ga0207648_10044593 Ga0207648_100445935 308
5 3300037418 Ga0395900_0586786 Ga0395900_0586786_53_1030 312
6 3300013296 Ga0157374_10147054 Ga0157374_101470542 317
7 3300037312 Ga0395899_0247487 Ga0395899_0247487_129_1154 318
8 3300037418 Ga0395900_0194673 Ga0395900_0194673_21_1046 318
9 3300013306 Ga0163162_10213237 Ga0163162_102132371 320
10 3300047321 Ga0495676_0120553 Ga0495676_0120553_360_1391 320
11 3300005539 Ga0068853_100452645 Ga0068853_1004526451 322
12 3300026041 Ga0207639_10345180 Ga0207639_103451801 322
13 3300035170 Ga0373943_0061252 Ga0373943_0061252_116_1147 323
14 3300035725 Ga0373947_0121752 Ga0373947_0121752_68_1099 323
15 3300013102 Ga0157371_10014831 Ga0157371_100148314 325
16 3300005539 Ga0068853_100291035 Ga0068853_1002910351 326
17 3300053090 Ga0500646_0037618 Ga0500646_0037618_210_1199 326
18 3300005458 Ga0070681_10038610 Ga0070681_100386103 328
19 3300035172 Ga0373955_0043158 Ga0373955_0043158_613_1719 328
20 3300037068 Ga0373925_0079620 Ga0373925_0079620_263_1369 328
21 3300046463 Ga0495653_0070640 Ga0495653_0070640_1120_2226 328
22 3300046516 Ga0495628_0006489 Ga0495628_0006489_5817_6923 328
23 3300046517 Ga0495630_0038442 Ga0495630_0038442_608_1714 328
24 3300046536 Ga0495587_0085501 Ga0495587_0085501_606_1712 328
25 3300046663 Ga0495635_0137088 Ga0495635_0137088_438_1544 328
26 3300005841 Ga0068863_100381478 Ga0068863_1003814782 329
27 3300005843 Ga0068860_100007278 Ga0068860_10000727810 329
28 3300009176 Ga0105242_10077363 Ga0105242_100773633 329
29 3300013307 Ga0157372_10027286 Ga0157372_100272864 329
30 3300026089 Ga0207648_10110406 Ga0207648_101104063 329
31 3300028381 Ga0268264_10005141 Ga0268264_1000514110 329
32 3300037418 Ga0395900_0032385 Ga0395900_0032385_878_1903 329
33 3300037466 Ga0395898_0224326 Ga0395898_0224326_64_1089 329
34 3300037471 Ga0395905_0005098 Ga0395905_0005098_11600_12625 329
35 3300038443 Ga0395901_0012025 Ga0395901_0012025_1268_2293 329
36 3300049571 Ga0501034_0000017 Ga0501034_0000017_39281_40309 329
37 3300005327 Ga0070658_10008410 Ga0070658_100084107 330
38 3300005366 Ga0070659_100083202 Ga0070659_1000832023 330
39 3300005459 Ga0068867_100057445 Ga0068867_1000574452 330
40 3300005618 Ga0068864_100021211 Ga0068864_1000212116 330
41 3300009545 Ga0105237_10017999 Ga0105237_100179997 330
42 3300025912 Ga0207707_10090822 Ga0207707_100908222 330
43 3300025932 Ga0207690_10122942 Ga0207690_101229422 330
44 3300026067 Ga0207678_10112120 Ga0207678_101121202 330
45 3300026095 Ga0207676_10038323 Ga0207676_100383231 330
46 3300005530 Ga0070679_100094989 Ga0070679_1000949892 331
47 3300006237 Ga0097621_100264799 Ga0097621_1002647991 331
48 3300006358 Ga0068871_100036404 Ga0068871_1000364043 331
49 3300006881 Ga0068865_100053974 Ga0068865_1000539742 331
50 3300009101 Ga0105247_10008274 Ga0105247_100082746 331
51 3300009553 Ga0105249_10029458 Ga0105249_100294584 331
52 3300010375 Ga0105239_10055013 Ga0105239_100550136 331
53 3300013102 Ga0157371_10018394 Ga0157371_100183944 331
