F427809

General Info

Members Datasets Scaffolds Average Seq Length
377 232 754 92

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0029267|Ga0495600_0029267_3051_3368
Length 105
Sequence MRRLARASGGAAMSMTHAVVLIEADRDALSTLGGELADIEGVAEAYSVTGQWDFVAIVRVPDHEQLADVVTDRIGTLSGVARTQTMVAFAAFSRHDLEALFSIGE

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
117 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
147 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
148 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
149 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
150 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
198 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
199 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
200 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
201 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
202 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
203 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
204 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
205 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
206 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
207 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
208 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
209 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
217 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.51
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0029267 3300046809 Bacteria 3566
2 JGI25406J46586_10082391 3300003203 Bacteria 984
3 JGI25406J46586_10139465 3300003203 Bacteria 709
4 JGI25407J50210_10142791 3300003373 Bacteria 589
5 Ga0070683_100110448 3300005329 Bacteria 2594
6 Ga0070683_102278089 3300005329 Bacteria 520
7 Ga0070680_101221982 3300005336 Bacteria 650
8 Ga0070682_100672454 3300005337 Bacteria 827
9 Ga0068868_100300825 3300005338 Bacteria 1362
10 Ga0070689_102096349 3300005340 Bacteria 518
11 Ga0070661_100608879 3300005344 Bacteria 884
12 Ga0070668_100939624 3300005347 Bacteria 775
13 Ga0070688_100111276 3300005365 Bacteria 1822
14 Ga0070659_100214082 3300005366 Bacteria 1588
15 Ga0070709_10208623 3300005434 Bacteria 1388
16 Ga0070709_10561979 3300005434 Bacteria 874
17 Ga0070709_10681783 3300005434 Bacteria 798
18 Ga0070709_11084399 3300005434 Unclassified 640
19 Ga0070714_100067170 3300005435 Bacteria 3091
20 Ga0070714_100119558 3300005435 Bacteria 2342
21 Ga0070714_100249965 3300005435 Bacteria 1639
22 Ga0070714_101225473 3300005435 Bacteria 732
23 Ga0070714_101574810 3300005435 Bacteria 642
24 Ga0070713_100430788 3300005436 Unclassified 1236
25 Ga0070713_101582714 3300005436 Bacteria 636
26 Ga0070710_10083855 3300005437 Bacteria 1866
27 Ga0070710_10461355 3300005437 Bacteria 863
28 Ga0070710_10807288 3300005437 Bacteria 671
29 Ga0070701_10708889 3300005438 Bacteria 678
30 Ga0070711_100025967 3300005439 Bacteria 3836
31 Ga0070711_101326061 3300005439 Bacteria 625
32 Ga0070700_100211571 3300005441 Bacteria 1368
33 Ga0070708_100008029 3300005445 Bacteria 8456
34 Ga0070663_101348309 3300005455 Bacteria 630
35 Ga0070662_100648643 3300005457 Bacteria 890
36 Ga0070681_10443566 3300005458 Bacteria 1210
37 Ga0068867_100206927 3300005459 Bacteria 1574
38 Ga0068867_101903166 3300005459 Bacteria 561
39 Ga0070685_10813630 3300005466 Bacteria 690
40 Ga0070706_100007300 3300005467 Bacteria 10373
41 Ga0070707_100001888 3300005468 Bacteria 20066
42 Ga0070707_100665600 3300005468 Bacteria 1004
43 Ga0070698_100001377 3300005471 Bacteria 26968
44 Ga0070699_101547362 3300005518 Bacteria 608
45 Ga0068853_100995906 3300005539 Bacteria 807
46 Ga0070672_100771974 3300005543 Bacteria 844
47 Ga0070686_101928208 3300005544 Bacteria 504
