F427799

General Info

Members Datasets Scaffolds Average Seq Length
377 248 344 247

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0114154|Ga0495585_0114154_234_1094
Length 279
Sequence MRSMAIPDLRASRCVRDDNEIFEERTMANPFSLEGKVALVTGANTGLGQAVGADIAAAGRSAPTETQGLVEATGRKFLSIKADFGSIEPVQRVVDETVAAFGKVDILVNNAGIIRRADSIEFSEADWDAVMDTNLKVVFFLTQAFAKQVLKQAKDGASDTTSIGKIINIASLLSFQGGIRVPSYTASKSGLAGLTKILANEWASKGINVNAIAPGYFDTNNTEALRNDADRNASILARIPAGRWGQPGDLGGAAVFLASRAADYVQGITLPVDGGWLAR

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
6 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
7 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
8 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
9 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
10 2643221583 Caulobacter sp. Root655 Isolate Unclassified
11 2643221584 Caulobacter sp. Root656 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
15 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
16 2818991435 Caulobacter henricii 536 Isolate Unclassified
17 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
18 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
19 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
20 2849560528 Caulobacter zeae 410 Isolate Unclassified
21 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
22 2851153111 Caulobacter radicis 736 Isolate Unclassified
23 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
24 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
25 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
28 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
29 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
30 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
31 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
32 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
114 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
132 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
235 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
240 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
241 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
244 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
245 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
248 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.25
Metatranscriptomes 0
Isolates 8.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.46
Nodule 0.27
Rhizoplane 2.92
Rhizosphere 58.62
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000306 3300002739 Bacteria 11061
2 JGI25152J39213_1004437 3300002773 Bacteria 4422
3 JGI25150J39212_1001502 3300002774 Bacteria 6443
4 JGI25153J46596_10009742 3300003215 Bacteria 4419
5 rootH2_10048436 3300003320 Bacteria 2660
6 rootL2_10142971 3300003322 Bacteria 2325
7 JGI25160J50197_1018157 3300003354 Bacteria 2201
8 JGI25161J50226_1000096 3300003374 Bacteria 72203
9 Ga0055525_1000008 3300003759 Bacteria 604287
10 Ga0055526_1000025 3300003771 Bacteria 154279
11 Ga0055526_1001917 3300003771 Bacteria 14393
12 Ga0055526_1006322 3300003771 Bacteria 6468
13 Ga0055537_1002105 3300003773 Bacteria 6993
14 Ga0055537_1002326 3300003773 Bacteria 6471
15 Ga0055537_1014297 3300003773 Bacteria 1448
16 Ga0055524_1004092 3300003775 Bacteria 6845
17 Ga0055524_1014608 3300003775 Bacteria 2901
18 Ga0055536_1006852 3300003781 Bacteria 5208
19 Ga0055536_1007094 3300003781 Bacteria 5084
20 Ga0055534_1001335 3300003784 Bacteria 9906
21 Ga0055528_1004785 3300003790 Bacteria 6445
22 Ga0055530_10002337 3300003791 Bacteria 12363
23 Ga0055530_10006490 3300003791 Bacteria 5208
24 Ga0055530_10021404 3300003791 Bacteria 1907
25 Ga0055530_10021642 3300003791 Bacteria 1889
26 Ga0055531_10002153 3300003794 Bacteria 13458
27 Ga0055531_10008038 3300003794 Bacteria 5636
28 Ga0055531_10009495 3300003794 Bacteria 4965
29 Ga0055543_1000045 3300004625 Bacteria 115098
30 Ga0065165_1001826 3300005262 Bacteria 20836
31 Ga0065714_10074651 3300005288 Bacteria 3008
32 Ga0070658_10262987 3300005327 Bacteria 1465
33 Ga0070666_10017221 3300005335 Bacteria 4633
34 Ga0070660_100028787 3300005339 Bacteria 4159
35 Ga0070692_10003755 3300005345 Bacteria 6241
36 Ga0070669_100074588 3300005353 Bacteria 2515
37 Ga0070671_100003348 3300005355 Bacteria 12501
38 Ga0070659_100495321 3300005366 Bacteria 1041
39 Ga0070667_100005533 3300005367 Bacteria 10541
40 Ga0070698_100099769 3300005471 Bacteria 2877
41 Ga0070686_100326401 3300005544 Bacteria 1146
42 Ga0070664_100303521 3300005564 Bacteria 1443
43 Ga0068859_100002144 3300005617 Bacteria 20060
44 Ga0068863_100006319 3300005841 Bacteria 11623
45 Ga0068863_100610087 3300005841 Bacteria 1080
46 Ga0068858_100001210 3300005842 Bacteria 26762
47 Ga0075366_10034841 3300006195 Bacteria 2966
48 Ga0075366_10114688 3300006195 Bacteria 1622
49 Ga0075436_100039532 3300006914 Bacteria 3256
50 Ga0097620_100002144 3300006931 Bacteria 20060
51 Ga0105244_10006736 3300009036 Bacteria 7389
52 Ga0105250_10055318 3300009092 Bacteria 1592
53 Ga0105247_10004227 3300009101 Bacteria 9205
54 Ga0105248_10029440 3300009177 Bacteria 6125
55 Ga0105249_10008689 3300009553 Bacteria 8853
56 Ga0157369_10059512 3300013105 Bacteria 4119
57 Ga0157372_10495156 3300013307 Unclassified 1425
58 Ga0157372_10697472 3300013307 Bacteria 1181
59 Ga0157379_10014582 3300014968 Bacteria 6894
60 Ga0209436_100004 3300025208 Bacteria 196698
61 Ga0209436_100176 3300025208 Bacteria 30384
62 Ga0209563_100003 3300025230 Bacteria 1932942