54 3300013306 Ga0163162_10006332 Ga0163162_100063324 331
55 3300013307 Ga0157372_10028710 Ga0157372_100287105 331
56 3300013308 Ga0157375_10038974 Ga0157375_100389742 331
57 3300014969 Ga0157376_10084675 Ga0157376_100846752 331
58 3300014969 Ga0157376_10308551 Ga0157376_103085512 331
59 3300047321 Ga0495676_0165621 Ga0495676_0165621_290_1333 331
60 3300005336 Ga0070680_100016888 Ga0070680_1000168884 332
61 3300005339 Ga0070660_100152552 Ga0070660_1001525522 332
62 3300005366 Ga0070659_100017471 Ga0070659_1000174717 332
63 3300005457 Ga0070662_100002740 Ga0070662_1000027405 332
64 3300005530 Ga0070679_100035544 Ga0070679_1000355443 332
65 3300005563 Ga0068855_100071679 Ga0068855_1000716794 332
66 3300013100 Ga0157373_10017978 Ga0157373_100179785 332
67 3300013102 Ga0157371_10075890 Ga0157371_100758902 332
68 3300013307 Ga0157372_10076899 Ga0157372_100768993 332
69 3300025917 Ga0207660_10033634 Ga0207660_100336342 332
70 3300025919 Ga0207657_10220101 Ga0207657_102201012 332
71 3300025921 Ga0207652_10029365 Ga0207652_100293654 332
72 3300025949 Ga0207667_10020979 Ga0207667_100209794 332
73 3300026116 Ga0207674_10024390 Ga0207674_100243905 332
74 3300005289 Ga0065704_10114337 Ga0065704_101143373 333
75 3300005290 Ga0065712_10005108 Ga0065712_100051082 333
76 3300005330 Ga0070690_100146515 Ga0070690_1001465152 333
77 3300005331 Ga0070670_100094499 Ga0070670_1000944992 333
78 3300005353 Ga0070669_100043293 Ga0070669_1000432932 333
79 3300005354 Ga0070675_100005185 Ga0070675_10000518510 333
80 3300005365 Ga0070688_100003172 Ga0070688_1000031726 333
81 3300005366 Ga0070659_100160579 Ga0070659_1001605793 333
82 3300005563 Ga0068855_100448395 Ga0068855_1004483951 333
83 3300005577 Ga0068857_100201748 Ga0068857_1002017481 333
84 3300005577 Ga0068857_100202271 Ga0068857_1002022711 333
85 3300005617 Ga0068859_100070605 Ga0068859_1000706053 333
86 3300005719 Ga0068861_100003143 Ga0068861_1000031437 333
87 3300005844 Ga0068862_100235784 Ga0068862_1002357842 333
88 3300006931 Ga0097620_100070605 Ga0097620_1000706053 333
89 3300009094 Ga0111539_10003454 Ga0111539_1000345411 333
90 3300009553 Ga0105249_10035187 Ga0105249_100351875 333
91 3300013306 Ga0163162_10065552 Ga0163162_100655523 333
92 3300013308 Ga0157375_10005137 Ga0157375_1000513711 333
93 3300014326 Ga0157380_10001175 Ga0157380_100011758 333
94 3300025923 Ga0207681_10031304 Ga0207681_100313043 333
95 3300025925 Ga0207650_10040821 Ga0207650_100408214 333
96 3300025926 Ga0207659_10098247 Ga0207659_100982473 333
97 3300025961 Ga0207712_10018495 Ga0207712_100184952 333
98 3300026116 Ga0207674_10011135 Ga0207674_100111351 333
99 3300026118 Ga0207675_100000359 Ga0207675_10000035925 333
100 3300027907 Ga0207428_10008958 Ga0207428_100089586 333
101 3300028380 Ga0268265_10009168 Ga0268265_100091687 333
102 3300032004 Ga0307414_10127422 Ga0307414_101274222 333
103 3300041411 Ga0439466_0028479 Ga0439466_0028479_33_1043 333
104 3300042002 Ga0439442_009487 Ga0439442_009487_660_1670 333
105 3300042435 Ga0439434_0030213 Ga0439434_0030213_600_1610 333
