F427962

General Info

Members Datasets Scaffolds Average Seq Length
378 235 756 379

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100075627|Ga0068861_1000756273
Length 414
Sequence VCGLEPAPSHAHAAAILRSGKRSLTAVIVYAQKMPMHGRFLTTHVGSLPRPDDLIAMMWAREDGIPVDTAALEERVCAAVDEVVARQIGAGIDIVNDGEWGKPSYATYIKDRLNGFGGSVAPSYAFQDVEALPQTKARIAADPGRKHRKAPACTAAISVRDLEAPRKDAERLNQALRAHGARGGFLTAASPGVTALFFHNDYYQTREDYVFAIADAMRHEYEAIAAAGVTLQIDCPDLAMGRHSQFRDLDLAGFREQMELNVAALNRALVNVAAGQVRMHLCWGNYPGPHHYDVPLRDLIDVLWKAKPHAIQFEAANPRHAHEWALFETVKLPEGKVLIPGVIECQSHYIEHPELVAQRIERYARLVGRDNVMAGVDCGFSIHVGSGGVDPEVVWAKLGSLSQGAAIASRTFWP

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
211 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
212 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
215 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
216 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
219 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
220 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
226 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
235 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.73
Nodule 0
Rhizoplane 2.38
Rhizosphere 80.95
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100075627 3300005719 Bacteria 2622
2 JGI25406J46586_10017401 3300003203 Bacteria 2972
3 rootL2_10216185 3300003322 Bacteria 4026
4 JGI25407J50210_10001267 3300003373 Bacteria 5661
5 Ga0065707_10015712 3300005295 Unclassified 1669
6 Ga0065707_10086702 3300005295 Archaea 5344
7 Ga0070658_10161937 3300005327 Bacteria 1877
8 Ga0070683_100240912 3300005329 Bacteria 1720
9 Ga0070670_100169673 3300005331 Unclassified 1892
10 Ga0070680_100011867 3300005336 Bacteria 6758
11 Ga0070680_100046832 3300005336 Bacteria 3519
12 Ga0070680_100263223 3300005336 Bacteria 1459
13 Ga0068868_100288957 3300005338 Bacteria 1390
14 Ga0070660_100016109 3300005339 Bacteria 5419
15 Ga0070660_100025691 3300005339 Bacteria 4379
16 Ga0070689_100098854 3300005340 Bacteria 2308
17 Ga0070691_10016326 3300005341 Bacteria 3410
18 Ga0070661_100017959 3300005344 Bacteria 5024
19 Ga0070661_100044203 3300005344 Bacteria 3254
20 Ga0070668_100085971 3300005347 Bacteria 2472
21 Ga0070675_100092174 3300005354 Bacteria 2540
22 Ga0070671_100005164 3300005355 Bacteria 10392
23 Ga0070674_100009447 3300005356 Bacteria 5839
24 Ga0070673_100006622 3300005364 Bacteria 7546
25 Ga0070659_100073685 3300005366 Bacteria 2718
26 Ga0070667_100001893 3300005367 Bacteria 18566
27 Ga0070713_100130087 3300005436 Bacteria 2219
28 Ga0070705_100154534 3300005440 Bacteria 1526
29 Ga0070694_100157520 3300005444 Bacteria 1663
30 Ga0070663_100005660 3300005455 Bacteria 7444
31 Ga0070662_100005615 3300005457 Bacteria 8022
32 Ga0070662_100055343 3300005457 Bacteria 2878
33 Ga0070662_100135550 3300005457 Bacteria 1903
34 Ga0070681_10009282 3300005458 Bacteria 9673
35 Ga0070681_10009287 3300005458 Bacteria 9671
36 Ga0070681_10026967 3300005458 Bacteria 5776
37 Ga0070681_10034978 3300005458 Bacteria 5045
38 Ga0070681_10056911 3300005458 Bacteria 3890
39 Ga0070707_100220871 3300005468 Bacteria 1845
40 Ga0070707_100359107 3300005468 Bacteria 1415
41 Ga0070699_100353712 3300005518 Bacteria 1323
42 Ga0070679_100000605 3300005530 Bacteria 30538
43 Ga0070679_100005220 3300005530 Bacteria 12022
44 Ga0070679_100070263 3300005530 Bacteria 3493
45 Ga0070679_100074041 3300005530 Bacteria 3396
46 Ga0070679_100132446 3300005530 Bacteria 2474
47 Ga0070679_100191893 3300005530 Unclassified 2011
48 Ga0070684_100035423 3300005535 Bacteria 4271
49 Ga0070684_100164486 3300005535 Bacteria 2014
