F427701

General Info

Members Datasets Scaffolds Average Seq Length
377 212 371 252

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10487292|Ga0157376_104872921
Length 281
Sequence MEFRRGAETRTRGRVRFPDKGNLGARFVSTMNFRLRIWRQSDRKSKGKLVEYKANNISPDTSFLEMLDIVNDELTAHGEAPIAFDSDCREGICGTCALTINGQAHGPKHPAAACQLYMRSFRNGETITIEPFRAKPFPLVRDLVIDRSALDRIVQAGGFIAARAGSAPEANSIPVPKHNADLAMEAAACIGCGACAAACPNASAMLFTAAKVSHLAFLPQGAPERTSRALKMVRQMDAEGFGNCTNTYECEAVCPAEISASFIAKLNREYARGVLQRSAGD

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2619618881 Frankia sp. ACN1ag Isolate Unclassified
3 2619619003 Frankia sp. CpI1-P Isolate Nodule
4 2626541554 Frankia sp. AvcI.1 Isolate Nodule
5 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
6 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
7 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0.53
Rhizoplane 6.9
Rhizosphere 86.47
Stem 0
Stem Tuber 0
Unclassified 3.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000003 3300000545 Bacteria 49535
2 JGI24746J21847_1009568 3300001977 Unclassified 1445
3 JGI24035J26624_1000974 3300002126 Bacteria 2695
4 Ga0055530_10012827 3300003791 Bacteria 2900
5 Ga0065704_10003787 3300005289 Bacteria 6546
6 Ga0065712_10035041 3300005290 Bacteria 1145
7 Ga0065712_10145176 3300005290 Bacteria 1415
8 Ga0065707_10145536 3300005295 Unclassified 1719
9 Ga0070658_10000530 3300005327 Bacteria 33125
10 Ga0070658_10203513 3300005327 Bacteria 1671
11 Ga0070676_10004347 3300005328 Bacteria 7442
12 Ga0070676_10075069 3300005328 Unclassified 2037
13 Ga0070683_100189964 3300005329 Bacteria 1950
14 Ga0070683_100481697 3300005329 Bacteria 1185
15 Ga0070690_100344812 3300005330 Bacteria 1079
16 Ga0070670_100021804 3300005331 Bacteria 5509
17 Ga0070670_100101492 3300005331 Bacteria 2477
18 Ga0070670_100154560 3300005331 Bacteria 1986
19 Ga0070670_100468783 3300005331 Bacteria 1117
20 Ga0068869_100039890 3300005334 Bacteria 3354
21 Ga0070666_10061434 3300005335 Bacteria 2544
22 Ga0070666_10210691 3300005335 Unclassified 1368
23 Ga0068868_100012120 3300005338 Bacteria 6295
24 Ga0068868_100204027 3300005338 Unclassified 1649
25 Ga0068868_100287230 3300005338 Bacteria 1394
26 Ga0068868_100891667 3300005338 Unclassified 808
27 Ga0070660_100092404 3300005339 Bacteria 2388
28 Ga0070660_100208676 3300005339 Bacteria 1585
29 Ga0070689_100025438 3300005340 Bacteria 4447
30 Ga0070689_100072245 3300005340 Bacteria 2696
31 Ga0070689_100112416 3300005340 Bacteria 2168
32 Ga0070687_100007919 3300005343 Bacteria 4470
33 Ga0070661_100192277 3300005344 Bacteria 1557
34 Ga0070668_100009539 3300005347 Bacteria 7202
35 Ga0070668_100019314 3300005347 Bacteria 5129
36 Ga0070668_100340611 3300005347 Bacteria 1267
37 Ga0070669_100000680 3300005353 Bacteria 24869
38 Ga0070675_100003479 3300005354 Bacteria 11943
39 Ga0070675_100008533 3300005354 Bacteria 7953
40 Ga0070675_100023107 3300005354 Bacteria 4969
41 Ga0070675_100198211 3300005354 Unclassified 1742
42 Ga0070675_100462837 3300005354 Unclassified 1139
43 Ga0070671_100082303 3300005355 Unclassified 2691
44 Ga0070671_100088922 3300005355 Bacteria 2585
45 Ga0070671_100193540 3300005355 Bacteria 1724
46 Ga0070674_100010459 3300005356 Bacteria 5611
47 Ga0070673_100031295 3300005364 Bacteria 3991
48 Ga0070673_100204281 3300005364 Bacteria 1703
49 Ga0070688_100003706 3300005365 Bacteria 7902
50 Ga0070688_100073501 3300005365 Bacteria 2193
51 Ga0070688_100168626 3300005365 Unclassified 1509
52 Ga0070659_100012366 3300005366 Bacteria 6327
53 Ga0070667_100030003 3300005367 Bacteria 4535
54 Ga0070667_100145187 3300005367 Bacteria 2080
55 Ga0070667_100334609 3300005367 Unclassified 1368
56 Ga0070709_10608597 3300005434 Bacteria 842
57 Ga0070714_100035144 3300005435 Bacteria 4199
58 Ga0070713_100092742 3300005436 Bacteria 2601
59 Ga0070711_100330153 3300005439 Bacteria 1221
60 Ga0070705_100284355 3300005440 Unclassified 1177
61 Ga0070708_100014073 3300005445 Bacteria 6574
62 Ga0070708_100065350 3300005445 Bacteria 3262
63 Ga0070708_100102377 3300005445 Bacteria 2624
64 Ga0070708_100302601 3300005445 Bacteria 1506
65 Ga0070708_100408268 3300005445 Unclassified 1281
66 Ga0070678_100032570 3300005456 Bacteria 3608
67 Ga0070662_100018702 3300005457 Bacteria 4691
68 Ga0070662_100031508 3300005457 Bacteria 3722
69 Ga0070681_10573496 3300005458 Unclassified 1042
70 Ga0068867_100062939 3300005459 Bacteria 2758
71 Ga0068867_100416656 3300005459 Unclassified 1137
72 Ga0070706_100000035 3300005467 Bacteria 152107
73 Ga0070706_100007330 3300005467 Bacteria 10348
74 Ga0070706_100075049 3300005467 Bacteria 3129
75 Ga0070706_100091962 3300005467 Bacteria 2814
76 Ga0070706_100121418 3300005467 Bacteria 2435
77 Ga0070707_100075067 3300005468 Bacteria 3260
78 Ga0070707_100077351 3300005468 Bacteria 3210
79 Ga0070698_100004983 3300005471 Bacteria 14549
80 Ga0070698_100018577 3300005471 Bacteria 7319
81 Ga0070699_100070633 3300005518 Bacteria 3036
82 Ga0070699_100128787 3300005518 Bacteria 2230
83 Ga0070697_100034546 3300005536 Bacteria 4077
84 Ga0070697_100063256 3300005536 Bacteria 3021
85 Ga0070697_100092273 3300005536 Bacteria 2505
86 Ga0070697_100181992 3300005536 Bacteria 1781
87 Ga0068853_100000038 3300005539 Bacteria 107719
88 Ga0068853_100804611 3300005539 Bacteria 900
89 Ga0070672_100016442 3300005543 Bacteria 5297
90 Ga0070672_100042681 3300005543 Bacteria 3493
91 Ga0070672_100297281 3300005543 Bacteria 1368
92 Ga0070693_100049514 3300005547 Bacteria 2397
93 Ga0070665_100142485 3300005548 Bacteria 2400
94 Ga0070665_100483234 3300005548 Bacteria 1249
95 Ga0070665_100756514 3300005548 Unclassified 985
96 Ga0070704_100050723 3300005549 Bacteria 2918
97 Ga0068855_100253116 3300005563 Unclassified 1964
98 Ga0070664_100047210 3300005564 Bacteria 3638
99 Ga0068856_100370237 3300005614 Unclassified 1452
100 Ga0068861_100023035 3300005719 Bacteria 4490
101 Ga0068858_100088553 3300005842 Bacteria 2880
102 Ga0068858_100452718 3300005842 Bacteria 1237