48 Ga0070695_101251668 3300005545 Bacteria 612
49 Ga0070696_100867493 3300005546 Bacteria 747
50 Ga0070664_100023880 3300005564 Bacteria 5051
51 Ga0070664_100217766 3300005564 Bacteria 1708
52 Ga0068856_100196695 3300005614 Bacteria 2030
53 Ga0068856_101242968 3300005614 Bacteria 761
54 Ga0070702_100365455 3300005615 Bacteria 1021
55 Ga0068852_101194412 3300005616 Bacteria 782
56 Ga0068866_10282139 3300005718 Bacteria 1029
57 Ga0068851_10541100 3300005834 Bacteria 703
58 Ga0081455_10001214 3300005937 Bacteria 32286
59 Ga0081538_10000332 3300005981 Bacteria 53567
60 Ga0081538_10045625 3300005981 Bacteria 2714
61 Ga0081538_10072232 3300005981 Bacteria 1893
62 Ga0081540_1064799 3300005983 Bacteria 1722
63 Ga0081539_10003484 3300005985 Bacteria 19225
64 Ga0081539_10025144 3300005985 Bacteria 3844
65 Ga0081539_10044799 3300005985 Bacteria 2551
66 Ga0081539_10189204 3300005985 Unclassified 959
67 Ga0081539_10335590 3300005985 Bacteria 639
68 Ga0070717_10016827 3300006028 Bacteria 5676
69 Ga0070716_100049499 3300006173 Bacteria 2381
70 Ga0070716_100182206 3300006173 Unclassified 1380
71 Ga0070712_100117806 3300006175 Unclassified 1994
72 Ga0070712_100138516 3300006175 Bacteria 1854
73 Ga0070712_100333174 3300006175 Unclassified 1237
74 Ga0070712_101159479 3300006175 Bacteria 672
75 Ga0070712_101673256 3300006175 Bacteria 557
76 Ga0070712_101744722 3300006175 Bacteria 545
77 Ga0075428_100178471 3300006844 Bacteria 2299
78 Ga0075428_100828992 3300006844 Bacteria 983
79 Ga0075428_102386474 3300006844 Unclassified 543
80 Ga0075430_100147019 3300006846 Bacteria 1963
81 Ga0075430_100179370 3300006846 Bacteria 1762
82 Ga0075431_100070382 3300006847 Bacteria 3610
83 Ga0075435_100738595 3300007076 Bacteria 856
84 Ga0105240_10004346 3300009093 Bacteria 21634
85 Ga0111539_10936981 3300009094 Bacteria 1007
86 Ga0111539_12763430 3300009094 Bacteria 569
87 Ga0105245_10855386 3300009098 Bacteria 950
88 Ga0105245_11150901 3300009098 Bacteria 823
89 Ga0105245_12026643 3300009098 Bacteria 629
90 Ga0114129_10392494 3300009147 Bacteria 1830
91 Ga0114129_13313038 3300009147 Bacteria 520
92 Ga0105243_10091934 3300009148 Bacteria 2500
93 Ga0105243_11109511 3300009148 Bacteria 800
94 Ga0105242_10678815 3300009176 Bacteria 1005
95 Ga0105237_10013622 3300009545 Bacteria 8516
96 Ga0105238_11325327 3300009551 Bacteria 746
97 Ga0105239_10467186 3300010375 Bacteria 1432
98 Ga0105239_10714886 3300010375 Bacteria 1146
99 Ga0105246_11940128 3300011119 Bacteria 566
100 Ga0157370_12084741 3300013104 Unclassified 508
101 Ga0157369_12127762 3300013105 Bacteria 569
102 Ga0163162_10437733 3300013306 Bacteria 1440
103 Ga0157372_10395861 3300013307 Bacteria 1610
104 Ga0157375_12708528 3300013308 Unclassified 593
105 Ga0157377_10295718 3300014745 Bacteria 1067
106 Ga0157377_10490290 3300014745 Bacteria 857
107 Ga0157376_12499850 3300014969 Bacteria 556
108 Ga0206349_1235485 3300020075 Bacteria 3093
109 Ga0206354_10038934 3300020081 Unclassified 987
110 Ga0206354_10721846 3300020081 Bacteria 764
111 Ga0206353_10401775 3300020082 Bacteria 625
112 Ga0206353_11834438 3300020082 Bacteria 819
113 Ga0213876_10491868 3300021384 Bacteria 653
114 Ga0207656_10338691 3300025321 Bacteria 749
115 Ga0207682_10071858 3300025893 Bacteria 1467
116 Ga0207692_10356247 3300025898 Bacteria 903
117 Ga0207692_10997999 3300025898 Bacteria 553
118 Ga0207688_10037894 3300025901 Bacteria 2675
119 Ga0207688_10685148 3300025901 Bacteria 648
120 Ga0207685_10495891 3300025905 Bacteria 642
121 Ga0207699_10047405 3300025906 Bacteria 2520
122 Ga0207699_10816944 3300025906 Bacteria 686
123 Ga0207695_10064774 3300025913 Bacteria 3761
124 Ga0207671_10008955 3300025914 Bacteria 8422