63 Ga0207425_1000125 3300025245 Bacteria 72177
64 Ga0207425_1000357 3300025245 Bacteria 31681
65 Ga0207425_1017168 3300025245 Bacteria 1595
66 Ga0207425_1025002 3300025245 Bacteria 1235
67 Ga0209677_105361 3300025253 Bacteria 3368
68 Ga0209129_1000609 3300025258 Bacteria 24166
69 Ga0209129_1004558 3300025258 Bacteria 5343
70 Ga0209129_1004785 3300025258 Bacteria 5113
71 Ga0209129_1017171 3300025258 Bacteria 1428
72 Ga0209565_1001039 3300025263 Bacteria 14093
73 Ga0209565_1005044 3300025263 Bacteria 3903
74 Ga0209673_1007436 3300025273 Bacteria 5050
75 Ga0209673_1009619 3300025273 Bacteria 4157
76 Ga0209130_1000001 3300025284 Bacteria 831557
77 Ga0209675_1003025 3300025291 Bacteria 8251
78 Ga0209676_1000184 3300025292 Bacteria 143543
79 Ga0209676_1000642 3300025292 Bacteria 50288
80 Ga0209025_1002329 3300025294 Bacteria 20516
81 Ga0209564_1001694 3300025295 Bacteria 20890
82 Ga0209564_1004422 3300025295 Bacteria 8609
83 Ga0209564_1004530 3300025295 Bacteria 8445
84 Ga0209758_1000543 3300025297 Bacteria 59880
85 Ga0209758_1012395 3300025297 Bacteria 4778
86 Ga0209050_1000320 3300025298 Bacteria 96836
87 Ga0209050_1000514 3300025298 Bacteria 65226
88 Ga0209050_1000620 3300025298 Bacteria 55670
89 Ga0209050_1009917 3300025298 Bacteria 4782
90 Ga0209050_1030700 3300025298 Bacteria 1691
91 Ga0209256_1003574 3300025299 Bacteria 10734
92 Ga0209256_1005861 3300025299 Bacteria 6815
93 Ga0209256_1006235 3300025299 Bacteria 6421
94 Ga0209256_1017497 3300025299 Bacteria 2378
95 Ga0209256_1038897 3300025299 Bacteria 1228
96 Ga0207426_1000005 3300025302 Bacteria 1037188
97 Ga0209051_1002969 3300025303 Bacteria 11548
98 Ga0209051_1055069 3300025303 Bacteria 1293
99 Ga0209257_1000010 3300025304 Bacteria 1158682
100 Ga0209257_1001822 3300025304 Bacteria 23330
101 Ga0209257_1002549 3300025304 Bacteria 17822
102 Ga0209257_1010260 3300025304 Bacteria 4785
103 Ga0207655_1015127 3300025728 Bacteria 4311
104 Ga0207710_10002534 3300025900 Bacteria 8449
105 Ga0207705_10174775 3300025909 Bacteria 1618
106 Ga0207657_10002453 3300025919 Bacteria 20036
107 Ga0207681_10428222 3300025923 Bacteria 1073
108 Ga0207644_10004640 3300025931 Bacteria 8931
109 Ga0207690_10039847 3300025932 Bacteria 3067
110 Ga0207711_10127296 3300025941 Bacteria 2280
111 Ga0207658_10006401 3300025986 Bacteria 8040
112 Ga0207703_10051246 3300026035 Bacteria 3344
113 Ga0207641_10027330 3300026088 Bacteria 4712
114 Ga0265326_10000008 3300028558 Bacteria 210923
115 Ga0265319_1005983 3300028563 Bacteria 5719
116 Ga0265319_1008681 3300028563 Bacteria 4420
117 Ga0265334_10000062 3300028573 Bacteria 78710
118 Ga0307517_10006752 3300028786 Bacteria 16890
119 Ga0307515_10138263 3300028794 Bacteria 2631
120 Ga0307515_10223535 3300028794 Bacteria 1694
121 Ga0265338_10002828 3300028800 Bacteria 25335
122 Ga0265324_10005030 3300029957 Bacteria 5809
123 Ga0316177_1189032 3300030731 Bacteria 4597
124 Ga0316180_1126262 3300030736 Bacteria 1440
125 Ga0265320_10000048 3300031240 Bacteria 118683
126 Ga0265320_10000130 3300031240 Bacteria 65406
127 Ga0265320_10017720 3300031240 Bacteria 3946
128 Ga0265320_10088491 3300031240 Bacteria 1436
129 Ga0265327_10042412 3300031251 Bacteria 2442
130 Ga0265327_10210941 3300031251 Bacteria 876
131 Ga0307513_10000291 3300031456 Bacteria 72855
132 Ga0307513_10002392 3300031456 Bacteria 25999
133 Ga0307513_10247089 3300031456 Bacteria 1584
134 Ga0307509_10000027 3300031507 Bacteria 228470
135 Ga0307509_10026305 3300031507 Bacteria 6491
136 Ga0307408_100000618 3300031548 Bacteria 30213
137 Ga0307408_100002147 3300031548 Bacteria 14113
138 Ga0307408_100007999 3300031548 Bacteria 6991
139 Ga0307405_10405719 3300031731 Bacteria 1068
140 Ga0307406_10004595 3300031901 Bacteria 7513
141 Ga0307407_10099364 3300031903 Bacteria 1803
142 Ga0307409_100507081 3300031995 Bacteria 1176
143 Ga0307414_10155015 3300032004 Bacteria 1812
144 Ga0373954_0000559 3300035118 Bacteria 13997
145 Ga0373924_0015955 3300035410 Bacteria 2863
146 Ga0373933_0135185 3300035724 Bacteria 1553
147 Ga0373937_0033064 3300036401 Bacteria 4694
148 Ga0395900_0000028 3300037418 Bacteria 285042
149 Ga0395900_0054335 3300037418 Bacteria 4124
150 Ga0395898_0417193 3300037466 Bacteria 1279
151 Ga0400483_140742 3300039062 Bacteria 3360
152 Ga0400483_145838 3300039062 Bacteria 3552
153 Ga0439466_0049694 3300041411 Bacteria 1377
154 Ga0451807_1898552 3300041486 Bacteria 2907
155 Ga0451853_0728074 3300041512 Bacteria 2385
156 Ga0439459_0037378 3300042438 Bacteria 1017
157 Ga0451577_0000024 3300042876 Bacteria 411758
158 Ga0451577_0247098 3300042876 Bacteria 1615
159 Ga0466969_0013764 3300044656 Bacteria 4259
160 Ga0466972_0081184 3300044658 Bacteria 1544
161 Ga0466966_0122798 3300044684 Bacteria 1594
162 Ga0466961_0170643 3300044693 Bacteria 1353
163 Ga0453684_0036043 3300044712 Bacteria 6825
164 Ga0466970_0149176 3300044765 Bacteria 1291
165 Ga0466957_0089264 3300044842 Bacteria 1929
166 Ga0466959_0000988 3300045049 Bacteria 16908
167 Ga0466959_0120422 3300045049 Bacteria 1866
168 Ga0451576_0002352 3300045051 Bacteria 28518
169 Ga0495627_000185 3300046453 Bacteria 69533
170 Ga0495592_0082426 3300046454 Unclassified 2324
171 Ga0495590_0001291 3300046457 Bacteria 10892
172 Ga0495638_0000849 3300046460 Bacteria 31864
173 Ga0495638_0003082 3300046460 Bacteria 13218
174 Ga0495638_0005851 3300046460 Bacteria 9042
175 Ga0495638_0102293 3300046460 Bacteria 1712