103 Ga0068860_100187635 3300005843 Bacteria 2000
104 Ga0068860_100279259 3300005843 Bacteria 1632
105 Ga0081540_1010438 3300005983 Bacteria 6291
106 Ga0081539_10001786 3300005985 Bacteria 34126
107 Ga0081539_10035082 3300005985 Bacteria 3020
108 Ga0070717_10004678 3300006028 Bacteria 9934
109 Ga0070717_10006553 3300006028 Bacteria 8575
110 Ga0070715_10070021 3300006163 Unclassified 1564
111 Ga0070716_100236427 3300006173 Bacteria 1236
112 Ga0070716_100304018 3300006173 Bacteria 1111
113 Ga0070712_100020668 3300006175 Bacteria 4311
114 Ga0070712_100344160 3300006175 Bacteria 1218
115 Ga0075362_10091049 3300006177 Bacteria 1416
116 Ga0075366_10095861 3300006195 Bacteria 1779
117 Ga0097621_100072964 3300006237 Bacteria 2840
118 Ga0097621_100103184 3300006237 Bacteria 2402
119 Ga0097621_100721825 3300006237 Bacteria 919
120 Ga0068871_100021406 3300006358 Bacteria 4969
121 Ga0068871_100167985 3300006358 Bacteria 1879
122 Ga0075430_100572354 3300006846 Bacteria 932
123 Ga0075431_100098074 3300006847 Bacteria 3026
124 Ga0075436_100022375 3300006914 Bacteria 4342
125 Ga0075435_100295856 3300007076 Unclassified 1384
126 Ga0075435_100582266 3300007076 Bacteria 970
127 Ga0099795_10022778 3300007788 Bacteria 2071
128 Ga0105245_10023881 3300009098 Bacteria 5366
129 Ga0105245_10229946 3300009098 Unclassified 1793
130 Ga0105245_10378611 3300009098 Bacteria 1409
131 Ga0105243_10026373 3300009148 Bacteria 4447
132 Ga0105242_10007827 3300009176 Bacteria 8223
133 Ga0105242_10200151 3300009176 Unclassified 1774
134 Ga0105248_10435795 3300009177 Unclassified 1476
135 Ga0105238_10378538 3300009551 Bacteria 1407
136 Ga0105249_10001222 3300009553 Bacteria 22630
137 Ga0105239_10039341 3300010375 Bacteria 5182
138 Ga0105239_10385444 3300010375 Bacteria 1585
139 Ga0105239_10536460 3300010375 Bacteria 1332
140 Ga0157373_10409329 3300013100 Bacteria 973
141 Ga0157374_10014791 3300013296 Bacteria 6834
142 Ga0157374_10033225 3300013296 Bacteria 4706
143 Ga0157374_10048717 3300013296 Bacteria 3933
144 Ga0157374_10114958 3300013296 Bacteria 2592
145 Ga0157374_10116768 3300013296 Bacteria 2571
146 Ga0157374_10307083 3300013296 Bacteria 1570
147 Ga0157374_10753289 3300013296 Unclassified 989
148 Ga0157378_10033959 3300013297 Bacteria 4512
149 Ga0157378_10271487 3300013297 Bacteria 1631
150 Ga0157378_10450729 3300013297 Bacteria 1277
151 Ga0157378_10623430 3300013297 Bacteria 1092
152 Ga0163162_10006259 3300013306 Bacteria 11539
153 Ga0163162_10009817 3300013306 Bacteria 9313
154 Ga0163162_10146499 3300013306 Bacteria 2478
155 Ga0163162_10451486 3300013306 Bacteria 1417
156 Ga0163162_10679159 3300013306 Bacteria 1152
157 Ga0157372_10090259 3300013307 Bacteria 3483
158 Ga0157375_10014810 3300013308 Bacteria 6967
159 Ga0157375_10159643 3300013308 Bacteria 2396
160 Ga0157375_10443947 3300013308 Bacteria 1463
161 Ga0157375_10570107 3300013308 Bacteria 1293
162 Ga0157375_10719114 3300013308 Bacteria 1151
163 Ga0157377_10186796 3300014745 Bacteria 1307
164 Ga0157376_10053765 3300014969 Bacteria 3355
165 Ga0157376_10061809 3300014969 Bacteria 3149
166 Ga0157376_10112733 3300014969 Bacteria 2396
167 Ga0157376_10487292 3300014969 Bacteria 1209
168 Ga0163161_10024935 3300017792 Bacteria 4228
169 Ga0213874_10016495 3300021377 Bacteria 1967
170 Ga0207666_1003080 3300025271 Bacteria 2031
171 Ga0207666_1009061 3300025271 Unclassified 1339
172 Ga0207673_1013943 3300025290 Bacteria 1058
173 Ga0209050_1000921 3300025298 Bacteria 38728
174 Ga0207697_10000080 3300025315 Bacteria 42127
175 Ga0207697_10000196 3300025315 Bacteria 32121
176 Ga0207697_10001360 3300025315 Bacteria 13398
177 Ga0207697_10003107 3300025315 Bacteria 8303
178 Ga0207697_10131462 3300025315 Unclassified 1082
179 Ga0207682_10178944 3300025893 Unclassified 968
180 Ga0207688_10036449 3300025901 Bacteria 2726
181 Ga0207688_10125815 3300025901 Bacteria 1499
182 Ga0207680_10013544 3300025903 Bacteria 4194
183 Ga0207680_10147314 3300025903 Bacteria 1566
184 Ga0207680_10231756 3300025903 Bacteria 1269
185 Ga0207645_10000462 3300025907 Bacteria 33661
186 Ga0207645_10006456 3300025907 Bacteria 8413
187 Ga0207645_10006885 3300025907 Bacteria 8107
188 Ga0207645_10028263 3300025907 Bacteria 3621
189 Ga0207705_10005613 3300025909 Bacteria 9371
190 Ga0207684_10000043 3300025910 Bacteria 259939
191 Ga0207684_10002423 3300025910 Bacteria 18811
192 Ga0207684_10011330 3300025910 Bacteria 7804
193 Ga0207684_10062646 3300025910 Bacteria 3158
194 Ga0207684_10084370 3300025910 Bacteria 2705
195 Ga0207684_10095004 3300025910 Bacteria 2543
196 Ga0207693_10009439 3300025915 Bacteria 7950
197 Ga0207693_10106959 3300025915 Bacteria 2194
198 Ga0207693_10163339 3300025915 Bacteria 1753
199 Ga0207663_10128341 3300025916 Bacteria 1748
200 Ga0207663_10403948 3300025916 Bacteria 1045
201 Ga0207663_10439726 3300025916 Bacteria 1004
202 Ga0207662_10005775 3300025918 Bacteria 6623
203 Ga0207649_10437873 3300025920 Bacteria 984
204 Ga0207646_10004744 3300025922 Bacteria 14638
205 Ga0207646_10058859 3300025922 Bacteria 3431
206 Ga0207646_10113124 3300025922 Bacteria 2437
207 Ga0207646_10174886 3300025922 Bacteria 1939
208 Ga0207646_10199063 3300025922 Bacteria 1809
209 Ga0207681_10007726 3300025923 Bacteria 6585
210 Ga0207681_10016086 3300025923 Bacteria 4673
211 Ga0207681_10025018 3300025923 Bacteria 3836
212 Ga0207650_10031790 3300025925 Bacteria 3814
213 Ga0207659_10016425 3300025926 Bacteria 4818
214 Ga0207659_10184144 3300025926 Bacteria 1657
215 Ga0207659_10210743 3300025926 Bacteria 1557
216 Ga0207687_10099860 3300025927 Bacteria 2133
217 Ga0207700_10070650 3300025928 Bacteria 2685
218 Ga0207664_10033328 3300025929 Bacteria 3956
219 Ga0207664_10832931 3300025929 Bacteria 829
220 Ga0207644_10004792 3300025931 Bacteria 8806
221 Ga0207644_10217870 3300025931 Bacteria 1512
222 Ga0207644_10585571 3300025931 Bacteria 925
223 Ga0207690_10057477 3300025932 Unclassified 2628
224 Ga0207706_10000188 3300025933 Bacteria 68890