125 Ga0207693_10073804 3300025915 Bacteria 2671
126 Ga0207693_10100780 3300025915 Bacteria 2265
127 Ga0207693_10209937 3300025915 Bacteria 1530
128 Ga0207693_10286037 3300025915 Unclassified 1292
129 Ga0207693_11135164 3300025915 Bacteria 592
130 Ga0207663_10018720 3300025916 Bacteria 3888
131 Ga0207663_10235739 3300025916 Bacteria 1339
132 Ga0207663_10375008 3300025916 Bacteria 1083
133 Ga0207660_10835270 3300025917 Bacteria 752
134 Ga0207649_10711820 3300025920 Bacteria 779
135 Ga0207646_10029958 3300025922 Bacteria 4940
136 Ga0207646_10538963 3300025922 Unclassified 1050
137 Ga0207694_11445440 3300025924 Bacteria 581
138 Ga0207659_11176984 3300025926 Bacteria 659
139 Ga0207659_11255872 3300025926 Bacteria 636
140 Ga0207687_10105671 3300025927 Bacteria 2080
141 Ga0207700_10764172 3300025928 Bacteria 864
142 Ga0207664_10102728 3300025929 Bacteria 2364
143 Ga0207664_10119357 3300025929 Bacteria 2205
144 Ga0207664_10194480 3300025929 Bacteria 1748
145 Ga0207664_11029051 3300025929 Bacteria 738
146 Ga0207664_11085385 3300025929 Bacteria 716
147 Ga0207664_11296371 3300025929 Bacteria 648
148 Ga0207664_11814903 3300025929 Bacteria 532
149 Ga0207664_11998289 3300025929 Unclassified 503
150 Ga0207690_10181324 3300025932 Bacteria 1586
151 Ga0207686_10657389 3300025934 Bacteria 830
152 Ga0207704_11255750 3300025938 Bacteria 632
153 Ga0207665_10079567 3300025939 Bacteria 2253
154 Ga0207665_10216201 3300025939 Unclassified 1402
155 Ga0207691_10232914 3300025940 Bacteria 1594
156 Ga0207689_10292673 3300025942 Bacteria 1349
157 Ga0207661_11917426 3300025944 Bacteria 538
158 Ga0207679_10014920 3300025945 Bacteria 5119
159 Ga0207640_10099239 3300025981 Bacteria 2038
160 Ga0207658_10251269 3300025986 Bacteria 1503
161 Ga0207677_11795988 3300026023 Bacteria 569
162 Ga0207639_10581969 3300026041 Bacteria 1031
163 Ga0207639_10661709 3300026041 Bacteria 967
164 Ga0207702_10576188 3300026078 Bacteria 1103
165 Ga0207648_10074369 3300026089 Bacteria 2961
166 Ga0207648_10268174 3300026089 Bacteria 1525
167 Ga0207675_102142186 3300026118 Bacteria 575
168 Ga0207698_10186564 3300026142 Bacteria 1843
169 Ga0207698_10539167 3300026142 Bacteria 1142
170 Ga0265337_1001321 3300028556 Bacteria 12353
171 Ga0265326_10004689 3300028558 Bacteria 4358
172 Ga0265319_1000581 3300028563 Bacteria 24540
173 Ga0265334_10087197 3300028573 Bacteria 1143
174 Ga0265318_10000976 3300028577 Bacteria 18349
175 Ga0265323_10106025 3300028653 Bacteria 925
176 Ga0265322_10022699 3300028654 Bacteria 1795
177 Ga0265336_10000001 3300028666 Bacteria 916179
178 Ga0265338_10000004 3300028800 Bacteria 644793
179 Ga0265338_10015764 3300028800 Bacteria 8277
180 Ga0316176_1184707 3300030732 Bacteria 547
181 Ga0314311_1020881 3300030733 Bacteria 661
182 Ga0265328_10235318 3300031239 Bacteria 699
183 Ga0265340_10000002 3300031247 Bacteria 711693
184 Ga0265339_10109109 3300031249 Unclassified 1433
185 Ga0265327_10004464 3300031251 Bacteria 12371
186 Ga0265327_10009205 3300031251 Bacteria 7164
187 Ga0265327_10029925 3300031251 Bacteria 3088
188 Ga0265316_10247205 3300031344 Bacteria 1311
189 Ga0307408_100443993 3300031548 Bacteria 1124
190 Ga0307408_101006638 3300031548 Bacteria 768
191 Ga0307408_101660576 3300031548 Bacteria 608
192 Ga0265342_10089166 3300031712 Bacteria 1770
193 Ga0265342_10410796 3300031712 Bacteria 698
194 Ga0307405_10200127 3300031731 Bacteria 1450
195 Ga0307405_10408402 3300031731 Bacteria 1065
196 Ga0307405_10818019 3300031731 Bacteria 782
197 Ga0307405_11594589 3300031731 Bacteria 576
198 Ga0307413_10106296 3300031824 Bacteria 1868
199 Ga0307413_10496292 3300031824 Bacteria 979
200 Ga0307413_11073109 3300031824 Bacteria 694