106 3300050511 nmdc:mga08y16_3350_c1 nmdc:mga08y16_3350_c1_10221_11228 333
107 iso_pu_bacteria 2818991444 2819587164 333
108 iso_pu_bacteria 2914759650 2914763693 333
109 3300005330 Ga0070690_100143780 Ga0070690_1001437801 334
110 3300005337 Ga0070682_100001184 Ga0070682_10000118413 334
111 3300005455 Ga0070663_100014614 Ga0070663_1000146144 334
112 3300005530 Ga0070679_100008525 Ga0070679_1000085254 334
113 3300013297 Ga0157378_10255949 Ga0157378_102559492 334
114 3300017792 Ga0163161_10317990 Ga0163161_103179901 334
115 3300025909 Ga0207705_10142231 Ga0207705_101422312 334
116 3300025919 Ga0207657_10097533 Ga0207657_100975331 334
117 3300025921 Ga0207652_10000739 Ga0207652_1000073924 334
118 3300026142 Ga0207698_10001651 Ga0207698_1000165110 334
119 3300053727 Ga0500611_000092 Ga0500611_000092_4961_6004 334
120 3300005334 Ga0068869_100235880 Ga0068869_1002358802 335
121 3300005617 Ga0068859_100000186 Ga0068859_1000001867 335
122 3300005617 Ga0068859_100062636 Ga0068859_1000626362 335
123 3300005841 Ga0068863_100002992 Ga0068863_1000029923 335
124 3300005842 Ga0068858_100006813 Ga0068858_1000068139 335
125 3300005843 Ga0068860_100109905 Ga0068860_1001099052 335
126 3300006931 Ga0097620_100000186 Ga0097620_10000018654 335
127 3300006931 Ga0097620_100062636 Ga0097620_1000626362 335
128 3300009093 Ga0105240_10077907 Ga0105240_100779073 335
129 3300013297 Ga0157378_10530638 Ga0157378_105306381 335
130 3300025900 Ga0207710_10012990 Ga0207710_100129904 335
131 3300025913 Ga0207695_10078177 Ga0207695_100781773 335
132 3300025927 Ga0207687_10200472 Ga0207687_102004722 335
133 3300025936 Ga0207670_10102251 Ga0207670_101022512 335
134 3300025942 Ga0207689_10005595 Ga0207689_100055957 335
135 3300026088 Ga0207641_10000194 Ga0207641_100001947 335
136 3300028381 Ga0268264_10034681 Ga0268264_100346812 335
137 3300028794 Ga0307515_10000001 Ga0307515_100000011313 335
138 3300031251 Ga0265327_10000440 Ga0265327_1000044026 335
139 3300041404 Ga0439436_0014476 Ga0439436_0014476_959_1966 335
140 3300042014 Ga0439457_000268 Ga0439457_000268_7023_8030 335
141 3300053088 Ga0500644_0002938 Ga0500644_0002938_2235_3242 335
142 3300053098 Ga0500650_0096128 Ga0500650_0096128_234_1241 335
143 3300013104 Ga0157370_10000795 Ga0157370_1000079514 336
144 3300005718 Ga0068866_10164939 Ga0068866_101649391 337
145 3300025942 Ga0207689_10056265 Ga0207689_100562652 337
146 3300005617 Ga0068859_100015578 Ga0068859_1000155786 338
147 3300006931 Ga0097620_100015579 Ga0097620_1000155796 338
148 3300009101 Ga0105247_10008423 Ga0105247_100084237 338
149 3300025900 Ga0207710_10003698 Ga0207710_100036988 338
150 3300025961 Ga0207712_10008681 Ga0207712_100086814 338
151 3300026095 Ga0207676_10035863 Ga0207676_100358635 338
152 3300028381 Ga0268264_10006854 Ga0268264_100068546 338
153 3300005288 Ga0065714_10076655 Ga0065714_100766553 339
154 3300005327 Ga0070658_10043984 Ga0070658_100439843 339
155 3300005329 Ga0070683_100125343 Ga0070683_1001253433 339