225 Ga0207706_10031533 3300025933 Bacteria 4721
226 Ga0207706_10566350 3300025933 Unclassified 977
227 Ga0207670_10367239 3300025936 Bacteria 1143
228 Ga0207669_10228325 3300025937 Bacteria 1371
229 Ga0207704_10148524 3300025938 Bacteria 1650
230 Ga0207665_10004579 3300025939 Bacteria 9179
231 Ga0207665_10101960 3300025939 Bacteria 2005
232 Ga0207665_10216752 3300025939 Unclassified 1401
233 Ga0207691_10010103 3300025940 Bacteria 9058
234 Ga0207691_10019761 3300025940 Bacteria 6370
235 Ga0207691_10040316 3300025940 Bacteria 4315
236 Ga0207691_10211064 3300025940 Bacteria 1686
237 Ga0207711_10049976 3300025941 Bacteria 3580
238 Ga0207689_10132178 3300025942 Bacteria 2054
239 Ga0207661_10158730 3300025944 Bacteria 1961
240 Ga0207667_10893648 3300025949 Bacteria 880
241 Ga0207651_10047455 3300025960 Bacteria 2896
242 Ga0207651_10140335 3300025960 Bacteria 1865
243 Ga0207651_10177367 3300025960 Bacteria 1686
244 Ga0207651_10445334 3300025960 Bacteria 1110
245 Ga0207712_10006867 3300025961 Bacteria 7186
246 Ga0207668_10003913 3300025972 Bacteria 8782
247 Ga0207668_10280878 3300025972 Bacteria 1365
248 Ga0207658_10029934 3300025986 Bacteria 3850
249 Ga0207658_10358520 3300025986 Bacteria 1271
250 Ga0207658_10415971 3300025986 Bacteria 1184
251 Ga0207677_10009298 3300026023 Bacteria 5526
252 Ga0207677_10069758 3300026023 Bacteria 2473
253 Ga0207677_10138937 3300026023 Unclassified 1857
254 Ga0207639_10000061 3300026041 Bacteria 107734
255 Ga0207648_10029759 3300026089 Bacteria 4842
256 Ga0207648_10690009 3300026089 Unclassified 946
257 Ga0207675_101024049 3300026118 Bacteria 844
258 Ga0207683_10029084 3300026121 Bacteria 4782
259 Ga0207683_10282578 3300026121 Unclassified 1516
260 Ga0268266_10021150 3300028379 Bacteria 5543
261 Ga0268266_10029436 3300028379 Bacteria 4668
262 Ga0268265_10019538 3300028380 Bacteria 4712
263 Ga0268264_10065980 3300028381 Bacteria 3051
264 Ga0268264_10278139 3300028381 Bacteria 1566
265 Ga0268264_10280152 3300028381 Bacteria 1561
266 Ga0265337_1002171 3300028556 Bacteria 9190
267 Ga0265319_1000567 3300028563 Bacteria 24971
268 Ga0265334_10094265 3300028573 Bacteria 1089
269 Ga0265318_10049897 3300028577 Bacteria 1574
270 Ga0265323_10000791 3300028653 Bacteria 16941
271 Ga0265323_10011319 3300028653 Bacteria 3602
272 Ga0265323_10020843 3300028653 Bacteria 2518
273 Ga0265322_10000916 3300028654 Bacteria 10365
274 Ga0307515_10043729 3300028794 Bacteria 6951
275 Ga0307515_10225103 3300028794 Bacteria 1683
276 Ga0265338_10000491 3300028800 Bacteria 70632
277 Ga0307512_10006691 3300030522 Bacteria 11603
278 Ga0265330_10047195 3300031235 Bacteria 1896
279 Ga0265320_10011184 3300031240 Bacteria 5292
280 Ga0265329_10038009 3300031242 Bacteria 1549
281 Ga0265316_10013188 3300031344 Bacteria 7360
282 Ga0265316_10135179 3300031344 Bacteria 1855
283 Ga0265316_10272083 3300031344 Bacteria 1239
284 Ga0307513_10008159 3300031456 Bacteria 13439
285 Ga0307509_10103997 3300031507 Bacteria 2866
286 Ga0307508_10007785 3300031616 Bacteria 9953
287 Ga0307508_10330531 3300031616 Bacteria 1116
288 Ga0265314_10035992 3300031711 Bacteria 3603
289 Ga0265314_10054095 3300031711 Bacteria 2780
290 Ga0265314_10085699 3300031711 Bacteria 2064
291 Ga0265314_10085897 3300031711 Bacteria 2062
292 Ga0265342_10061804 3300031712 Bacteria 2206
293 Ga0316576_10054335 3300031727 Bacteria 2921
294 Ga0307516_10026467 3300031730 Bacteria 5888
295 Ga0307416_100013310 3300032002 Bacteria 5588
296 Ga0307415_100149815 3300032126 Bacteria 1794
297 Ga0307510_10199307 3300033180 Bacteria 1539
298 Ga0373938_0073408 3300034957 Bacteria 822
299 Ga0373944_0013021 3300035089 Bacteria 2301
300 Ga0373951_0002295 3300035091 Bacteria 4859
301 Ga0373936_0049856 3300035113 Bacteria 1692
302 Ga0373943_0014285 3300035170 Bacteria 3593
303 Ga0373943_0110780 3300035170 Bacteria 1448
304 Ga0373947_0195831 3300035725 Unclassified 1320
305 Ga0373947_0442878 3300035725 Unclassified 879
306 Ga0373937_0606519 3300036401 Bacteria 1039
307 Ga0373925_0039317 3300037068 Bacteria 3500
308 Ga0395901_0370938 3300038443 Bacteria 1474
309 Ga0436360_0136495 3300039438 Bacteria 6736
310 Ga0436360_0264008 3300039438 Bacteria 6116
311 Ga0436361_0045618 3300039447 Bacteria 2262
312 Ga0436361_0524327 3300039447 Bacteria 3989
313 Ga0436363_0310594 3300039450 Bacteria 845
314 Ga0436363_0955611 3300039450 Bacteria 13242
315 Ga0436362_0503107 3300039453 Bacteria 2270
316 Ga0451577_0023012 3300042876 Bacteria 5687
317 Ga0453684_0030933 3300044712 Bacteria 7545
318 Ga0451576_0000379 3300045051 Bacteria 104282
319 Ga0451576_0024553 3300045051 Bacteria 6510
320 Ga0466967_0305218 3300045976 Bacteria 1532
321 Ga0495603_0063642 3300046455 Bacteria 2176
322 Ga0495653_0169607 3300046463 Bacteria 1508
323 Ga0495594_0023666 3300046499 Bacteria 3293
324 Ga0495628_0471571 3300046516 Bacteria 909
325 Ga0495645_0126147 3300046543 Bacteria 1798
326 Ga0495588_0132483 3300046674 Unclassified 1315
327 Ga0495623_0235108 3300046679 Bacteria 1037
328 Ga0495647_0061810 3300046681 Bacteria 1480
329 Ga0495658_0064880 3300046683 Bacteria 2105
330 Ga0495581_0079932 3300047315 Bacteria 1892
331 Ga0495674_0018437 3300047319 Bacteria 6496
332 Ga0495676_0191522 3300047321 Bacteria 1426
333 Ga0495602_0246998 3300048088 Bacteria 1332
334 Ga0496100_0031240 3300048903 Bacteria 3309
335 Ga0496101_0095708 3300048904 Bacteria 2215
336 Ga0496101_0236724 3300048904 Unclassified 1420
337 Ga0496102_0187917 3300048905 Unclassified 1947
338 Ga0496102_0555854 3300048905 Bacteria 1070
339 Ga0496104_0036073 3300048907 Bacteria 4619
340 Ga0496104_0070861 3300048907 Bacteria 3315
341 Ga0496104_0210827 3300048907 Bacteria 1854
342 Ga0496104_0801368 3300048907 Unclassified 848
343 Ga0496105_0140639 3300048908 Unclassified 1987
344 Ga0496106_0039782 3300048909 Bacteria 3521
345 Ga0496107_0039253 3300048910 Bacteria 3395
346 Ga0496107_0433441 3300048910 Unclassified 977
347 Ga0496108_0000029 3300048911 Bacteria 167261
348 Ga0496109_0068278 3300048912 Bacteria 3259