201 Ga0307413_11836744 3300031824 Bacteria 543
202 Ga0307413_11904317 3300031824 Bacteria 534
203 Ga0307410_10131802 3300031852 Bacteria 1837
204 Ga0307410_10274609 3300031852 Bacteria 1320
205 Ga0307410_10658150 3300031852 Bacteria 879
206 Ga0307410_11245253 3300031852 Bacteria 649
207 Ga0307406_11028046 3300031901 Bacteria 708
208 Ga0307406_11104480 3300031901 Bacteria 685
209 Ga0307407_10108324 3300031903 Bacteria 1739
210 Ga0307407_10294543 3300031903 Bacteria 1129
211 Ga0307407_10648367 3300031903 Unclassified 791
212 Ga0307412_10781100 3300031911 Bacteria 827
213 Ga0307412_11004707 3300031911 Bacteria 737
214 Ga0307409_100099685 3300031995 Bacteria 2406
215 Ga0307409_100815622 3300031995 Bacteria 942
216 Ga0307409_101123659 3300031995 Bacteria 807
217 Ga0307409_101541771 3300031995 Bacteria 692
218 Ga0307409_101702270 3300031995 Bacteria 659
219 Ga0307409_101901240 3300031995 Unclassified 625
220 Ga0307416_100036777 3300032002 Bacteria 3759
221 Ga0307416_100076241 3300032002 Bacteria 2810
222 Ga0307416_100197802 3300032002 Bacteria 1903
223 Ga0307416_100215879 3300032002 Bacteria 1835
224 Ga0307416_100295299 3300032002 Bacteria 1607
225 Ga0307416_100526488 3300032002 Bacteria 1251
226 Ga0307416_100708762 3300032002 Bacteria 1096
227 Ga0307416_101982188 3300032002 Bacteria 685
228 Ga0307416_103171093 3300032002 Bacteria 550
229 Ga0307414_10250055 3300032004 Bacteria 1473
230 Ga0307414_10854379 3300032004 Bacteria 832
231 Ga0307414_10976244 3300032004 Bacteria 779
232 Ga0307414_11182524 3300032004 Bacteria 708
233 Ga0307411_10274309 3300032005 Bacteria 1339
234 Ga0307411_10314454 3300032005 Bacteria 1262
235 Ga0307415_100050081 3300032126 Bacteria 2828
236 Ga0307415_100461832 3300032126 Bacteria 1100
237 Ga0307415_101031280 3300032126 Bacteria 766
238 Ga0307415_101126927 3300032126 Bacteria 736
239 Ga0307415_101167063 3300032126 Bacteria 724
240 Ga0307415_101560163 3300032126 Bacteria 633
241 Ga0373947_0839160 3300035725 Bacteria 627
242 Ga0373937_0180388 3300036401 Unclassified 1983
243 Ga0373937_1898137 3300036401 Unclassified 542
244 Ga0436364_1068218 3300037853 Bacteria 910
245 Ga0436364_1144136 3300037853 Bacteria 610
246 Ga0395901_0799912 3300038443 Bacteria 932
247 Ga0395901_1184068 3300038443 Bacteria 731
248 Ga0436365_0110090 3300039437 Bacteria 2433
249 Ga0436365_0768982 3300039437 Bacteria 1354
250 Ga0436363_0282143 3300039450 Unclassified 788
251 Ga0436363_1559163 3300039450 Bacteria 510
252 Ga0451807_0809165 3300041486 Bacteria 677
253 Ga0451845_0910241 3300041501 Bacteria 584
254 Ga0451853_1819362 3300041512 Bacteria 567
255 Ga0439448_0081619 3300042005 Bacteria 1086
256 Ga0439448_0166081 3300042005 Bacteria 769
257 Ga0439450_050287 3300042008 Bacteria 988
258 Ga0439463_061086 3300042016 Bacteria 963
259 Ga0450905_063123 3300042142 Bacteria 622
260 Ga0439458_0157079 3300042157 Bacteria 611
261 Ga0439444_0197518 3300042437 Bacteria 506
262 Ga0439464_0104654 3300042439 Bacteria 862
263 Ga0466972_0498504 3300044658 Bacteria 573
264 Ga0466965_0204327 3300044683 Bacteria 1049
265 Ga0466966_0927336 3300044684 Bacteria 525
266 Ga0466963_0071241 3300044694 Bacteria 2339
267 Ga0466963_0100528 3300044694 Bacteria 1979
268 Ga0466963_0226954 3300044694 Unclassified 1308
269 Ga0466963_0962297 3300044694 Bacteria 601
270 Ga0466957_0028723 3300044842 Bacteria 3313
271 Ga0466959_0638274 3300045049 Bacteria 715
272 Ga0466958_0162868 3300045836 Bacteria 1410
273 Ga0466958_0933019 3300045836 Bacteria 566
274 Ga0466958_1021216 3300045836 Bacteria 540
275 Ga0466958_1059216 3300045836 Bacteria 529
276 Ga0466967_0066531 3300045976 Bacteria 3211
277 Ga0466967_0144199 3300045976 Bacteria 2220
278 Ga0466967_0480383 3300045976 Bacteria 1217