156 3300005331 Ga0070670_100094938 Ga0070670_1000949382 339
157 3300005336 Ga0070680_100041019 Ga0070680_1000410194 339
158 3300005337 Ga0070682_100091336 Ga0070682_1000913362 339
159 3300005339 Ga0070660_100023036 Ga0070660_1000230363 339
160 3300005339 Ga0070660_100089040 Ga0070660_1000890401 339
161 3300005539 Ga0068853_100077770 Ga0068853_1000777703 339
162 3300005616 Ga0068852_100002617 Ga0068852_1000026173 339
163 3300013102 Ga0157371_10000318 Ga0157371_1000031848 339
164 3300013102 Ga0157371_10016729 Ga0157371_100167296 339
165 3300013102 Ga0157371_10033147 Ga0157371_100331473 339
166 3300013102 Ga0157371_10255264 Ga0157371_102552641 339
167 3300013105 Ga0157369_10018092 Ga0157369_100180924 339
168 3300013297 Ga0157378_10098293 Ga0157378_100982933 339
169 3300013307 Ga0157372_10052136 Ga0157372_100521365 339
170 3300013307 Ga0157372_10239553 Ga0157372_102395532 339
171 3300014325 Ga0163163_10281234 Ga0163163_102812342 339
172 3300025904 Ga0207647_10058434 Ga0207647_100584342 339
173 3300025917 Ga0207660_10030171 Ga0207660_100301715 339
174 3300025917 Ga0207660_10120136 Ga0207660_101201363 339
175 3300025919 Ga0207657_10005296 Ga0207657_100052963 339
176 3300025919 Ga0207657_10053889 Ga0207657_100538894 339
177 3300025921 Ga0207652_10021964 Ga0207652_100219642 339
178 3300025944 Ga0207661_10164698 Ga0207661_101646981 339
179 3300049571 Ga0501034_0162787 Ga0501034_0162787_27_1058 339
180 3300049586 Ga0501070_0143939 Ga0501070_0143939_16_1047 339
181 3300049823 Ga0501044_0060128 Ga0501044_0060128_845_1876 339
182 3300005327 Ga0070658_10344770 Ga0070658_103447701 340
183 3300005329 Ga0070683_100000211 Ga0070683_10000021123 340
184 3300005329 Ga0070683_100003981 Ga0070683_10000398111 340
185 3300005330 Ga0070690_100019967 Ga0070690_1000199673 340
186 3300005331 Ga0070670_100102221 Ga0070670_1001022213 340
187 3300005334 Ga0068869_100016129 Ga0068869_1000161293 340
188 3300005334 Ga0068869_100043864 Ga0068869_1000438643 340
189 3300005335 Ga0070666_10002600 Ga0070666_100026005 340
190 3300005336 Ga0070680_100025265 Ga0070680_1000252653 340
191 3300005338 Ga0068868_100008958 Ga0068868_1000089583 340
192 3300005338 Ga0068868_100012580 Ga0068868_1000125804 340
193 3300005340 Ga0070689_100004082 Ga0070689_1000040823 340
194 3300005340 Ga0070689_100262164 Ga0070689_1002621641 340
195 3300005340 Ga0070689_100292646 Ga0070689_1002926461 340
196 3300005344 Ga0070661_100004977 Ga0070661_1000049776 340
197 3300005354 Ga0070675_100078766 Ga0070675_1000787662 340
198 3300005354 Ga0070675_100359161 Ga0070675_1003591611 340
199 3300005355 Ga0070671_100073189 Ga0070671_1000731893 340
200 3300005355 Ga0070671_100102273 Ga0070671_1001022733 340
201 3300005364 Ga0070673_100041322 Ga0070673_1000413221 340
202 3300005364 Ga0070673_100061030 Ga0070673_1000610303 340
203 3300005364 Ga0070673_100210194 Ga0070673_1002101942 340
204 3300005365 Ga0070688_100025164 Ga0070688_1000251644 340
205 3300005365 Ga0070688_100054822 Ga0070688_1000548223 340
206 3300005365 Ga0070688_100055470 Ga0070688_1000554703 340