176 Ga0495651_0113665 3300046462 Unclassified 1998
177 Ga0495650_0000017 3300046471 Bacteria 542552
178 Ga0495605_0000112 3300046474 Bacteria 104223
179 Ga0495605_0002051 3300046474 Bacteria 12706
180 Ga0495605_0008662 3300046474 Bacteria 5746
181 Ga0495664_0038762 3300046477 Bacteria 2814
182 Ga0495584_0009883 3300046491 Bacteria 4906
183 Ga0495585_0015834 3300046492 Bacteria 4378
184 Ga0495585_0017665 3300046492 Bacteria 4119
185 Ga0495585_0114154 3300046492 Bacteria 1434
186 Ga0495596_0000088 3300046500 Bacteria 64229
187 Ga0495596_0003086 3300046500 Bacteria 8602
188 Ga0495607_0001443 3300046501 Bacteria 21163
189 Ga0495607_0084264 3300046501 Bacteria 1739
190 Ga0495607_0091987 3300046501 Bacteria 1642
191 Ga0495607_0113257 3300046501 Bacteria 1435
192 Ga0495583_0000029 3300046506 Bacteria 255536
193 Ga0495583_0000051 3300046506 Bacteria 212400
194 Ga0495583_0005424 3300046506 Bacteria 8664
195 Ga0495606_0025238 3300046507 Bacteria 4260
196 Ga0495606_0253399 3300046507 Bacteria 975
197 Ga0495606_0263433 3300046507 Bacteria 950
198 Ga0495610_0000176 3300046512 Bacteria 71110
199 Ga0495610_0004463 3300046512 Bacteria 10334
200 Ga0495610_0017659 3300046512 Bacteria 4061
201 Ga0495610_0071606 3300046512 Bacteria 1616
202 Ga0495610_0107453 3300046512 Bacteria 1240
203 Ga0495616_0000572 3300046513 Bacteria 27802
204 Ga0495616_0001503 3300046513 Bacteria 16105
205 Ga0495616_0005078 3300046513 Bacteria 8184
206 Ga0495616_0025050 3300046513 Bacteria 3192
207 Ga0495628_0011516 3300046516 Bacteria 7477
208 Ga0495628_0122930 3300046516 Bacteria 1990
209 Ga0495631_0003199 3300046518 Bacteria 9017
210 Ga0495631_0027197 3300046518 Bacteria 2620
211 Ga0495632_0016087 3300046519 Bacteria 4171
212 Ga0495637_0015323 3300046520 Bacteria 3596
213 Ga0495643_0006828 3300046522 Bacteria 7455
214 Ga0495643_0012735 3300046522 Bacteria 5061
215 Ga0495643_0066181 3300046522 Bacteria 1906
216 Ga0495643_0077471 3300046522 Bacteria 1737
217 Ga0495644_0006279 3300046523 Bacteria 4616
218 Ga0495644_0006644 3300046523 Bacteria 4481
219 Ga0495644_0054634 3300046523 Bacteria 1500
220 Ga0495648_0019419 3300046524 Bacteria 4778
221 Ga0495642_0002587 3300046528 Bacteria 7305
222 Ga0495652_0002631 3300046529 Bacteria 18326
223 Ga0495652_0072180 3300046529 Bacteria 2878
224 Ga0495652_0084191 3300046529 Unclassified 2616
225 Ga0495652_0362541 3300046529 Bacteria 1035
226 Ga0495654_0004307 3300046530 Bacteria 8483
227 Ga0495609_0000001 3300046538 Bacteria 1060094
228 Ga0495609_0003048 3300046538 Bacteria 9853
229 Ga0495597_0050109 3300046542 Bacteria 1844
230 Ga0495645_0075598 3300046543 Unclassified 2424
231 Ga0495656_0025112 3300046615 Bacteria 2359
232 Ga0495668_0000130 3300046616 Bacteria 112924
233 Ga0495668_0000715 3300046616 Bacteria 39968
234 Ga0495668_0009316 3300046616 Bacteria 6035
235 Ga0495668_0038810 3300046616 Bacteria 2660
236 Ga0495611_0000226 3300046648 Bacteria 39543
237 Ga0495625_0001311 3300046660 Bacteria 31043
238 Ga0495625_0031948 3300046660 Bacteria 3910
239 Ga0495635_0026495 3300046663 Bacteria 4033
240 Ga0495661_0000069 3300046665 Bacteria 125790
241 Ga0495661_0000181 3300046665 Bacteria 72564
242 Ga0495661_0002091 3300046665 Bacteria 15672
243 Ga0495661_0007418 3300046665 Bacteria 7645
244 Ga0495661_0068928 3300046665 Bacteria 2074
245 Ga0495661_0071028 3300046665 Bacteria 2035
246 Ga0495646_0033311 3300046680 Unclassified 3203
247 Ga0495669_0003613 3300046684 Bacteria 6366
248 Ga0495649_0000684 3300046694 Bacteria 27605
249 Ga0495589_0000061 3300046794 Bacteria 104649
250 Ga0495589_0000165 3300046794 Bacteria 60337
251 Ga0495589_0011973 3300046794 Bacteria 4497
252 Ga0495600_0013353 3300046809 Bacteria 5158
253 Ga0495660_0000104 3300046810 Bacteria 90778
254 Ga0495660_0011168 3300046810 Bacteria 5214
255 Ga0495672_0005095 3300047320 Bacteria 10494
256 Ga0495683_0021841 3300047323 Bacteria 3297
257 Ga0495683_0029748 3300047323 Bacteria 2790
258 Ga0495683_0064603 3300047323 Bacteria 1807
259 Ga0495687_000027 3300047443 Bacteria 299689
260 Ga0495687_005981 3300047443 Bacteria 7583
261 Ga0495687_067078 3300047443 Bacteria 1454
262 Ga0495675_0108335 3300047444 Bacteria 1735
263 Ga0495677_0000001 3300047445 Bacteria 715000
264 Ga0495677_0001967 3300047445 Bacteria 8200
265 Ga0495677_0004965 3300047445 Bacteria 5074
266 Ga0495685_028701 3300047447 Bacteria 1914
267 Ga0495673_0000115 3300047469 Bacteria 154414
268 Ga0495673_0000643 3300047469 Bacteria 34377
269 Ga0495681_0031897 3300047470 Bacteria 2659
270 Ga0495681_0046812 3300047470 Bacteria 2060
271 Ga0495681_0087443 3300047470 Bacteria 1381
272 Ga0495686_0019878 3300047472 Bacteria 4482
273 Ga0495686_0048226 3300047472 Bacteria 2686
274 Ga0495686_0135237 3300047472 Bacteria 1458
275 Ga0495602_0208838 3300048088 Unclassified 1484
276 Ga0495626_0000101 3300048091 Bacteria 110322
277 Ga0495626_0000135 3300048091 Bacteria 93280
278 Ga0496102_0046604 3300048905 Bacteria 3937
279 Ga0496102_0122139 3300048905 Bacteria 2433
280 Ga0496103_0350407 3300048906 Bacteria 949
281 Ga0496106_0000075 3300048909 Bacteria 79842
282 Ga0496106_0006892 3300048909 Bacteria 8407
283 Ga0496107_0000095 3300048910 Bacteria 42594
284 Ga0496108_0000034 3300048911 Bacteria 157614
285 Ga0496109_0215656 3300048912 Bacteria 1805
286 Ga0496112_0076847 3300048915 Bacteria 3302
287 Ga0496115_0023089 3300048918 Bacteria 4825
288 Ga0496116_0020096 3300048919 Bacteria 5084