279 Ga0466967_0729810 3300045976 Bacteria 982
280 Ga0466967_1175278 3300045976 Bacteria 764
281 Ga0466967_2526859 3300045976 Bacteria 508
282 Ga0495592_0598041 3300046454 Bacteria 673
283 Ga0495590_0035969 3300046457 Bacteria 1728
284 Ga0495629_0853845 3300046459 Bacteria 599
285 Ga0495653_0000374 3300046463 Bacteria 36082
286 Ga0495653_0146237 3300046463 Bacteria 1656
287 Ga0495664_0000007 3300046477 Bacteria 386710
288 Ga0495584_0552190 3300046491 Bacteria 587
289 Ga0495596_0094448 3300046500 Bacteria 1161
290 Ga0495608_0239179 3300046511 Bacteria 1135
291 Ga0495608_0874200 3300046511 Bacteria 527
292 Ga0495616_0100313 3300046513 Bacteria 1359
293 Ga0495616_0282642 3300046513 Bacteria 705
294 Ga0495618_0000151 3300046514 Bacteria 49582
295 Ga0495630_0000414 3300046517 Bacteria 32942
296 Ga0495632_0372875 3300046519 Bacteria 626
297 Ga0495637_0194062 3300046520 Bacteria 748
298 Ga0495652_0078948 3300046529 Bacteria 2723
299 Ga0495665_0205027 3300046531 Bacteria 1022
300 Ga0495598_0449186 3300046537 Bacteria 510
301 Ga0495597_0151381 3300046542 Bacteria 952
302 Ga0495597_0201420 3300046542 Bacteria 797
303 Ga0495645_0001966 3300046543 Bacteria 13967
304 Ga0495657_0000008 3300046675 Bacteria 221090
305 Ga0495599_0311479 3300046678 Unclassified 949
306 Ga0495646_0243042 3300046680 Bacteria 967
307 Ga0495646_0690388 3300046680 Bacteria 514
308 Ga0495670_0109524 3300046691 Bacteria 1428
309 Ga0495604_0000047 3300047317 Bacteria 109717
310 Ga0495676_0466174 3300047321 Bacteria 832
311 Ga0495684_0002636 3300047471 Bacteria 14253
312 Ga0495684_0100218 3300047471 Bacteria 2190
313 Ga0496100_0004800 3300048903 Bacteria 7219
314 Ga0496100_0342390 3300048903 Bacteria 1128
315 Ga0496101_0797350 3300048904 Bacteria 745
316 Ga0496101_1191822 3300048904 Bacteria 597
317 Ga0496102_0000002 3300048905 Bacteria 814588
318 Ga0496102_0144140 3300048905 Bacteria 2235
319 Ga0496103_0000046 3300048906 Bacteria 161981
320 Ga0496103_0175389 3300048906 Bacteria 1377
321 Ga0496104_0000001 3300048907 Bacteria 711867
322 Ga0496109_0197554 3300048912 Bacteria 1891
323 Ga0496110_0000502 3300048913 Bacteria 26572
324 Ga0496111_0001359 3300048914 Bacteria 13843
325 Ga0496113_0166621 3300048916 Bacteria 1744
326 Ga0496114_0994518 3300048917 Bacteria 722
327 Ga0496115_0000034 3300048918 Bacteria 135380
328 Ga0496115_0000329 3300048918 Bacteria 40480
329 Ga0496123_0511071 3300048926 Bacteria 523
330 Ga0501290_099911 3300049513 Bacteria 515
331 Ga0501291_065053 3300049514 Bacteria 695
332 Ga0501291_078164 3300049514 Bacteria 654
333 Ga0501295_175248 3300049518 Bacteria 537
334 Ga0501298_119085 3300049521 Bacteria 620
335 Ga0501299_043574 3300049522 Bacteria 907
336 Ga0501299_065390 3300049522 Bacteria 779
337 Ga0501299_078916 3300049522 Bacteria 728
338 Ga0501302_022694 3300049525 Bacteria 553
339 Ga0501201_056492 3300049651 Bacteria 500
340 Ga0501202_017315 3300049652 Bacteria 1407
341 Ga0501208_061088 3300049655 Bacteria 738
342 Ga0501209_198252 3300049656 Bacteria 617
343 Ga0501216_093529 3300049660 Bacteria 653
344 Ga0501227_213129 3300049665 Bacteria 549
345 Ga0501230_125589 3300049667 Bacteria 571
346 Ga0501233_009079 3300049668 Bacteria 1934
347 Ga0501233_166006 3300049668 Bacteria 624
348 Ga0501243_030010 3300049675 Bacteria 925
349 Ga0501248_027335 3300049678 Bacteria 631
350 Ga0501249_224799 3300049679 Bacteria 501
351 Ga0501221_077332 3300049704 Bacteria 795
352 Ga0501225_0090945 3300049705 Bacteria 884
353 Ga0501283_060666 3300049779 Bacteria 683
354 Ga0501212_010654 3300049851 Bacteria 1314
355 nmdc:mga05p37_598232_c1 3300050507 Bacteria 1245
356 nmdc:mga05p37_944068_c1 3300050507 Bacteria 924