207 3300005366 Ga0070659_100029805 Ga0070659_1000298053 340
208 3300005367 Ga0070667_100267922 Ga0070667_1002679221 340
209 3300005456 Ga0070678_100159763 Ga0070678_1001597632 340
210 3300005457 Ga0070662_100032018 Ga0070662_1000320183 340
211 3300005459 Ga0068867_100012240 Ga0068867_1000122406 340
212 3300005466 Ga0070685_10038976 Ga0070685_100389762 340
213 3300005466 Ga0070685_10155728 Ga0070685_101557282 340
214 3300005530 Ga0070679_100043059 Ga0070679_1000430594 340
215 3300005535 Ga0070684_100000568 Ga0070684_10000056815 340
216 3300005535 Ga0070684_100304437 Ga0070684_1003044371 340
217 3300005539 Ga0068853_100007326 Ga0068853_1000073265 340
218 3300005548 Ga0070665_100073574 Ga0070665_1000735743 340
219 3300005563 Ga0068855_100021324 Ga0068855_1000213243 340
220 3300005564 Ga0070664_100001475 Ga0070664_1000014756 340
221 3300005564 Ga0070664_100029557 Ga0070664_1000295573 340
222 3300005564 Ga0070664_100044587 Ga0070664_1000445873 340
223 3300005577 Ga0068857_100001702 Ga0068857_1000017024 340
224 3300005577 Ga0068857_100186025 Ga0068857_1001860252 340
225 3300005578 Ga0068854_100074676 Ga0068854_1000746763 340
226 3300005614 Ga0068856_100031637 Ga0068856_1000316378 340
227 3300005614 Ga0068856_100341322 Ga0068856_1003413221 340
228 3300005616 Ga0068852_100027499 Ga0068852_1000274993 340
229 3300005617 Ga0068859_100012688 Ga0068859_1000126886 340
230 3300005617 Ga0068859_100101819 Ga0068859_1001018193 340
231 3300005841 Ga0068863_100133973 Ga0068863_1001339732 340
232 3300005841 Ga0068863_100234916 Ga0068863_1002349162 340
233 3300005842 Ga0068858_100009912 Ga0068858_1000099126 340
234 3300005842 Ga0068858_100033527 Ga0068858_1000335275 340
235 3300006237 Ga0097621_100026043 Ga0097621_1000260435 340
236 3300006237 Ga0097621_100032016 Ga0097621_1000320165 340
237 3300006881 Ga0068865_100154890 Ga0068865_1001548902 340
238 3300006931 Ga0097620_100012688 Ga0097620_1000126886 340
239 3300006931 Ga0097620_100101815 Ga0097620_1001018152 340
240 3300009174 Ga0105241_10121601 Ga0105241_101216012 340
241 3300009176 Ga0105242_10046111 Ga0105242_100461113 340
242 3300009553 Ga0105249_10215614 Ga0105249_102156141 340
243 3300010375 Ga0105239_10046154 Ga0105239_100461543 340
244 3300010375 Ga0105239_10204231 Ga0105239_102042313 340
245 3300013102 Ga0157371_10041477 Ga0157371_100414773 340
246 3300013104 Ga0157370_10001314 Ga0157370_1000131427 340
247 3300013105 Ga0157369_10107989 Ga0157369_101079892 340
248 3300013296 Ga0157374_10083999 Ga0157374_100839993 340
249 3300013296 Ga0157374_10113242 Ga0157374_101132421 340
250 3300013297 Ga0157378_10033743 Ga0157378_100337433 340
251 3300013306 Ga0163162_10004586 Ga0163162_100045863 340
252 3300013306 Ga0163162_10032092 Ga0163162_100320925 340
253 3300013307 Ga0157372_10085072 Ga0157372_100850722 340
254 3300013307 Ga0157372_10092796 Ga0157372_100927964 340
255 3300013308 Ga0157375_10008784 Ga0157375_100087846 340
256 3300013308 Ga0157375_10012199 Ga0157375_100121995 340