289 Ga0496116_0184131 3300048919 Bacteria 1114
290 Ga0496117_0023716 3300048920 Bacteria 4877
291 Ga0496118_0035641 3300048921 Bacteria 4036
292 Ga0496119_0105735 3300048922 Bacteria 1572
293 Ga0496121_0001883 3300048924 Bacteria 33669
294 Ga0496121_0005658 3300048924 Bacteria 15897
295 Ga0496121_0024204 3300048924 Bacteria 5816
296 Ga0496121_0320413 3300048924 Bacteria 1044
297 Ga0496122_0032361 3300048925 Bacteria 4327
298 Ga0496123_0000933 3300048926 Bacteria 45679
299 Ga0496123_0116682 3300048926 Bacteria 1512
300 Ga0496124_0012190 3300048927 Bacteria 8507
301 Ga0496124_0015900 3300048927 Bacteria 7185
302 Ga0496124_0157694 3300048927 Bacteria 1773
303 Ga0496125_0003869 3300048928 Bacteria 17713
304 Ga0496125_0008890 3300048928 Bacteria 10431
305 Ga0496125_0027372 3300048928 Bacteria 5169
306 Ga0496125_0064495 3300048928 Bacteria 2910
307 Ga0496126_0508318 3300048929 Bacteria 962
308 Ga0495682_0004343 3300049460 Bacteria 6090
309 Ga0501034_0192648 3300049571 Bacteria 2000
310 Ga0501036_0019809 3300049572 Bacteria 5649
311 Ga0501073_0137262 3300049589 Bacteria 1695
312 Ga0501227_011098 3300049665 Bacteria 1959
313 Ga0501269_000056 3300049766 Bacteria 34896
314 Ga0501279_000629 3300049775 Bacteria 4654
315 nmdc:mga0k408_41107_c1 3300050493 Bacteria 2661
316 nmdc:mga0k408_47587_c1 3300050493 Bacteria 2479
317 nmdc:mga08x19_189153_c1 3300050514 Bacteria 1408
318 nmdc:mga0sz30_9407_c1 3300050516 Bacteria 3718
319 Ga0495601_0010132 3300053077 Bacteria 5599
320 Ga0495601_0021612 3300053077 Bacteria 3941
321 Ga0495601_0094362 3300053077 Bacteria 1928
322 Ga0495612_0002622 3300053078 Bacteria 7414
323 Ga0495619_0088170 3300053085 Bacteria 2099
324 Ga0500578_0000030 3300053086 Bacteria 140063
325 Ga0500644_0001191 3300053088 Bacteria 7387
326 Ga0500554_004561 3300053102 Bacteria 2945
327 Ga0500556_0001823 3300053104 Bacteria 7815
328 Ga0500594_0000037 3300053118 Bacteria 43146
329 Ga0500608_000110 3300053122 Bacteria 33704
330 Ga0500614_001988 3300053123 Bacteria 4672
331 Ga0500559_0000145 3300053136 Bacteria 55410
332 Ga0500564_007078 3300053138 Bacteria 4732
333 Ga0500568_0001666 3300053139 Bacteria 13919
334 Ga0500573_0012159 3300053140 Bacteria 4831
335 Ga0500577_0011205 3300053142 Bacteria 2666
336 Ga0500620_107432 3300053155 Bacteria 977
337 Ga0500622_0002338 3300053156 Bacteria 13811
338 Ga0500622_0024640 3300053156 Bacteria 3182
339 Ga0500622_0026753 3300053156 Bacteria 3042
340 Ga0500622_0143154 3300053156 Bacteria 1138
341 Ga0500633_0010373 3300053160 Bacteria 2489
342 Ga0500611_024356 3300053727 Bacteria 1188
343 Ga0500609_001245 3300053731 Bacteria 3783
344 Ga0501084_0197694 3300054114 Bacteria 1696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0197694 Ga0501084_0197694_350_1048 218
2 3300047470 Ga0495681_0031897 Ga0495681_0031897_1960_2631 219
3 3300046513 Ga0495616_0001503 Ga0495616_0001503_12400_13182 222
4 3300037466 Ga0395898_0417193 Ga0395898_0417193_57_812 224
5 3300045049 Ga0466959_0000988 Ga0466959_0000988_12165_12884 224
6 3300048905 Ga0496102_0046604 Ga0496102_0046604_1138_1893 224
7 3300003759 Ga0055525_1000008 Ga0055525_100000887 225
8 3300025230 Ga0209563_100003 Ga0209563_1000031171 225
9 3300025253 Ga0209677_105361 Ga0209677_1053612 225
10 3300031456 Ga0307513_10247089 Ga0307513_102470892 226
11 iso_pu_bacteria 3000405567 3000408594 227
12 3300005366 Ga0070659_100495321 Ga0070659_1004953211 228
13 3300039062 Ga0400483_145838 Ga0400483_145838_1301_2029 228
14 3300042876 Ga0451577_0247098 Ga0451577_0247098_357_1127 228
15 3300047470 Ga0495681_0087443 Ga0495681_0087443_258_1040 228
16 iso_pu_bacteria 3000017691 3000020506 228
17 3300005345 Ga0070692_10003755 Ga0070692_100037554 229
18 3300003781 Ga0055536_1006852 Ga0055536_10068522 230
19 3300003781 Ga0055536_1007094 Ga0055536_10070942 230
20 3300003791 Ga0055530_10002337 Ga0055530_100023378 230
21 3300003791 Ga0055530_10006490 Ga0055530_100064902 230
22 3300003794 Ga0055531_10008038 Ga0055531_100080384 230
23 3300025292 Ga0209676_1000184 Ga0209676_100018442 230
24 3300025292 Ga0209676_1000642 Ga0209676_100064226 230
25 3300025298 Ga0209050_1000514 Ga0209050_100051442 230
26 3300025298 Ga0209050_1000620 Ga0209050_100062015 230
27 3300025303 Ga0209051_1002969 Ga0209051_10029698 230
28 3300025304 Ga0209257_1001822 Ga0209257_100182215 230
29 3300048927 Ga0496124_0012190 Ga0496124_0012190_3640_4398 230
30 3300050516 nmdc:mga0sz30_9407_c1 nmdc:mga0sz30_9407_c1_1669_2427 230
31 3300053142 Ga0500577_0011205 Ga0500577_0011205_1082_1939 230
32 3300003322 rootL2_10142971 rootL2_101429713 231
33 3300028794 Ga0307515_10138263 Ga0307515_101382632 231
34 3300046453 Ga0495627_000185 Ga0495627_000185_13885_14655 231
35 3300046460 Ga0495638_0102293 Ga0495638_0102293_154_924 231
36 3300046512 Ga0495610_0071606 Ga0495610_0071606_570_1337 231
37 3300046616 Ga0495668_0000130 Ga0495668_0000130_72513_73343 231
38 3300046660 Ga0495625_0001311 Ga0495625_0001311_13345_14184 231
39 3300047472 Ga0495686_0135237 Ga0495686_0135237_293_1048 231
40 3300048928 Ga0496125_0027372 Ga0496125_0027372_2236_2991 231
41 3300053156 Ga0500622_0024640 Ga0500622_0024640_396_1166 231
42 3300031548 Ga0307408_100000618 Ga0307408_1000006188 232
43 3300031731 Ga0307405_10405719 Ga0307405_104057192 232
44 3300031901 Ga0307406_10004595 Ga0307406_100045957 232
45 3300047472 Ga0495686_0048226 Ga0495686_0048226_24_803 232
46 3300053136 Ga0500559_0000145 Ga0500559_0000145_42478_43248 232