349 Ga0496109_0409386 3300048912 Bacteria 1281
350 Ga0496109_0416249 3300048912 Unclassified 1270
351 Ga0496109_0448408 3300048912 Bacteria 1219
352 Ga0496110_0630209 3300048913 Unclassified 971
353 Ga0496111_0194998 3300048914 Unclassified 1506
354 Ga0496112_0036564 3300048915 Bacteria 4790
355 Ga0496112_0066172 3300048915 Bacteria 3566
356 Ga0496112_0189360 3300048915 Bacteria 2020
357 Ga0496112_0377866 3300048915 Unclassified 1358
358 Ga0496114_0597597 3300048917 Unclassified 973
359 Ga0496115_0036650 3300048918 Bacteria 3884
360 Ga0501080_0010988 3300049742 Bacteria 8288
361 Ga0501080_0056721 3300049742 Bacteria 3647
362 Ga0501045_0151069 3300049824 Bacteria 1728
363 nmdc:mga03683_24677_c1 3300050489 Bacteria 2354
364 nmdc:mga0k408_101267_c1 3300050493 Bacteria 1698
365 nmdc:mga0k408_1981_c1 3300050493 Bacteria 10986
366 nmdc:mga0k408_413206_c1 3300050493 Bacteria 802
367 nmdc:mga09592_453290_c1 3300050508 Bacteria 1106
368 nmdc:mga0qj67_748206_c1 3300050509 Bacteria 776
369 nmdc:mga0rr50_256576_c1 3300050513 Unclassified 1453
370 nmdc:mga0rr50_564021_c1 3300050513 Bacteria 970
371 nmdc:mga08x19_59844_c1 3300050514 Bacteria 2466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0151069 Ga0501045_0151069_67_759 229
2 3300050508 nmdc:mga09592_453290_c1 nmdc:mga09592_453290_c1_297_986 229
3 3300050509 nmdc:mga0qj67_748206_c1 nmdc:mga0qj67_748206_c1_50_739 229
4 3300005329 Ga0070683_100481697 Ga0070683_1004816972 230
5 3300047315 Ga0495581_0079932 Ga0495581_0079932_1183_1875 230
6 3300026023 Ga0207677_10138937 Ga0207677_101389372 232
7 iso_pu_bacteria 2751185734 2753070623 242
8 iso_pu_bacteria 2579778521 2579853073 244
9 iso_pu_bacteria 2619618881 2619855920 244
10 iso_pu_bacteria 2619619003 2620348362 244
11 iso_pu_bacteria 2626541554 2626635413 244
12 iso_pu_bacteria 2899359706 2899367720 244
13 3300032002 Ga0307416_100013310 Ga0307416_1000133102 246
14 3300032126 Ga0307415_100149815 Ga0307415_1001498152 246
15 3300035091 Ga0373951_0002295 Ga0373951_0002295_3208_3948 246
16 3300005983 Ga0081540_1010438 Ga0081540_10104385 247
17 3300006028 Ga0070717_10006553 Ga0070717_100065532 247
18 3300006846 Ga0075430_100572354 Ga0075430_1005723542 247
19 3300013297 Ga0157378_10450729 Ga0157378_104507292 247
20 3300028794 Ga0307515_10043729 Ga0307515_100437292 247
21 3300030522 Ga0307512_10006691 Ga0307512_100066912 247
22 3300031456 Ga0307513_10008159 Ga0307513_1000815913 247
23 3300031507 Ga0307509_10103997 Ga0307509_101039972 247
24 3300031616 Ga0307508_10007785 Ga0307508_100077855 247
25 3300031616 Ga0307508_10330531 Ga0307508_103305311 247
26 3300031727 Ga0316576_10054335 Ga0316576_100543352 247
27 3300031730 Ga0307516_10026467 Ga0307516_100264673 247
28 3300033180 Ga0307510_10199307 Ga0307510_101993072 247
29 3300005329 Ga0070683_100189964 Ga0070683_1001899642 248
30 3300006847 Ga0075431_100098074 Ga0075431_1000980742 248
31 3300025944 Ga0207661_10158730 Ga0207661_101587302 248
32 3300028556 Ga0265337_1002171 Ga0265337_10021716 248
33 3300028800 Ga0265338_10000491 Ga0265338_1000049166 248
34 3300031240 Ga0265320_10011184 Ga0265320_100111844 248
35 3300031711 Ga0265314_10085699 Ga0265314_100856992 248
36 3300034957 Ga0373938_0073408 Ga0373938_0073408_59_808 248
37 3300046463 Ga0495653_0169607 Ga0495653_0169607_181_927 248
38 3300046499 Ga0495594_0023666 Ga0495594_0023666_2421_3170 248
39 3300046679 Ga0495623_0235108 Ga0495623_0235108_95_841 248
40 3300047319 Ga0495674_0018437 Ga0495674_0018437_1736_2482 248
41 3300047321 Ga0495676_0191522 Ga0495676_0191522_449_1195 248
42 3300048088 Ga0495602_0246998 Ga0495602_0246998_42_788 248
43 3300048911 Ga0496108_0000029 Ga0496108_0000029_11468_12217 248
44 3300049742 Ga0501080_0010988 Ga0501080_0010988_4945_5697 248
45 3300003791 Ga0055530_10012827 Ga0055530_100128272 249
46 3300005327 Ga0070658_10000530 Ga0070658_1000053015 249
47 3300005327 Ga0070658_10203513 Ga0070658_102035133 249
48 3300005331 Ga0070670_100468783 Ga0070670_1004687832 249
49 3300005339 Ga0070660_100208676 Ga0070660_1002086762 249
50 3300005548 Ga0070665_100142485 Ga0070665_1001424852 249
51 3300006177 Ga0075362_10091049 Ga0075362_100910492 249
52 3300006195 Ga0075366_10095861 Ga0075366_100958612 249
53 3300009551 Ga0105238_10378538 Ga0105238_103785382 249
54 3300010375 Ga0105239_10536460 Ga0105239_105364602 249
55 3300013296 Ga0157374_10307083 Ga0157374_103070832 249
56 3300013306 Ga0163162_10451486 Ga0163162_104514862 249
57 3300013308 Ga0157375_10719114 Ga0157375_107191142 249
58 3300025298 Ga0209050_1000921 Ga0209050_100092127 249
59 3300025909 Ga0207705_10005613 Ga0207705_100056137 249
60 3300025939 Ga0207665_10216752 Ga0207665_102167521 249
61 3300025949 Ga0207667_10893648 Ga0207667_108936481 249
62 3300049742 Ga0501080_0056721 Ga0501080_0056721_2866_3615 249
63 3300050489 nmdc:mga03683_24677_c1 nmdc:mga03683_24677_c1_49_798 249
64 3300050493 nmdc:mga0k408_101267_c1 nmdc:mga0k408_101267_c1_459_1208 249
65 3300050493 nmdc:mga0k408_413206_c1 nmdc:mga0k408_413206_c1_40_789 249
66 3300005434 Ga0070709_10608597 Ga0070709_106085971 250
67 3300005439 Ga0070711_100330153 Ga0070711_1003301532 250
68 3300005539 Ga0068853_100000038 Ga0068853_10000003823 250
69 3300006173 Ga0070716_100304018 Ga0070716_1003040182 250
70 3300006175 Ga0070712_100344160 Ga0070712_1003441602 250
71 3300013296 Ga0157374_10048717 Ga0157374_100487173 250
72 3300013307 Ga0157372_10090259 Ga0157372_100902593 250
73 3300014745 Ga0157377_10186796 Ga0157377_101867961 250
74 3300021377 Ga0213874_10016495 Ga0213874_100164952 250
75 3300025915 Ga0207693_10163339 Ga0207693_101633392 250
76 3300025916 Ga0207663_10128341 Ga0207663_101283412 250
77 3300025916 Ga0207663_10403948 Ga0207663_104039482 250
78 3300025939 Ga0207665_10101960 Ga0207665_101019603 250
79 3300026041 Ga0207639_10000061 Ga0207639_1000006162 250
80 3300035725 Ga0373947_0442878 Ga0373947_0442878_71_823 250
81 3300039438 Ga0436360_0136495 Ga0436360_0136495_5847_6599 250