257 3300013308 Ga0157375_10153458 Ga0157375_101534583 340
258 3300014745 Ga0157377_10012210 Ga0157377_100122104 340
259 3300014745 Ga0157377_10014418 Ga0157377_100144183 340
260 3300014745 Ga0157377_10133567 Ga0157377_101335672 340
261 3300014968 Ga0157379_10083882 Ga0157379_100838823 340
262 3300014969 Ga0157376_10019448 Ga0157376_100194484 340
263 3300014969 Ga0157376_10108796 Ga0157376_101087963 340
264 3300017792 Ga0163161_10055618 Ga0163161_100556183 340
265 3300017792 Ga0163161_10062533 Ga0163161_100625333 340
266 3300025903 Ga0207680_10104297 Ga0207680_101042972 340
267 3300025904 Ga0207647_10013381 Ga0207647_100133816 340
268 3300025909 Ga0207705_10018554 Ga0207705_100185548 340
269 3300025909 Ga0207705_10039922 Ga0207705_100399223 340
270 3300025913 Ga0207695_10195741 Ga0207695_101957412 340
271 3300025917 Ga0207660_10008625 Ga0207660_100086256 340
272 3300025920 Ga0207649_10001781 Ga0207649_1000178110 340
273 3300025921 Ga0207652_10000171 Ga0207652_1000017125 340
274 3300025926 Ga0207659_10058014 Ga0207659_100580143 340
275 3300025932 Ga0207690_10016583 Ga0207690_100165834 340
276 3300025933 Ga0207706_10003848 Ga0207706_100038486 340
277 3300025936 Ga0207670_10011502 Ga0207670_100115023 340
278 3300025936 Ga0207670_10021624 Ga0207670_100216245 340
279 3300025938 Ga0207704_10029667 Ga0207704_100296673 340
280 3300025940 Ga0207691_10050518 Ga0207691_100505183 340
281 3300025942 Ga0207689_10003496 Ga0207689_100034967 340
282 3300025942 Ga0207689_10058714 Ga0207689_100587143 340
283 3300025944 Ga0207661_10000688 Ga0207661_1000068817 340
284 3300025944 Ga0207661_10094009 Ga0207661_100940092 340
285 3300025945 Ga0207679_10000391 Ga0207679_1000039120 340
286 3300025949 Ga0207667_10000539 Ga0207667_1000053928 340
287 3300025949 Ga0207667_10026698 Ga0207667_100266986 340
288 3300025961 Ga0207712_10158219 Ga0207712_101582192 340
289 3300025981 Ga0207640_10040775 Ga0207640_100407752 340
290 3300025986 Ga0207658_10103401 Ga0207658_101034011 340
291 3300025986 Ga0207658_10187250 Ga0207658_101872501 340
292 3300025986 Ga0207658_10203834 Ga0207658_102038342 340
293 3300026023 Ga0207677_10008332 Ga0207677_100083325 340
294 3300026023 Ga0207677_10159513 Ga0207677_101595132 340
295 3300026041 Ga0207639_10003619 Ga0207639_100036197 340
296 3300026078 Ga0207702_10033398 Ga0207702_100333985 340
297 3300026088 Ga0207641_10190241 Ga0207641_101902412 340
298 3300026089 Ga0207648_10028275 Ga0207648_100282756 340
299 3300026095 Ga0207676_10002355 Ga0207676_1000235511 340
300 3300026116 Ga0207674_10001890 Ga0207674_1000189012 340
301 3300026116 Ga0207674_10038548 Ga0207674_100385483 340
302 3300026116 Ga0207674_10331552 Ga0207674_103315521 340
303 3300026121 Ga0207683_10019477 Ga0207683_100194776 340
304 3300028379 Ga0268266_10026586 Ga0268266_100265862 340
305 3300028379 Ga0268266_10099447 Ga0268266_100994472 340
306 3300037418 Ga0395900_0148974 Ga0395900_0148974_1278_2309 340
307 3300037466 Ga0395898_0029934 Ga0395898_0029934_2450_3481 340