47 3300053727 Ga0500611_024356 Ga0500611_024356_326_1117 232
48 3300006195 Ga0075366_10034841 Ga0075366_100348412 233
49 3300028786 Ga0307517_10006752 Ga0307517_1000675212 233
50 3300031456 Ga0307513_10000291 Ga0307513_1000029139 233
51 3300031456 Ga0307513_10002392 Ga0307513_1000239210 233
52 3300048924 Ga0496121_0320413 Ga0496121_0320413_63_878 233
53 3300050493 nmdc:mga0k408_47587_c1 nmdc:mga0k408_47587_c1_1687_2457 233
54 3300005471 Ga0070698_100099769 Ga0070698_1000997692 234
55 3300005544 Ga0070686_100326401 Ga0070686_1003264012 234
56 3300006914 Ga0075436_100039532 Ga0075436_1000395322 234
57 3300025299 Ga0209256_1017497 Ga0209256_10174972 234
58 3300031995 Ga0307409_100507081 Ga0307409_1005070812 234
59 3300041486 Ga0451807_1898552 Ga0451807_1898552_2141_2896 234
60 3300044712 Ga0453684_0036043 Ga0453684_0036043_3021_3788 234
61 3300045051 Ga0451576_0002352 Ga0451576_0002352_9076_9843 234
62 3300046507 Ga0495606_0253399 Ga0495606_0253399_173_943 234
63 3300050514 nmdc:mga08x19_189153_c1 nmdc:mga08x19_189153_c1_191_955 234
64 3300053088 Ga0500644_0001191 Ga0500644_0001191_5436_6206 234
65 3300053122 Ga0500608_000110 Ga0500608_000110_31424_32248 234
66 3300053156 Ga0500622_0026753 Ga0500622_0026753_1088_1906 234
67 iso_pu_bacteria 2510917030 2511199763 234
68 iso_pu_bacteria 2582581279 2585146743 234
69 iso_pu_bacteria 2582581280 2585155708 234
70 iso_pu_bacteria 2582581293 2585199489 234
71 iso_pu_bacteria 2585428106 2587918765 234
72 iso_pu_bacteria 2643221545 2643751635 234
73 iso_pu_bacteria 2643221552 2643780147 234
74 iso_pu_bacteria 2643221583 2643926125 234
75 iso_pu_bacteria 2643221584 2643928653 234
76 iso_pu_bacteria 2643221640 2644225412 234
77 iso_pu_bacteria 2643221642 2644232720 234
78 iso_pu_bacteria 2643221691 2644511394 234
79 iso_pu_bacteria 2791355048 2792463012 234
80 iso_pu_bacteria 2818991435 2819536755 234
81 iso_pu_bacteria 2818991454 2819645916 234
82 iso_pu_bacteria 2842333319 2842334323 234
83 iso_pu_bacteria 2843744320 2843746935 234
84 iso_pu_bacteria 2849560528 2849560962 234
85 iso_pu_bacteria 2849573788 2849576891 234
86 iso_pu_bacteria 2851153111 2851154211 234
87 iso_pu_bacteria 2857504554 2857508666 234
88 iso_pu_bacteria 2884960567 2884964431 234
89 iso_pu_bacteria 2885429604 2885430831 234
90 iso_pu_bacteria 2898329390 2898333890 234
91 iso_pu_bacteria 2919100787 2919103599 234
92 iso_pu_bacteria 2928531327 2928535695 234
93 iso_pu_bacteria 3005445848 3005451316 234
94 iso_pu_bacteria 8047673197 8047679453 234
95 3300003773 Ga0055537_1002326 Ga0055537_10023263 235
96 3300003794 Ga0055531_10002153 Ga0055531_100021533 235
97 3300025273 Ga0209673_1009619 Ga0209673_10096193 235
98 3300025299 Ga0209256_1003574 Ga0209256_10035748 235
99 3300025299 Ga0209256_1005861 Ga0209256_10058612 235
100 3300025304 Ga0209257_1002549 Ga0209257_10025495 235
101 3300028563 Ga0265319_1008681 Ga0265319_10086815 235
102 3300031240 Ga0265320_10000130 Ga0265320_1000013053 235
103 3300035118 Ga0373954_0000559 Ga0373954_0000559_1616_2380 235
104 3300035410 Ga0373924_0015955 Ga0373924_0015955_952_1716 235
105 3300035724 Ga0373933_0135185 Ga0373933_0135185_546_1310 235
106 3300036401 Ga0373937_0033064 Ga0373937_0033064_562_1326 235
107 3300042438 Ga0439459_0037378 Ga0439459_0037378_103_873 235
108 3300046457 Ga0495590_0001291 Ga0495590_0001291_10068_10838 235
109 3300046460 Ga0495638_0003082 Ga0495638_0003082_6277_7047 235
110 3300046460 Ga0495638_0005851 Ga0495638_0005851_2079_2849 235
111 3300046471 Ga0495650_0000017 Ga0495650_0000017_540585_541436 235
112 3300046477 Ga0495664_0038762 Ga0495664_0038762_1700_2464 235
113 3300046507 Ga0495606_0025238 Ga0495606_0025238_2291_3073 235
114 3300046512 Ga0495610_0000176 Ga0495610_0000176_1177_1947 235
115 3300046512 Ga0495610_0017659 Ga0495610_0017659_388_1158 235
116 3300046518 Ga0495631_0027197 Ga0495631_0027197_33_803 235
117 3300046519 Ga0495632_0016087 Ga0495632_0016087_2667_3449 235
118 3300046522 Ga0495643_0077471 Ga0495643_0077471_64_879 235
119 3300046523 Ga0495644_0054634 Ga0495644_0054634_385_1224 235
120 3300046524 Ga0495648_0019419 Ga0495648_0019419_259_1110 235
121 3300046529 Ga0495652_0072180 Ga0495652_0072180_606_1370 235
122 3300046660 Ga0495625_0031948 Ga0495625_0031948_2319_3089 235
123 3300047444 Ga0495675_0108335 Ga0495675_0108335_199_963 235
124 3300047470 Ga0495681_0046812 Ga0495681_0046812_272_1123 235
125 3300047472 Ga0495686_0019878 Ga0495686_0019878_15_785 235
126 3300048909 Ga0496106_0000075 Ga0496106_0000075_14361_15122 235
127 3300048909 Ga0496106_0006892 Ga0496106_0006892_4244_5014 235
128 3300048910 Ga0496107_0000095 Ga0496107_0000095_17134_17904 235
129 3300048924 Ga0496121_0001883 Ga0496121_0001883_21006_21776 235
130 3300053077 Ga0495601_0094362 Ga0495601_0094362_149_913 235
131 3300053085 Ga0495619_0088170 Ga0495619_0088170_1323_2087 235
132 3300053086 Ga0500578_0000030 Ga0500578_0000030_128329_129099 235
133 3300053118 Ga0500594_0000037 Ga0500594_0000037_25889_26659 235
134 3300053138 Ga0500564_007078 Ga0500564_007078_414_1184 235
135 3300053156 Ga0500622_0002338 Ga0500622_0002338_11006_11776 235
136 3300053160 Ga0500633_0010373 Ga0500633_0010373_1381_2142 235
137 3300003320 rootH2_10048436 rootH2_100484362 236
138 3300003354 JGI25160J50197_1018157 JGI25160J50197_10181572 236
139 3300005262 Ga0065165_1001826 Ga0065165_100182613 236
140 3300005288 Ga0065714_10074651 Ga0065714_100746513 236