82 3300039438 Ga0436360_0264008 Ga0436360_0264008_1757_2509 250
83 3300039447 Ga0436361_0045618 Ga0436361_0045618_555_1307 250
84 3300039447 Ga0436361_0524327 Ga0436361_0524327_605_1357 250
85 3300039450 Ga0436363_0955611 Ga0436363_0955611_633_1385 250
86 3300039453 Ga0436362_0503107 Ga0436362_0503107_487_1239 250
87 3300046674 Ga0495588_0132483 Ga0495588_0132483_406_1158 250
88 3300048907 Ga0496104_0801368 Ga0496104_0801368_49_801 250
89 3300000545 CNXas_1000003 CNXas_100000327 251
90 3300001977 JGI24746J21847_1009568 JGI24746J21847_10095681 251
91 3300002126 JGI24035J26624_1000974 JGI24035J26624_10009742 251
92 3300005289 Ga0065704_10003787 Ga0065704_100037873 251
93 3300005290 Ga0065712_10035041 Ga0065712_100350411 251
94 3300005290 Ga0065712_10145176 Ga0065712_101451763 251
95 3300005295 Ga0065707_10145536 Ga0065707_101455362 251
96 3300005328 Ga0070676_10004347 Ga0070676_100043476 251
97 3300005328 Ga0070676_10075069 Ga0070676_100750693 251
98 3300005330 Ga0070690_100344812 Ga0070690_1003448122 251
99 3300005331 Ga0070670_100021804 Ga0070670_1000218042 251
100 3300005331 Ga0070670_100101492 Ga0070670_1001014922 251
101 3300005331 Ga0070670_100154560 Ga0070670_1001545602 251
102 3300005334 Ga0068869_100039890 Ga0068869_1000398902 251
103 3300005335 Ga0070666_10061434 Ga0070666_100614342 251
104 3300005335 Ga0070666_10210691 Ga0070666_102106912 251
105 3300005338 Ga0068868_100012120 Ga0068868_1000121204 251
106 3300005338 Ga0068868_100204027 Ga0068868_1002040272 251
107 3300005338 Ga0068868_100287230 Ga0068868_1002872302 251
108 3300005338 Ga0068868_100891667 Ga0068868_1008916671 251
109 3300005339 Ga0070660_100092404 Ga0070660_1000924043 251
110 3300005340 Ga0070689_100025438 Ga0070689_1000254383 251
111 3300005340 Ga0070689_100072245 Ga0070689_1000722452 251
112 3300005340 Ga0070689_100112416 Ga0070689_1001124163 251
113 3300005343 Ga0070687_100007919 Ga0070687_1000079193 251
114 3300005344 Ga0070661_100192277 Ga0070661_1001922772 251
115 3300005347 Ga0070668_100009539 Ga0070668_1000095393 251
116 3300005347 Ga0070668_100019314 Ga0070668_1000193143 251
117 3300005347 Ga0070668_100340611 Ga0070668_1003406112 251
118 3300005353 Ga0070669_100000680 Ga0070669_1000006805 251
119 3300005354 Ga0070675_100003479 Ga0070675_1000034799 251
120 3300005354 Ga0070675_100008533 Ga0070675_1000085334 251
121 3300005354 Ga0070675_100023107 Ga0070675_1000231075 251
122 3300005354 Ga0070675_100198211 Ga0070675_1001982112 251
123 3300005354 Ga0070675_100462837 Ga0070675_1004628372 251
124 3300005355 Ga0070671_100082303 Ga0070671_1000823033 251
125 3300005355 Ga0070671_100088922 Ga0070671_1000889221 251
126 3300005355 Ga0070671_100193540 Ga0070671_1001935402 251
127 3300005356 Ga0070674_100010459 Ga0070674_1000104593 251
128 3300005364 Ga0070673_100031295 Ga0070673_1000312952 251
129 3300005364 Ga0070673_100204281 Ga0070673_1002042812 251
130 3300005365 Ga0070688_100003706 Ga0070688_1000037063 251
131 3300005365 Ga0070688_100073501 Ga0070688_1000735012 251
132 3300005365 Ga0070688_100168626 Ga0070688_1001686263 251
133 3300005366 Ga0070659_100012366 Ga0070659_1000123662 251
134 3300005367 Ga0070667_100030003 Ga0070667_1000300031 251
135 3300005367 Ga0070667_100145187 Ga0070667_1001451872 251
136 3300005367 Ga0070667_100334609 Ga0070667_1003346091 251
137 3300005435 Ga0070714_100035144 Ga0070714_1000351442 251
138 3300005436 Ga0070713_100092742 Ga0070713_1000927422 251
139 3300005440 Ga0070705_100284355 Ga0070705_1002843551 251
140 3300005445 Ga0070708_100014073 Ga0070708_1000140733 251
141 3300005445 Ga0070708_100065350 Ga0070708_1000653502 251
142 3300005445 Ga0070708_100102377 Ga0070708_1001023773 251
143 3300005445 Ga0070708_100302601 Ga0070708_1003026011 251
144 3300005445 Ga0070708_100408268 Ga0070708_1004082682 251
145 3300005456 Ga0070678_100032570 Ga0070678_1000325702 251
146 3300005457 Ga0070662_100018702 Ga0070662_1000187024 251
147 3300005457 Ga0070662_100031508 Ga0070662_1000315083 251
148 3300005458 Ga0070681_10573496 Ga0070681_105734961 251
149 3300005459 Ga0068867_100062939 Ga0068867_1000629392 251
150 3300005459 Ga0068867_100416656 Ga0068867_1004166561 251
151 3300005467 Ga0070706_100000035 Ga0070706_10000003590 251
152 3300005467 Ga0070706_100007330 Ga0070706_1000073303 251
153 3300005467 Ga0070706_100075049 Ga0070706_1000750493 251
154 3300005467 Ga0070706_100091962 Ga0070706_1000919622 251
155 3300005467 Ga0070706_100121418 Ga0070706_1001214182 251
156 3300005468 Ga0070707_100075067 Ga0070707_1000750673 251
157 3300005468 Ga0070707_100077351 Ga0070707_1000773512 251
158 3300005471 Ga0070698_100004983 Ga0070698_1000049838 251
159 3300005471 Ga0070698_100018577 Ga0070698_1000185777 251
160 3300005518 Ga0070699_100070633 Ga0070699_1000706332 251
161 3300005518 Ga0070699_100128787 Ga0070699_1001287872 251
162 3300005536 Ga0070697_100034546 Ga0070697_1000345462 251
163 3300005536 Ga0070697_100063256 Ga0070697_1000632562 251
164 3300005536 Ga0070697_100092273 Ga0070697_1000922732 251
165 3300005536 Ga0070697_100181992 Ga0070697_1001819921 251
166 3300005539 Ga0068853_100804611 Ga0068853_1008046111 251
167 3300005543 Ga0070672_100016442 Ga0070672_1000164424 251
168 3300005543 Ga0070672_100042681 Ga0070672_1000426812 251
169 3300005543 Ga0070672_100297281 Ga0070672_1002972813 251
170 3300005547 Ga0070693_100049514 Ga0070693_1000495141 251
171 3300005548 Ga0070665_100483234 Ga0070665_1004832343 251
172 3300005548 Ga0070665_100756514 Ga0070665_1007565141 251
173 3300005549 Ga0070704_100050723 Ga0070704_1000507232 251
174 3300005563 Ga0068855_100253116 Ga0068855_1002531162 251
175 3300005564 Ga0070664_100047210 Ga0070664_1000472102 251
176 3300005614 Ga0068856_100370237 Ga0068856_1003702372 251
177 3300005719 Ga0068861_100023035 Ga0068861_1000230352 251
178 3300005842 Ga0068858_100088553 Ga0068858_1000885532 251
179 3300005842 Ga0068858_100452718 Ga0068858_1004527182 251
180 3300005843 Ga0068860_100187635 Ga0068860_1001876353 251