357 nmdc:mga0qj67_500132_c1 3300050509 Bacteria 977
358 nmdc:mga0qj67_814842_c1 3300050509 Bacteria 738
359 nmdc:mga06r32_125336_c1 3300050510 Bacteria 2536
360 nmdc:mga06r32_1825033_c1 3300050510 Bacteria 543
361 nmdc:mga08y16_1729635_c1 3300050511 Bacteria 580
362 nmdc:mga08y16_495303_c1 3300050511 Bacteria 1242
363 nmdc:mga0n895_197057_c1 3300050512 Bacteria 2045
364 Ga0495601_0000276 3300053077 Bacteria 27580
365 Ga0495601_0046778 3300053077 Bacteria 2723
366 Ga0495612_0000023 3300053078 Bacteria 118413
367 Ga0495619_0186033 3300053085 Bacteria 1437
368 Ga0495619_0368548 3300053085 Bacteria 993
369 Ga0495619_0618230 3300053085 Unclassified 740
370 Ga0590071_022249 3300059421 Bacteria 1497
371 Ga0590071_028072 3300059421 Bacteria 1336
372 Ga0590074_017938 3300059423 Bacteria 1210
373 Ga0590075_010557 3300059424 Bacteria 2225
374 Ga0590077_031868 3300059426 Bacteria 1153
375 Ga0587094_009356 3300059513 Unclassified 1249
376 Ga0501082_1740641 3300060353 Bacteria 544
377 Ga0466962_0636400 3300061719 Bacteria 545
378 Ga0495600_0029267
379 JGI25406J46586_10082391
380 JGI25406J46586_10139465
381 JGI25407J50210_10142791
382 Ga0070683_100110448
383 Ga0070683_102278089
384 Ga0070680_101221982
385 Ga0070682_100672454
386 Ga0068868_100300825
387 Ga0070689_102096349
388 Ga0070661_100608879
389 Ga0070668_100939624
390 Ga0070688_100111276
391 Ga0070659_100214082
392 Ga0070709_10208623
393 Ga0070709_10561979
394 Ga0070709_10681783
395 Ga0070709_11084399
396 Ga0070714_100067170
397 Ga0070714_100119558
398 Ga0070714_100249965
399 Ga0070714_101225473
400 Ga0070714_101574810
401 Ga0070713_100430788
402 Ga0070713_101582714
403 Ga0070710_10083855
404 Ga0070710_10461355
405 Ga0070710_10807288
406 Ga0070701_10708889
407 Ga0070711_100025967
408 Ga0070711_101326061
409 Ga0070700_100211571
410 Ga0070708_100008029
411 Ga0070663_101348309
412 Ga0070662_100648643
413 Ga0070681_10443566
414 Ga0068867_100206927
415 Ga0068867_101903166
416 Ga0070685_10813630
417 Ga0070706_100007300
418 Ga0070707_100001888
419 Ga0070707_100665600
420 Ga0070698_100001377
421 Ga0070699_101547362
422 Ga0068853_100995906
423 Ga0070672_100771974
424 Ga0070686_101928208
425 Ga0070695_101251668
426 Ga0070696_100867493
427 Ga0070664_100023880
428 Ga0070664_100217766
429 Ga0068856_100196695
430 Ga0068856_101242968
431 Ga0070702_100365455
432 Ga0068852_101194412
433 Ga0068866_10282139
434 Ga0068851_10541100
435 Ga0081455_10001214
436 Ga0081538_10000332
437 Ga0081538_10045625
438 Ga0081538_10072232
439 Ga0081540_1064799
440 Ga0081539_10003484
441 Ga0081539_10025144
442 Ga0081539_10044799
443 Ga0081539_10189204
444 Ga0081539_10335590
445 Ga0070717_10016827
446 Ga0070716_100049499
447 Ga0070716_100182206
448 Ga0070712_100117806
449 Ga0070712_100138516
450 Ga0070712_100333174
451 Ga0070712_101159479
452 Ga0070712_101673256
453 Ga0070712_101744722
454 Ga0075428_100178471
455 Ga0075428_100828992
456 Ga0075428_102386474
457 Ga0075430_100147019
458 Ga0075430_100179370
459 Ga0075431_100070382
460 Ga0075435_100738595
461 Ga0105240_10004346
462 Ga0111539_10936981
463 Ga0111539_12763430
464 Ga0105245_10855386
465 Ga0105245_11150901
466 Ga0105245_12026643
467 Ga0114129_10392494
468 Ga0114129_13313038
469 Ga0105243_10091934
470 Ga0105243_11109511
471 Ga0105242_10678815
472 Ga0105237_10013622
473 Ga0105238_11325327
474 Ga0105239_10467186
475 Ga0105239_10714886
476 Ga0105246_11940128
477 Ga0157370_12084741
478 Ga0157369_12127762
479 Ga0163162_10437733
480 Ga0157372_10395861
481 Ga0157375_12708528
482 Ga0157377_10295718
483 Ga0157377_10490290
484 Ga0157376_12499850
485 Ga0206349_1235485
486 Ga0206354_10038934
487 Ga0206354_10721846
488 Ga0206353_10401775
489 Ga0206353_11834438