141 3300005335 Ga0070666_10017221 Ga0070666_100172214 236
142 3300005355 Ga0070671_100003348 Ga0070671_1000033483 236
143 3300005367 Ga0070667_100005533 Ga0070667_1000055335 236
144 3300005564 Ga0070664_100303521 Ga0070664_1003035212 236
145 3300005617 Ga0068859_100002144 Ga0068859_10000214411 236
146 3300005841 Ga0068863_100006319 Ga0068863_1000063194 236
147 3300005842 Ga0068858_100001210 Ga0068858_1000012109 236
148 3300006931 Ga0097620_100002144 Ga0097620_10000214411 236
149 3300009036 Ga0105244_10006736 Ga0105244_100067365 236
150 3300009092 Ga0105250_10055318 Ga0105250_100553181 236
151 3300009101 Ga0105247_10004227 Ga0105247_100042276 236
152 3300009177 Ga0105248_10029440 Ga0105248_100294405 236
153 3300009553 Ga0105249_10008689 Ga0105249_100086895 236
154 3300014968 Ga0157379_10014582 Ga0157379_100145825 236
155 3300025295 Ga0209564_1004422 Ga0209564_10044222 236
156 3300025728 Ga0207655_1015127 Ga0207655_10151272 236
157 3300025900 Ga0207710_10002534 Ga0207710_100025346 236
158 3300025931 Ga0207644_10004640 Ga0207644_100046404 236
159 3300025941 Ga0207711_10127296 Ga0207711_101272962 236
160 3300025986 Ga0207658_10006401 Ga0207658_100064015 236
161 3300026035 Ga0207703_10051246 Ga0207703_100512463 236
162 3300026088 Ga0207641_10027330 Ga0207641_100273304 236
163 3300028794 Ga0307515_10223535 Ga0307515_102235352 236
164 3300032004 Ga0307414_10155015 Ga0307414_101550152 236
165 3300037418 Ga0395900_0054335 Ga0395900_0054335_1327_2082 236
166 3300046460 Ga0495638_0000849 Ga0495638_0000849_30574_31374 236
167 3300046474 Ga0495605_0000112 Ga0495605_0000112_66580_67335 236
168 3300046501 Ga0495607_0084264 Ga0495607_0084264_124_879 236
169 3300046506 Ga0495583_0000029 Ga0495583_0000029_65802_66572 236
170 3300046512 Ga0495610_0107453 Ga0495610_0107453_117_872 236
171 3300046516 Ga0495628_0011516 Ga0495628_0011516_5597_6409 236
172 3300046522 Ga0495643_0012735 Ga0495643_0012735_2340_3095 236
173 3300046529 Ga0495652_0362541 Ga0495652_0362541_164_976 236
174 3300046542 Ga0495597_0050109 Ga0495597_0050109_549_1304 236
175 3300046665 Ga0495661_0071028 Ga0495661_0071028_941_1696 236
176 3300046794 Ga0495589_0000165 Ga0495589_0000165_18241_18996 236
177 3300046810 Ga0495660_0000104 Ga0495660_0000104_30019_30774 236
178 3300047320 Ga0495672_0005095 Ga0495672_0005095_9497_10252 236
179 3300047323 Ga0495683_0029748 Ga0495683_0029748_891_1646 236
180 3300047443 Ga0495687_005981 Ga0495687_005981_4781_5536 236
181 3300047443 Ga0495687_067078 Ga0495687_067078_658_1422 236
182 3300047445 Ga0495677_0001967 Ga0495677_0001967_118_873 236
183 3300048091 Ga0495626_0000101 Ga0495626_0000101_72679_73434 236
184 3300048905 Ga0496102_0122139 Ga0496102_0122139_1165_1929 236
185 3300048906 Ga0496103_0350407 Ga0496103_0350407_119_883 236
186 3300048912 Ga0496109_0215656 Ga0496109_0215656_807_1571 236
187 3300048915 Ga0496112_0076847 Ga0496112_0076847_992_1756 236
188 3300048919 Ga0496116_0020096 Ga0496116_0020096_1390_2154 236
189 3300048922 Ga0496119_0105735 Ga0496119_0105735_71_835 236
190 3300048924 Ga0496121_0005658 Ga0496121_0005658_1741_2505 236
191 3300048927 Ga0496124_0157694 Ga0496124_0157694_308_1072 236
192 3300048928 Ga0496125_0003869 Ga0496125_0003869_1031_1795 236
193 3300048928 Ga0496125_0008890 Ga0496125_0008890_6684_7448 236
194 3300048929 Ga0496126_0508318 Ga0496126_0508318_93_857 236
195 3300049571 Ga0501034_0192648 Ga0501034_0192648_890_1648 236
196 3300049766 Ga0501269_000056 Ga0501269_000056_446_1201 236
197 3300053077 Ga0495601_0010132 Ga0495601_0010132_1480_2292 236
198 3300053102 Ga0500554_004561 Ga0500554_004561_427_1197 236
199 3300053123 Ga0500614_001988 Ga0500614_001988_348_1118 236
200 iso_pu_bacteria 2582581298 2585221495 236
201 iso_pu_bacteria 2585427529 2585544335 236
202 iso_pu_bacteria 8001845381 8001849251 236
203 3300005353 Ga0070669_100074588 Ga0070669_1000745882 237
204 3300005841 Ga0068863_100610087 Ga0068863_1006100872 237
205 3300025273 Ga0209673_1007436 Ga0209673_10074364 237
206 3300025923 Ga0207681_10428222 Ga0207681_104282222 237
207 3300028558 Ga0265326_10000008 Ga0265326_10000008117 237
208 3300028573 Ga0265334_10000062 Ga0265334_100000628 237
209 3300028800 Ga0265338_10002828 Ga0265338_1000282815 237
210 3300029957 Ga0265324_10005030 Ga0265324_100050308 237
211 3300031507 Ga0307509_10000027 Ga0307509_10000027185 237
212 3300046501 Ga0495607_0091987 Ga0495607_0091987_124_879 237
213 3300046522 Ga0495643_0066181 Ga0495643_0066181_115_870 237
214 3300046665 Ga0495661_0000181 Ga0495661_0000181_14028_14783 237
215 3300047469 Ga0495673_0000643 Ga0495673_0000643_32351_33121 237
216 3300048911 Ga0496108_0000034 Ga0496108_0000034_70996_71754 237
217 3300048918 Ga0496115_0023089 Ga0496115_0023089_1121_1891 237
218 3300048920 Ga0496117_0023716 Ga0496117_0023716_2018_2779 237
219 3300048921 Ga0496118_0035641 Ga0496118_0035641_719_1480 237
220 3300048924 Ga0496121_0024204 Ga0496121_0024204_3326_4087 237
221 3300048925 Ga0496122_0032361 Ga0496122_0032361_2427_3188 237
222 3300053139 Ga0500568_0001666 Ga0500568_0001666_3793_4554 237
223 3300053155 Ga0500620_107432 Ga0500620_107432_60_821 237
224 3300002739 JGI25158J39367_1000306 JGI25158J39367_10003069 238
225 3300002773 JGI25152J39213_1004437 JGI25152J39213_10044374 238
226 3300002774 JGI25150J39212_1001502 JGI25150J39212_10015025 238
227 3300003215 JGI25153J46596_10009742 JGI25153J46596_100097424 238