181 3300005843 Ga0068860_100279259 Ga0068860_1002792592 251
182 3300005985 Ga0081539_10001786 Ga0081539_100017862 251
183 3300005985 Ga0081539_10035082 Ga0081539_100350822 251
184 3300006028 Ga0070717_10004678 Ga0070717_100046785 251
185 3300006163 Ga0070715_10070021 Ga0070715_100700212 251
186 3300006173 Ga0070716_100236427 Ga0070716_1002364271 251
187 3300006175 Ga0070712_100020668 Ga0070712_1000206683 251
188 3300006237 Ga0097621_100072964 Ga0097621_1000729642 251
189 3300006237 Ga0097621_100103184 Ga0097621_1001031842 251
190 3300006237 Ga0097621_100721825 Ga0097621_1007218251 251
191 3300006358 Ga0068871_100021406 Ga0068871_1000214065 251
192 3300006358 Ga0068871_100167985 Ga0068871_1001679852 251
193 3300006914 Ga0075436_100022375 Ga0075436_1000223753 251
194 3300007076 Ga0075435_100295856 Ga0075435_1002958562 251
195 3300007076 Ga0075435_100582266 Ga0075435_1005822662 251
196 3300007788 Ga0099795_10022778 Ga0099795_100227783 251
197 3300009098 Ga0105245_10023881 Ga0105245_100238816 251
198 3300009098 Ga0105245_10229946 Ga0105245_102299463 251
199 3300009098 Ga0105245_10378611 Ga0105245_103786112 251
200 3300009148 Ga0105243_10026373 Ga0105243_100263732 251
201 3300009176 Ga0105242_10007827 Ga0105242_100078274 251
202 3300009176 Ga0105242_10200151 Ga0105242_102001511 251
203 3300009177 Ga0105248_10435795 Ga0105248_104357951 251
204 3300009553 Ga0105249_10001222 Ga0105249_1000122221 251
205 3300010375 Ga0105239_10039341 Ga0105239_100393412 251
206 3300010375 Ga0105239_10385444 Ga0105239_103854443 251
207 3300013100 Ga0157373_10409329 Ga0157373_104093291 251
208 3300013296 Ga0157374_10014791 Ga0157374_100147913 251
209 3300013296 Ga0157374_10033225 Ga0157374_100332254 251
210 3300013296 Ga0157374_10114958 Ga0157374_101149582 251
211 3300013296 Ga0157374_10116768 Ga0157374_101167681 251
212 3300013296 Ga0157374_10753289 Ga0157374_107532891 251
213 3300013297 Ga0157378_10033959 Ga0157378_100339592 251
214 3300013297 Ga0157378_10271487 Ga0157378_102714872 251
215 3300013297 Ga0157378_10623430 Ga0157378_106234301 251
216 3300013306 Ga0163162_10006259 Ga0163162_100062599 251
217 3300013306 Ga0163162_10009817 Ga0163162_100098173 251
218 3300013306 Ga0163162_10146499 Ga0163162_101464992 251
219 3300013306 Ga0163162_10679159 Ga0163162_106791592 251
220 3300013308 Ga0157375_10014810 Ga0157375_100148104 251
221 3300013308 Ga0157375_10159643 Ga0157375_101596433 251
222 3300013308 Ga0157375_10443947 Ga0157375_104439472 251
223 3300013308 Ga0157375_10570107 Ga0157375_105701073 251
224 3300014969 Ga0157376_10053765 Ga0157376_100537652 251
225 3300014969 Ga0157376_10061809 Ga0157376_100618092 251
226 3300014969 Ga0157376_10112733 Ga0157376_101127333 251
227 3300014969 Ga0157376_10487292 Ga0157376_104872921 251
228 3300017792 Ga0163161_10024935 Ga0163161_100249353 251
229 3300025271 Ga0207666_1003080 Ga0207666_10030802 251
230 3300025271 Ga0207666_1009061 Ga0207666_10090611 251
231 3300025290 Ga0207673_1013943 Ga0207673_10139432 251
232 3300025315 Ga0207697_10000080 Ga0207697_1000008013 251
233 3300025315 Ga0207697_10000196 Ga0207697_1000019628 251
234 3300025315 Ga0207697_10001360 Ga0207697_100013604 251
235 3300025315 Ga0207697_10003107 Ga0207697_100031074 251
236 3300025315 Ga0207697_10131462 Ga0207697_101314621 251
237 3300025893 Ga0207682_10178944 Ga0207682_101789441 251
238 3300025901 Ga0207688_10036449 Ga0207688_100364491 251
239 3300025901 Ga0207688_10125815 Ga0207688_101258152 251
240 3300025903 Ga0207680_10013544 Ga0207680_100135443 251
241 3300025903 Ga0207680_10147314 Ga0207680_101473142 251
242 3300025903 Ga0207680_10231756 Ga0207680_102317561 251
243 3300025907 Ga0207645_10000462 Ga0207645_1000046232 251
244 3300025907 Ga0207645_10006456 Ga0207645_100064567 251
245 3300025907 Ga0207645_10006885 Ga0207645_100068857 251
246 3300025907 Ga0207645_10028263 Ga0207645_100282633 251
247 3300025910 Ga0207684_10000043 Ga0207684_1000004332 251
248 3300025910 Ga0207684_10002423 Ga0207684_100024231 251
249 3300025910 Ga0207684_10011330 Ga0207684_100113304 251
250 3300025910 Ga0207684_10062646 Ga0207684_100626464 251
251 3300025910 Ga0207684_10084370 Ga0207684_100843703 251
252 3300025910 Ga0207684_10095004 Ga0207684_100950042 251
253 3300025915 Ga0207693_10009439 Ga0207693_100094398 251
254 3300025915 Ga0207693_10106959 Ga0207693_101069591 251
255 3300025916 Ga0207663_10439726 Ga0207663_104397261 251
256 3300025918 Ga0207662_10005775 Ga0207662_100057755 251
257 3300025920 Ga0207649_10437873 Ga0207649_104378731 251
258 3300025922 Ga0207646_10004744 Ga0207646_1000474414 251
259 3300025922 Ga0207646_10058859 Ga0207646_100588594 251
260 3300025922 Ga0207646_10113124 Ga0207646_101131242 251
261 3300025922 Ga0207646_10174886 Ga0207646_101748861 251
262 3300025922 Ga0207646_10199063 Ga0207646_101990632 251
263 3300025923 Ga0207681_10007726 Ga0207681_100077264 251
264 3300025923 Ga0207681_10016086 Ga0207681_100160865 251
265 3300025923 Ga0207681_10025018 Ga0207681_100250183 251
266 3300025925 Ga0207650_10031790 Ga0207650_100317902 251
267 3300025926 Ga0207659_10016425 Ga0207659_100164255 251
268 3300025926 Ga0207659_10184144 Ga0207659_101841442 251
269 3300025926 Ga0207659_10210743 Ga0207659_102107432 251
270 3300025927 Ga0207687_10099860 Ga0207687_100998601 251
271 3300025928 Ga0207700_10070650 Ga0207700_100706503 251
272 3300025929 Ga0207664_10033328 Ga0207664_100333282 251
273 3300025929 Ga0207664_10832931 Ga0207664_108329311 251
274 3300025931 Ga0207644_10004792 Ga0207644_100047922 251
275 3300025931 Ga0207644_10217870 Ga0207644_102178702 251
276 3300025931 Ga0207644_10585571 Ga0207644_105855712 251
277 3300025932 Ga0207690_10057477 Ga0207690_100574772 251
278 3300025933 Ga0207706_10000188 Ga0207706_1000018854 251
279 3300025933 Ga0207706_10031533 Ga0207706_100315333 251
280 3300025933 Ga0207706_10566350 Ga0207706_105663501 251
281 3300025936 Ga0207670_10367239 Ga0207670_103672391 251