490 Ga0213876_10491868
491 Ga0207656_10338691
492 Ga0207682_10071858
493 Ga0207692_10356247
494 Ga0207692_10997999
495 Ga0207688_10037894
496 Ga0207688_10685148
497 Ga0207685_10495891
498 Ga0207699_10047405
499 Ga0207699_10816944
500 Ga0207695_10064774
501 Ga0207671_10008955
502 Ga0207693_10073804
503 Ga0207693_10100780
504 Ga0207693_10209937
505 Ga0207693_10286037
506 Ga0207693_11135164
507 Ga0207663_10018720
508 Ga0207663_10235739
509 Ga0207663_10375008
510 Ga0207660_10835270
511 Ga0207649_10711820
512 Ga0207646_10029958
513 Ga0207646_10538963
514 Ga0207694_11445440
515 Ga0207659_11176984
516 Ga0207659_11255872
517 Ga0207687_10105671
518 Ga0207700_10764172
519 Ga0207664_10102728
520 Ga0207664_10119357
521 Ga0207664_10194480
522 Ga0207664_11029051
523 Ga0207664_11085385
524 Ga0207664_11296371
525 Ga0207664_11814903
526 Ga0207664_11998289
527 Ga0207690_10181324
528 Ga0207686_10657389
529 Ga0207704_11255750
530 Ga0207665_10079567
531 Ga0207665_10216201
532 Ga0207691_10232914
533 Ga0207689_10292673
534 Ga0207661_11917426
535 Ga0207679_10014920
536 Ga0207640_10099239
537 Ga0207658_10251269
538 Ga0207677_11795988
539 Ga0207639_10581969
540 Ga0207639_10661709
541 Ga0207702_10576188
542 Ga0207648_10074369
543 Ga0207648_10268174
544 Ga0207675_102142186
545 Ga0207698_10186564
546 Ga0207698_10539167
547 Ga0265337_1001321
548 Ga0265326_10004689
549 Ga0265319_1000581
550 Ga0265334_10087197
551 Ga0265318_10000976
552 Ga0265323_10106025
553 Ga0265322_10022699
554 Ga0265336_10000001
555 Ga0265338_10000004
556 Ga0265338_10015764
557 Ga0316176_1184707
558 Ga0314311_1020881
559 Ga0265328_10235318
560 Ga0265340_10000002
561 Ga0265339_10109109
562 Ga0265327_10004464
563 Ga0265327_10009205
564 Ga0265327_10029925
565 Ga0265316_10247205
566 Ga0307408_100443993
567 Ga0307408_101006638
568 Ga0307408_101660576
569 Ga0265342_10089166
570 Ga0265342_10410796
571 Ga0307405_10200127
572 Ga0307405_10408402
573 Ga0307405_10818019
574 Ga0307405_11594589
575 Ga0307413_10106296
576 Ga0307413_10496292
577 Ga0307413_11073109
578 Ga0307413_11836744
579 Ga0307413_11904317
580 Ga0307410_10131802
581 Ga0307410_10274609
582 Ga0307410_10658150
583 Ga0307410_11245253
584 Ga0307406_11028046
585 Ga0307406_11104480
586 Ga0307407_10108324
587 Ga0307407_10294543
588 Ga0307407_10648367
589 Ga0307412_10781100
590 Ga0307412_11004707
591 Ga0307409_100099685
592 Ga0307409_100815622
593 Ga0307409_101123659
594 Ga0307409_101541771
595 Ga0307409_101702270
596 Ga0307409_101901240
597 Ga0307416_100036777
598 Ga0307416_100076241
599 Ga0307416_100197802
600 Ga0307416_100215879
601 Ga0307416_100295299
602 Ga0307416_100526488
603 Ga0307416_100708762
604 Ga0307416_101982188
605 Ga0307416_103171093
606 Ga0307414_10250055
607 Ga0307414_10854379
608 Ga0307414_10976244
609 Ga0307414_11182524
610 Ga0307411_10274309
611 Ga0307411_10314454
612 Ga0307415_100050081
613 Ga0307415_100461832
614 Ga0307415_101031280
615 Ga0307415_101126927
616 Ga0307415_101167063
617 Ga0307415_101560163
618 Ga0373947_0839160
619 Ga0373937_0180388
620 Ga0373937_1898137
621 Ga0436364_1068218
622 Ga0436364_1144136
623 Ga0395901_0799912
624 Ga0395901_1184068
625 Ga0436365_0110090
626 Ga0436365_0768982
627 Ga0436363_0282143
628 Ga0436363_1559163
629 Ga0451807_0809165
630 Ga0451845_0910241
631 Ga0451853_1819362
632 Ga0439448_0081619
633 Ga0439448_0166081
634 Ga0439450_050287
635 Ga0439463_061086
636 Ga0450905_063123
637 Ga0439458_0157079
638 Ga0439444_0197518
639 Ga0439464_0104654
640 Ga0466972_0498504
641 Ga0466965_0204327
642 Ga0466966_0927336
643 Ga0466963_0071241
644 Ga0466963_0100528
645 Ga0466963_0226954
646 Ga0466963_0962297
647 Ga0466957_0028723
648 Ga0466959_0638274
649 Ga0466958_0162868