308 3300037466 Ga0395898_0118591 Ga0395898_0118591_1324_2355 340
309 3300048913 Ga0496110_0274859 Ga0496110_0274859_249_1280 340
310 3300005327 Ga0070658_10036387 Ga0070658_100363874 341
311 3300005327 Ga0070658_10079891 Ga0070658_100798912 341
312 3300005331 Ga0070670_100043976 Ga0070670_1000439761 341
313 3300005341 Ga0070691_10032536 Ga0070691_100325363 341
314 3300005356 Ga0070674_100151917 Ga0070674_1001519172 341
315 3300005530 Ga0070679_100059125 Ga0070679_1000591254 341
316 3300005539 Ga0068853_100031245 Ga0068853_1000312454 341
317 3300005547 Ga0070693_100003857 Ga0070693_1000038575 341
318 3300005563 Ga0068855_100020250 Ga0068855_1000202506 341
319 3300005719 Ga0068861_100050719 Ga0068861_1000507194 341
320 3300006237 Ga0097621_100027647 Ga0097621_1000276475 341
321 3300006358 Ga0068871_100011135 Ga0068871_1000111353 341
322 3300009093 Ga0105240_10002244 Ga0105240_1000224419 341
323 3300009174 Ga0105241_10006152 Ga0105241_100061522 341
324 3300013102 Ga0157371_10000656 Ga0157371_1000065626 341
325 3300013102 Ga0157371_10081834 Ga0157371_100818342 341
326 3300013104 Ga0157370_10000916 Ga0157370_1000091628 341
327 3300013104 Ga0157370_10001221 Ga0157370_1000122125 341
328 3300013296 Ga0157374_10012169 Ga0157374_100121695 341
329 3300013306 Ga0163162_10153822 Ga0163162_101538223 341
330 3300013306 Ga0163162_10416009 Ga0163162_104160092 341
331 3300013307 Ga0157372_10009417 Ga0157372_100094172 341
332 3300014325 Ga0163163_10000462 Ga0163163_1000046210 341
333 3300014969 Ga0157376_10022999 Ga0157376_100229996 341
334 3300017792 Ga0163161_10061115 Ga0163161_100611152 341
335 3300025909 Ga0207705_10059637 Ga0207705_100596372 341
336 3300025909 Ga0207705_10143214 Ga0207705_101432142 341
337 3300025912 Ga0207707_10012595 Ga0207707_100125953 341
338 3300025913 Ga0207695_10011412 Ga0207695_100114128 341
339 3300025914 Ga0207671_10184078 Ga0207671_101840783 341
340 3300025917 Ga0207660_10035020 Ga0207660_100350203 341
341 3300025919 Ga0207657_10208763 Ga0207657_102087632 341
342 3300025921 Ga0207652_10000016 Ga0207652_10000016131 341
343 3300025921 Ga0207652_10014701 Ga0207652_100147017 341
344 3300025932 Ga0207690_10065477 Ga0207690_100654771 341
345 3300025942 Ga0207689_10003166 Ga0207689_100031663 341
346 3300025949 Ga0207667_10023424 Ga0207667_100234246 341
347 3300025972 Ga0207668_10214169 Ga0207668_102141692 341
348 3300026041 Ga0207639_10023014 Ga0207639_100230144 341
349 3300026067 Ga0207678_10055656 Ga0207678_100556563 341
350 3300026089 Ga0207648_10151774 Ga0207648_101517741 341
351 3300026118 Ga0207675_100066529 Ga0207675_1000665294 341
352 3300037312 Ga0395899_0011529 Ga0395899_0011529_473_1510 341
353 3300037312 Ga0395899_0013887 Ga0395899_0013887_4092_5129 341
354 3300037418 Ga0395900_0018416 Ga0395900_0018416_5391_6428 341
355 3300037418 Ga0395900_0038608 Ga0395900_0038608_2990_4027 341
356 3300037466 Ga0395898_0007047 Ga0395898_0007047_6678_7715 341
357 3300038443 Ga0395901_0016817 Ga0395901_0016817_1976_3013 341