282 3300025937 Ga0207669_10228325 Ga0207669_102283251 251
283 3300025938 Ga0207704_10148524 Ga0207704_101485242 251
284 3300025939 Ga0207665_10004579 Ga0207665_100045793 251
285 3300025940 Ga0207691_10010103 Ga0207691_100101033 251
286 3300025940 Ga0207691_10019761 Ga0207691_100197613 251
287 3300025940 Ga0207691_10040316 Ga0207691_100403164 251
288 3300025940 Ga0207691_10211064 Ga0207691_102110642 251
289 3300025941 Ga0207711_10049976 Ga0207711_100499763 251
290 3300025942 Ga0207689_10132178 Ga0207689_101321781 251
291 3300025960 Ga0207651_10047455 Ga0207651_100474551 251
292 3300025960 Ga0207651_10140335 Ga0207651_101403352 251
293 3300025960 Ga0207651_10177367 Ga0207651_101773672 251
294 3300025960 Ga0207651_10445334 Ga0207651_104453342 251
295 3300025961 Ga0207712_10006867 Ga0207712_100068676 251
296 3300025972 Ga0207668_10003913 Ga0207668_100039135 251
297 3300025972 Ga0207668_10280878 Ga0207668_102808782 251
298 3300025986 Ga0207658_10029934 Ga0207658_100299342 251
299 3300025986 Ga0207658_10358520 Ga0207658_103585202 251
300 3300025986 Ga0207658_10415971 Ga0207658_104159711 251
301 3300026023 Ga0207677_10009298 Ga0207677_100092985 251
302 3300026023 Ga0207677_10069758 Ga0207677_100697581 251
303 3300026089 Ga0207648_10029759 Ga0207648_100297592 251
304 3300026089 Ga0207648_10690009 Ga0207648_106900091 251
305 3300026118 Ga0207675_101024049 Ga0207675_1010240491 251
306 3300026121 Ga0207683_10029084 Ga0207683_100290842 251
307 3300026121 Ga0207683_10282578 Ga0207683_102825782 251
308 3300028379 Ga0268266_10021150 Ga0268266_100211503 251
309 3300028379 Ga0268266_10029436 Ga0268266_100294363 251
310 3300028380 Ga0268265_10019538 Ga0268265_100195384 251
311 3300028381 Ga0268264_10065980 Ga0268264_100659803 251
312 3300028381 Ga0268264_10278139 Ga0268264_102781392 251
313 3300028381 Ga0268264_10280152 Ga0268264_102801522 251
314 3300028563 Ga0265319_1000567 Ga0265319_100056717 251
315 3300028573 Ga0265334_10094265 Ga0265334_100942651 251
316 3300028577 Ga0265318_10049897 Ga0265318_100498972 251
317 3300028653 Ga0265323_10000791 Ga0265323_100007917 251
318 3300028653 Ga0265323_10011319 Ga0265323_100113194 251
319 3300028653 Ga0265323_10020843 Ga0265323_100208432 251
320 3300028654 Ga0265322_10000916 Ga0265322_100009163 251
321 3300028794 Ga0307515_10225103 Ga0307515_102251032 251
322 3300031235 Ga0265330_10047195 Ga0265330_100471952 251
323 3300031242 Ga0265329_10038009 Ga0265329_100380092 251
324 3300031344 Ga0265316_10013188 Ga0265316_100131886 251
325 3300031344 Ga0265316_10135179 Ga0265316_101351791 251
326 3300031344 Ga0265316_10272083 Ga0265316_102720831 251
327 3300031711 Ga0265314_10035992 Ga0265314_100359923 251
328 3300031711 Ga0265314_10054095 Ga0265314_100540952 251
329 3300031711 Ga0265314_10085897 Ga0265314_100858971 251
330 3300031712 Ga0265342_10061804 Ga0265342_100618042 251
331 3300035089 Ga0373944_0013021 Ga0373944_0013021_1477_2232 251
332 3300035113 Ga0373936_0049856 Ga0373936_0049856_926_1681 251
333 3300035170 Ga0373943_0014285 Ga0373943_0014285_2003_2758 251
334 3300035170 Ga0373943_0110780 Ga0373943_0110780_192_947 251
335 3300035725 Ga0373947_0195831 Ga0373947_0195831_192_947 251
336 3300036401 Ga0373937_0606519 Ga0373937_0606519_214_969 251
337 3300037068 Ga0373925_0039317 Ga0373925_0039317_2715_3470 251
338 3300038443 Ga0395901_0370938 Ga0395901_0370938_647_1402 251
339 3300039450 Ga0436363_0310594 Ga0436363_0310594_60_815 251
340 3300042876 Ga0451577_0023012 Ga0451577_0023012_2248_3021 251
341 3300044712 Ga0453684_0030933 Ga0453684_0030933_5128_5952 251
342 3300045051 Ga0451576_0000379 Ga0451576_0000379_394_1203 251
343 3300045051 Ga0451576_0024553 Ga0451576_0024553_1020_1775 251
344 3300045976 Ga0466967_0305218 Ga0466967_0305218_760_1515 251
345 3300046455 Ga0495603_0063642 Ga0495603_0063642_246_1031 251
346 3300046516 Ga0495628_0471571 Ga0495628_0471571_105_875 251
347 3300046543 Ga0495645_0126147 Ga0495645_0126147_758_1513 251
348 3300046681 Ga0495647_0061810 Ga0495647_0061810_46_801 251
349 3300046683 Ga0495658_0064880 Ga0495658_0064880_348_1103 251
350 3300048903 Ga0496100_0031240 Ga0496100_0031240_785_1540 251
351 3300048904 Ga0496101_0095708 Ga0496101_0095708_1076_1831 251
352 3300048904 Ga0496101_0236724 Ga0496101_0236724_353_1108 251
353 3300048905 Ga0496102_0187917 Ga0496102_0187917_555_1310 251
354 3300048905 Ga0496102_0555854 Ga0496102_0555854_289_1044 251
355 3300048907 Ga0496104_0036073 Ga0496104_0036073_3451_4206 251
356 3300048907 Ga0496104_0070861 Ga0496104_0070861_757_1512 251
357 3300048907 Ga0496104_0210827 Ga0496104_0210827_1069_1824 251
358 3300048908 Ga0496105_0140639 Ga0496105_0140639_698_1453 251
359 3300048909 Ga0496106_0039782 Ga0496106_0039782_590_1345 251
360 3300048910 Ga0496107_0039253 Ga0496107_0039253_1984_2739 251
361 3300048910 Ga0496107_0433441 Ga0496107_0433441_57_812 251
362 3300048912 Ga0496109_0068278 Ga0496109_0068278_2377_3132 251
363 3300048912 Ga0496109_0409386 Ga0496109_0409386_396_1151 251
364 3300048912 Ga0496109_0416249 Ga0496109_0416249_156_911 251
365 3300048912 Ga0496109_0448408 Ga0496109_0448408_94_849 251
366 3300048913 Ga0496110_0630209 Ga0496110_0630209_32_787 251
367 3300048914 Ga0496111_0194998 Ga0496111_0194998_688_1443 251
368 3300048915 Ga0496112_0036564 Ga0496112_0036564_1820_2575 251
369 3300048915 Ga0496112_0066172 Ga0496112_0066172_561_1316 251
370 3300048915 Ga0496112_0189360 Ga0496112_0189360_1010_1855 251
371 3300048915 Ga0496112_0377866 Ga0496112_0377866_587_1342 251
372 3300048917 Ga0496114_0597597 Ga0496114_0597597_134_889 251
373 3300048918 Ga0496115_0036650 Ga0496115_0036650_2719_3474 251
374 3300050493 nmdc:mga0k408_1981_c1 nmdc:mga0k408_1981_c1_5893_6651 251
375 3300050513 nmdc:mga0rr50_256576_c1 nmdc:mga0rr50_256576_c1_99_854 251
376 3300050513 nmdc:mga0rr50_564021_c1 nmdc:mga0rr50_564021_c1_105_860 251
377 3300050514 nmdc:mga08x19_59844_c1 nmdc:mga08x19_59844_c1_373_1128 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13237