650 Ga0466958_0933019
651 Ga0466958_1021216
652 Ga0466958_1059216
653 Ga0466967_0066531
654 Ga0466967_0144199
655 Ga0466967_0480383
656 Ga0466967_0729810
657 Ga0466967_1175278
658 Ga0466967_2526859
659 Ga0495592_0598041
660 Ga0495590_0035969
661 Ga0495629_0853845
662 Ga0495653_0000374
663 Ga0495653_0146237
664 Ga0495664_0000007
665 Ga0495584_0552190
666 Ga0495596_0094448
667 Ga0495608_0239179
668 Ga0495608_0874200
669 Ga0495616_0100313
670 Ga0495616_0282642
671 Ga0495618_0000151
672 Ga0495630_0000414
673 Ga0495632_0372875
674 Ga0495637_0194062
675 Ga0495652_0078948
676 Ga0495665_0205027
677 Ga0495598_0449186
678 Ga0495597_0151381
679 Ga0495597_0201420
680 Ga0495645_0001966
681 Ga0495657_0000008
682 Ga0495599_0311479
683 Ga0495646_0243042
684 Ga0495646_0690388
685 Ga0495670_0109524
686 Ga0495604_0000047
687 Ga0495676_0466174
688 Ga0495684_0002636
689 Ga0495684_0100218
690 Ga0496100_0004800
691 Ga0496100_0342390
692 Ga0496101_0797350
693 Ga0496101_1191822
694 Ga0496102_0000002
695 Ga0496102_0144140
696 Ga0496103_0000046
697 Ga0496103_0175389
698 Ga0496104_0000001
699 Ga0496109_0197554
700 Ga0496110_0000502
701 Ga0496111_0001359
702 Ga0496113_0166621
703 Ga0496114_0994518
704 Ga0496115_0000034
705 Ga0496115_0000329
706 Ga0496123_0511071
707 Ga0501290_099911
708 Ga0501291_065053
709 Ga0501291_078164
710 Ga0501295_175248
711 Ga0501298_119085
712 Ga0501299_043574
713 Ga0501299_065390
714 Ga0501299_078916
715 Ga0501302_022694
716 Ga0501201_056492
717 Ga0501202_017315
718 Ga0501208_061088
719 Ga0501209_198252
720 Ga0501216_093529
721 Ga0501227_213129
722 Ga0501230_125589
723 Ga0501233_009079
724 Ga0501233_166006
725 Ga0501243_030010
726 Ga0501248_027335
727 Ga0501249_224799
728 Ga0501221_077332
729 Ga0501225_0090945
730 Ga0501283_060666
731 Ga0501212_010654
732 nmdc:mga05p37_598232_c1
733 nmdc:mga05p37_944068_c1
734 nmdc:mga0qj67_500132_c1
735 nmdc:mga0qj67_814842_c1
736 nmdc:mga06r32_125336_c1
737 nmdc:mga06r32_1825033_c1
738 nmdc:mga08y16_1729635_c1
739 nmdc:mga08y16_495303_c1
740 nmdc:mga0n895_197057_c1
741 Ga0495601_0000276
742 Ga0495601_0046778
743 Ga0495612_0000023
744 Ga0495619_0186033
745 Ga0495619_0368548
746 Ga0495619_0618230
747 Ga0590071_022249
748 Ga0590071_028072
749 Ga0590074_017938
750 Ga0590075_010557
751 Ga0590077_031868
752 Ga0587094_009356
753 Ga0501082_1740641
754 Ga0466962_0636400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

20

91

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.9268 1 75
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.9155 1 75
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.9011 1 80
2zbc-assembly1.cif.gz_C-2 crystal structure of sts042, a stand-alone ram module protein, from hyperthermophilic archaeon sulfolobus tokodaii strain7. 0.8989 3 79
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.8905 1 80
ID Description Score Start End Superfamily
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9524 1 75 3.30.70.920
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9403 1 75 3.30.70.920
2z4pD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9333 1 72 3.30.70.920
2zbcB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9179 3 73 3.30.70.920
2cg4B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9059 2 75 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A1Q7PR05-F1-model_v4 Transcription regulator AsnC/Lrp ligand binding domain-containing protein 0.9705 2 71
AF-A0A7C3G3J6-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9703 1 71
AF-A0A2E8V9Y8-F1-model_v4 AsnC family transcriptional regulator 0.9676 1 71
AF-A0A370LSD5-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9669 2 72
AF-A0A2D6LDK9-F1-model_v4 deleted 0.9664 2 71

Map