358 3300038443 Ga0395901_0112626 Ga0395901_0112626_1558_2595 341
359 3300044842 Ga0466957_0000460 Ga0466957_0000460_3038_4093 341
360 3300046616 Ga0495668_0001051 Ga0495668_0001051_14594_15628 341
361 3300047317 Ga0495604_0097861 Ga0495604_0097861_845_1951 341
362 3300005843 Ga0068860_100236193 Ga0068860_1002361932 342
363 3300014969 Ga0157376_10166843 Ga0157376_101668432 342
364 3300036401 Ga0373937_0405762 Ga0373937_0405762_202_1239 342
365 3300011119 Ga0105246_10010026 Ga0105246_100100266 344
366 iso_pu_bacteria 2738541278 2738727818 344
367 3300003323 rootH1_10021375 rootH1_100213755 348
368 3300005468 Ga0070707_100466875 Ga0070707_1004668751 348
369 3300030522 Ga0307512_10044885 Ga0307512_100448851 348
370 3300031507 Ga0307509_10044028 Ga0307509_100440288 348
371 3300041509 Ga0451843_1472935 Ga0451843_1472935_46_1101 348
372 3300041512 Ga0451853_1888965 Ga0451853_1888965_261_1313 348
373 3300044656 Ga0466969_0000091 Ga0466969_0000091_16804_17859 348
374 3300044706 Ga0466964_0005934 Ga0466964_0005934_3422_4477 348
375 3300044735 Ga0466968_0049820 Ga0466968_0049820_163_1218 348
376 3300049705 Ga0501225_0001093 Ga0501225_0001093_3973_5019 348
377 3300053086 Ga0500578_0000019 Ga0500578_0000019_21393_22439 348

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02618

YceG

YceG-like family

60

348

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r1f-assembly1.cif.gz_A crystal structure of predicted aminodeoxychorismate lyase from escherichia coli 0.7433 79 334
2r1f-assembly1.cif.gz_A crystal structure of predicted aminodeoxychorismate lyase from escherichia coli 0.7307 79 334
4iiw-assembly1.cif.gz_A-5 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.6544 34 323
4iiw-assembly1.cif.gz_B 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.6332 32 322
4iiw-assembly1.cif.gz_A-5 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.626 34 323
ID Description Score Start End Superfamily
2r1fA03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.9336 298 334 3.30.160.60
2r1fB03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.9163 298 331 3.30.160.60
2r1fA03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.8253 298 334 3.30.160.60
2r1fB03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.7487 298 331 3.30.160.60
2o6iB02 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.1756 51 187 1.20.1250.30
ID Description Score Start End GO Terms
AF-A0A3M1N9R3-F1-model_v4 Endolytic transglycosylase MltG 0.9953 200 338 GO:0005886
GO:0016829
GO:0071555
AF-A0A7V4BS14-F1-model_v4 Endolytic transglycosylase MltG 0.9947 216 340 GO:0005886
GO:0016829
GO:0071555
AF-A0A1V5MSD2-F1-model_v4 Putative aminodeoxychorismate lyase 0.99 159 334 GO:0005886
GO:0016829
GO:0071555
AF-A0A7C5YDZ3-F1-model_v4 Endolytic transglycosylase MltG 0.982 201 340 GO:0005886
GO:0016829
GO:0071555
AF-A0A3M1N9R3-F1-model_v4 Endolytic transglycosylase MltG 0.9812 200 338 GO:0005886
GO:0016829
GO:0071555

Feature Viewer

pLDDT pTM Quality
93.4 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map