Fer4_10

4Fe-4S dicluster domain

181

255

0.94

PF00037

Fer4

4Fe-4S binding domain

185

203

0.91

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

34

152

0.91

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

68

119

0.75

PF12838

Fer4_7

4Fe-4S dicluster domain

188

258

0.6

PF13183

Fer4_8

4Fe-4S dicluster domain

185

258

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.7966 1 250
5c3j-assembly1.cif.gz_B crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1 0.7855 2 242
6lum-assembly1.cif.gz_Q structure of mycobacterium smegmatis succinate dehydrogenase 2 0.7759 3 241
2acz-assembly1.cif.gz_B complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.7727 1 243
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.7702 1 250
ID Description Score Start End Superfamily
af_Q2FZC7_12_128_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8268 2 116 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8244 2 116 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8027 2 116 3.10.20.30
af_Q2FZC7_130_266_1.10.1060.10 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.782 118 251 1.10.1060.10
af_Q2FZC7_130_266_1.10.1060.10 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.7614 118 251 1.10.1060.10
ID Description Score Start End GO Terms
AF-A0A2V5QGQ4-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9998 151 251 GO:0046872
GO:0051536
AF-A0A7Y3HLH8-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.9952 162 246 GO:0051536
AF-A0A2M7U510-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9942 144 245 GO:0046872
GO:0051536
AF-A0A2V8LZ52-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9915 157 250 GO:0046872
GO:0051536
AF-A0A1V6E1N2-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9913 145 250 GO:0051536

Feature Viewer

pLDDT pTM Quality
92.47 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map