228 3300003374 JGI25161J50226_1000096 JGI25161J50226_100009670 238
229 3300003771 Ga0055526_1000025 Ga0055526_100002573 238
230 3300003771 Ga0055526_1001917 Ga0055526_100191712 238
231 3300003771 Ga0055526_1006322 Ga0055526_10063224 238
232 3300003773 Ga0055537_1002105 Ga0055537_10021057 238
233 3300003773 Ga0055537_1014297 Ga0055537_10142972 238
234 3300003775 Ga0055524_1004092 Ga0055524_10040924 238
235 3300003775 Ga0055524_1014608 Ga0055524_10146083 238
236 3300003784 Ga0055534_1001335 Ga0055534_100133510 238
237 3300003790 Ga0055528_1004785 Ga0055528_10047857 238
238 3300003791 Ga0055530_10021404 Ga0055530_100214041 238
239 3300003791 Ga0055530_10021642 Ga0055530_100216422 238
240 3300003794 Ga0055531_10009495 Ga0055531_100094954 238
241 3300004625 Ga0055543_1000045 Ga0055543_100004515 238
242 3300005327 Ga0070658_10262987 Ga0070658_102629872 238
243 3300005339 Ga0070660_100028787 Ga0070660_1000287873 238
244 3300006195 Ga0075366_10114688 Ga0075366_101146882 238
245 3300013105 Ga0157369_10059512 Ga0157369_100595122 238
246 3300013307 Ga0157372_10495156 Ga0157372_104951562 238
247 3300013307 Ga0157372_10697472 Ga0157372_106974722 238
248 3300025208 Ga0209436_100004 Ga0209436_10000490 238
249 3300025208 Ga0209436_100176 Ga0209436_10017626 238
250 3300025245 Ga0207425_1000125 Ga0207425_10001258 238
251 3300025245 Ga0207425_1000357 Ga0207425_100035713 238
252 3300025245 Ga0207425_1017168 Ga0207425_10171682 238
253 3300025245 Ga0207425_1025002 Ga0207425_10250022 238
254 3300025258 Ga0209129_1000609 Ga0209129_100060912 238
255 3300025258 Ga0209129_1004558 Ga0209129_10045582 238
256 3300025258 Ga0209129_1004785 Ga0209129_10047856 238
257 3300025258 Ga0209129_1017171 Ga0209129_10171711 238
258 3300025263 Ga0209565_1001039 Ga0209565_10010399 238
259 3300025263 Ga0209565_1005044 Ga0209565_10050442 238
260 3300025284 Ga0209130_1000001 Ga0209130_1000001334 238
261 3300025291 Ga0209675_1003025 Ga0209675_10030254 238
262 3300025294 Ga0209025_1002329 Ga0209025_10023295 238
263 3300025295 Ga0209564_1001694 Ga0209564_10016944 238
264 3300025295 Ga0209564_1004530 Ga0209564_10045305 238
265 3300025297 Ga0209758_1000543 Ga0209758_100054340 238
266 3300025297 Ga0209758_1012395 Ga0209758_10123955 238
267 3300025298 Ga0209050_1000320 Ga0209050_100032057 238
268 3300025298 Ga0209050_1009917 Ga0209050_10099173 238
269 3300025298 Ga0209050_1030700 Ga0209050_10307002 238
270 3300025299 Ga0209256_1006235 Ga0209256_10062356 238
271 3300025299 Ga0209256_1038897 Ga0209256_10388972 238
272 3300025302 Ga0207426_1000005 Ga0207426_1000005939 238
273 3300025303 Ga0209051_1055069 Ga0209051_10550692 238
274 3300025304 Ga0209257_1000010 Ga0209257_1000010245 238
275 3300025304 Ga0209257_1010260 Ga0209257_10102604 238
276 3300025909 Ga0207705_10174775 Ga0207705_101747752 238
277 3300025919 Ga0207657_10002453 Ga0207657_1000245312 238
278 3300025932 Ga0207690_10039847 Ga0207690_100398472 238
279 3300028563 Ga0265319_1005983 Ga0265319_10059833 238
280 3300030731 Ga0316177_1189032 Ga0316177_11890325 238
281 3300030736 Ga0316180_1126262 Ga0316180_11262622 238
282 3300031240 Ga0265320_10000048 Ga0265320_1000004882 238
283 3300031240 Ga0265320_10017720 Ga0265320_100177202 238
284 3300031240 Ga0265320_10088491 Ga0265320_100884911 238
285 3300031251 Ga0265327_10042412 Ga0265327_100424122 238
286 3300031251 Ga0265327_10210941 Ga0265327_102109411 238
287 3300031507 Ga0307509_10026305 Ga0307509_100263053 238
288 3300031548 Ga0307408_100002147 Ga0307408_1000021474 238
289 3300031548 Ga0307408_100007999 Ga0307408_1000079993 238
290 3300031903 Ga0307407_10099364 Ga0307407_100993643 238
291 3300037418 Ga0395900_0000028 Ga0395900_0000028_134319_135074 238
292 3300039062 Ga0400483_140742 Ga0400483_140742_284_1042 238
293 3300041411 Ga0439466_0049694 Ga0439466_0049694_592_1356 238
294 3300041512 Ga0451853_0728074 Ga0451853_0728074_1019_1786 238
295 3300042876 Ga0451577_0000024 Ga0451577_0000024_151370_152137 238
296 3300044656 Ga0466969_0013764 Ga0466969_0013764_518_1288 238
297 3300044658 Ga0466972_0081184 Ga0466972_0081184_521_1276 238
298 3300044684 Ga0466966_0122798 Ga0466966_0122798_661_1416 238
299 3300044693 Ga0466961_0170643 Ga0466961_0170643_38_793 238
300 3300044765 Ga0466970_0149176 Ga0466970_0149176_281_1036 238
301 3300044842 Ga0466957_0089264 Ga0466957_0089264_906_1661 238
302 3300045049 Ga0466959_0120422 Ga0466959_0120422_359_1114 238
303 3300046454 Ga0495592_0082426 Ga0495592_0082426_295_1113 238
304 3300046462 Ga0495651_0113665 Ga0495651_0113665_182_1000 238
305 3300046474 Ga0495605_0002051 Ga0495605_0002051_4099_4854 238
306 3300046474 Ga0495605_0008662 Ga0495605_0008662_636_1391 238
307 3300046491 Ga0495584_0009883 Ga0495584_0009883_3408_4163 238
308 3300046492 Ga0495585_0015834 Ga0495585_0015834_3223_3978 238
309 3300046492 Ga0495585_0017665 Ga0495585_0017665_621_1376 238
310 3300046492 Ga0495585_0114154 Ga0495585_0114154_234_1094 238
311 3300046500 Ga0495596_0000088 Ga0495596_0000088_28352_29107 238
312 3300046500 Ga0495596_0003086 Ga0495596_0003086_4357_5112 238
313 3300046501 Ga0495607_0001443 Ga0495607_0001443_4197_4952 238
314 3300046501 Ga0495607_0113257 Ga0495607_0113257_385_1140 238
315 3300046506 Ga0495583_0000051 Ga0495583_0000051_184637_185392 238
316 3300046506 Ga0495583_0005424 Ga0495583_0005424_3553_4308 238
317 3300046507 Ga0495606_0263433 Ga0495606_0263433_49_804 238
318 3300046512 Ga0495610_0004463 Ga0495610_0004463_887_1642 238
319 3300046513 Ga0495616_0000572 Ga0495616_0000572_15530_16285 238
320 3300046513 Ga0495616_0005078 Ga0495616_0005078_2796_3551 238
321 3300046513 Ga0495616_0025050 Ga0495616_0025050_1509_2264 238
322 3300046516 Ga0495628_0122930 Ga0495628_0122930_105_923 238
323 3300046518 Ga0495631_0003199 Ga0495631_0003199_4075_4830 238
324 3300046520 Ga0495637_0015323 Ga0495637_0015323_907_1677 238
325 3300046522 Ga0495643_0006828 Ga0495643_0006828_3645_4400 238
326 3300046523 Ga0495644_0006279 Ga0495644_0006279_3841_4596 238
327 3300046523 Ga0495644_0006644 Ga0495644_0006644_1198_1953 238
328 3300046528 Ga0495642_0002587 Ga0495642_0002587_4209_4964 238
329 3300046529 Ga0495652_0002631 Ga0495652_0002631_2342_3160 238
330 3300046529 Ga0495652_0084191 Ga0495652_0084191_1338_2156 238
331 3300046530 Ga0495654_0004307 Ga0495654_0004307_5608_6447 238
332 3300046538 Ga0495609_0000001 Ga0495609_0000001_580986_581741 238
333 3300046538 Ga0495609_0003048 Ga0495609_0003048_2524_3279 238
334 3300046543 Ga0495645_0075598 Ga0495645_0075598_911_1729 238
335 3300046615 Ga0495656_0025112 Ga0495656_0025112_1068_1823 238
336 3300046616 Ga0495668_0000715 Ga0495668_0000715_15804_16559 238
337 3300046616 Ga0495668_0009316 Ga0495668_0009316_4306_5073 238
338 3300046616 Ga0495668_0038810 Ga0495668_0038810_1078_1848 238
339 3300046648 Ga0495611_0000226 Ga0495611_0000226_15523_16278 238
340 3300046663 Ga0495635_0026495 Ga0495635_0026495_1042_1860 238
341 3300046665 Ga0495661_0000069 Ga0495661_0000069_38661_39416 238
342 3300046665 Ga0495661_0002091 Ga0495661_0002091_7940_8695 238
343 3300046665 Ga0495661_0007418 Ga0495661_0007418_1445_2200 238
344 3300046665 Ga0495661_0068928 Ga0495661_0068928_389_1144 238
345 3300046680 Ga0495646_0033311 Ga0495646_0033311_1486_2304 238
346 3300046684 Ga0495669_0003613 Ga0495669_0003613_313_1068 238
347 3300046694 Ga0495649_0000684 Ga0495649_0000684_12798_13556 238
348 3300046794 Ga0495589_0000061 Ga0495589_0000061_96973_97728 238
349 3300046794 Ga0495589_0011973 Ga0495589_0011973_178_933 238
350 3300046809 Ga0495600_0013353 Ga0495600_0013353_2506_3324 238
351 3300046810 Ga0495660_0011168 Ga0495660_0011168_865_1620 238
352 3300047323 Ga0495683_0021841 Ga0495683_0021841_419_1174 238
353 3300047323 Ga0495683_0064603 Ga0495683_0064603_861_1628 238
354 3300047443 Ga0495687_000027 Ga0495687_000027_239258_240013 238
355 3300047445 Ga0495677_0000001 Ga0495677_0000001_239339_240094 238
356 3300047445 Ga0495677_0004965 Ga0495677_0004965_4276_5031 238
357 3300047447 Ga0495685_028701 Ga0495685_028701_128_883 238
358 3300047469 Ga0495673_0000115 Ga0495673_0000115_22295_23065 238
359 3300048088 Ga0495602_0208838 Ga0495602_0208838_322_1140 238
360 3300048091 Ga0495626_0000135 Ga0495626_0000135_33328_34083 238
361 3300048919 Ga0496116_0184131 Ga0496116_0184131_180_941 238
362 3300048926 Ga0496123_0000933 Ga0496123_0000933_38304_39059 238
363 3300048926 Ga0496123_0116682 Ga0496123_0116682_487_1257 238
364 3300048927 Ga0496124_0015900 Ga0496124_0015900_5442_6197 238
365 3300048928 Ga0496125_0064495 Ga0496125_0064495_164_925 238
366 3300049460 Ga0495682_0004343 Ga0495682_0004343_1120_1875 238
367 3300049572 Ga0501036_0019809 Ga0501036_0019809_2590_3348 238
368 3300049589 Ga0501073_0137262 Ga0501073_0137262_54_833 238
369 3300049665 Ga0501227_011098 Ga0501227_011098_128_886 238
370 3300049775 Ga0501279_000629 Ga0501279_000629_603_1361 238
371 3300050493 nmdc:mga0k408_41107_c1 nmdc:mga0k408_41107_c1_531_1322 238
372 3300053077 Ga0495601_0021612 Ga0495601_0021612_1461_2279 238
373 3300053078 Ga0495612_0002622 Ga0495612_0002622_6276_7094 238
374 3300053104 Ga0500556_0001823 Ga0500556_0001823_7035_7805 238
375 3300053140 Ga0500573_0012159 Ga0500573_0012159_2719_3477 238
376 3300053156 Ga0500622_0143154 Ga0500622_0143154_11_850 238
377 3300053731 Ga0500609_001245 Ga0500609_001245_2943_3710 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

45

277

0.95

PF00106

adh_short

short chain dehydrogenase

36

230

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9312 4 238
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.927 7 234
4j2h-assembly1.cif.gz_A crystal structure of a putative short-chain alcohol dehydrogenase from sinorhizobium meliloti 1021 (target nysgrc-011708) 0.9197 4 238
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9195 7 234
3ay6-assembly1.cif.gz_C crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose 0.9189 4 238
ID Description Score Start End Superfamily
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9399 4 238 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9321 70 234 3.40.50.720
af_P9WGQ5_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9272 4 234 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9246 4 238 3.40.50.720
2ewmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9164 7 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C6BQX5-F1-model_v4 SDR family oxidoreductase 0.9416 33 238 GO:0008202
GO:0016616
AF-A0A2M7BIA6-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9407 1 238 GO:0016616
AF-A0A7C4IX71-F1-model_v4 SDR family oxidoreductase 0.9402 1 238 GO:0016616
AF-A0A1F4QWB5-F1-model_v4 Short-chain dehydrogenase 0.9402 5 237
AF-H6NSQ0-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9399 4 238 GO:0008678
GO:0051287

Feature Viewer

pLDDT pTM Quality
87.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map