50 Ga0070697_100094543 3300005536 Bacteria 2477
51 Ga0068853_100007057 3300005539 Bacteria 8983
52 Ga0068853_100207578 3300005539 Bacteria 1785
53 Ga0070695_100159981 3300005545 Bacteria 1580
54 Ga0070665_100053497 3300005548 Bacteria 4049
55 Ga0070665_100122264 3300005548 Bacteria 2605
56 Ga0070665_100195833 3300005548 Unclassified 2022
57 Ga0068855_100006506 3300005563 Bacteria 14207
58 Ga0068855_100031395 3300005563 Bacteria 6344
59 Ga0068855_100041951 3300005563 Bacteria 5422
60 Ga0068855_100129698 3300005563 Unclassified 2880
61 Ga0070664_100037782 3300005564 Bacteria 4061
62 Ga0068856_100030184 3300005614 Bacteria 5299
63 Ga0068856_100328975 3300005614 Unclassified 1546
64 Ga0070702_100184187 3300005615 Bacteria 1369
65 Ga0068852_100111339 3300005616 Bacteria 2489
66 Ga0068859_100000153 3300005617 Bacteria 65765
67 Ga0068859_100000422 3300005617 Bacteria 42364
68 Ga0068859_100014799 3300005617 Bacteria 7836
69 Ga0068859_100016046 3300005617 Bacteria 7527
70 Ga0068859_100178375 3300005617 Bacteria 2207
71 Ga0068861_100020933 3300005719 Bacteria 4694
72 Ga0068861_100037304 3300005719 Bacteria 3613
73 Ga0068863_100003923 3300005841 Bacteria 14694
74 Ga0068858_100004045 3300005842 Bacteria 14458
75 Ga0068858_100010041 3300005842 Bacteria 8986
76 Ga0068860_100004110 3300005843 Bacteria 14908
77 Ga0068860_100187371 3300005843 Bacteria 2001
78 Ga0081538_10000655 3300005981 Bacteria 38278
79 Ga0081539_10000142 3300005985 Bacteria 165444
80 Ga0081539_10000215 3300005985 Bacteria 135054
81 Ga0081539_10003297 3300005985 Bacteria 20197
82 Ga0075364_10095808 3300006051 Bacteria 1973
83 Ga0075432_10016578 3300006058 Bacteria 2515
84 Ga0070715_10085026 3300006163 Bacteria 1444
85 Ga0075366_10056819 3300006195 Bacteria 2325
86 Ga0075366_10111838 3300006195 Bacteria 1643
87 Ga0075370_10027212 3300006353 Bacteria 3171
88 Ga0075431_100018646 3300006847 Bacteria 7069
89 Ga0075434_100001879 3300006871 Bacteria 18182
90 Ga0075434_100005719 3300006871 Bacteria 11353
91 Ga0075434_100038255 3300006871 Bacteria 4752
92 Ga0075429_100042687 3300006880 Bacteria 3946
93 Ga0075436_100003764 3300006914 Bacteria 10402
94 Ga0075436_100024987 3300006914 Bacteria 4107
95 Ga0075436_100032943 3300006914 Bacteria 3570
96 Ga0097620_100000153 3300006931 Bacteria 65765
97 Ga0097620_100000422 3300006931 Bacteria 42364
98 Ga0097620_100014799 3300006931 Bacteria 7836
99 Ga0097620_100016045 3300006931 Bacteria 7527
100 Ga0097620_100178376 3300006931 Bacteria 2207
101 Ga0075435_100000043 3300007076 Bacteria 64194
102 Ga0075435_100018173 3300007076 Bacteria 5338
103 Ga0105250_10018801 3300009092 Bacteria 2796
104 Ga0105240_10007240 3300009093 Bacteria 16152
105 Ga0105240_10007408 3300009093 Bacteria 15946
106 Ga0105240_10011593 3300009093 Bacteria 12268
107 Ga0105240_10139677 3300009093 Bacteria 2897
108 Ga0111539_10020559 3300009094 Bacteria 8130
109 Ga0105247_10000157 3300009101 Bacteria 66480
110 Ga0114129_10134282 3300009147 Bacteria 3396
111 Ga0114129_10195835 3300009147 Bacteria 2740
112 Ga0105243_10082273 3300009148 Bacteria 2631
113 Ga0105242_10155615 3300009176 Bacteria 1997
114 Ga0105248_10002210 3300009177 Bacteria 21556
115 Ga0105248_10008979 3300009177 Bacteria 10988
116 Ga0105248_10121345 3300009177 Bacteria 2948
117 Ga0105237_10045468 3300009545 Unclassified 4418
118 Ga0105237_10111826 3300009545 Bacteria 2723
119 Ga0105237_10212701 3300009545 Unclassified 1933
120 Ga0105238_10006833 3300009551 Bacteria 11390
121 Ga0105238_10166606 3300009551 Bacteria 2179
122 Ga0105238_10251330 3300009551 Bacteria 1746
123 Ga0105249_10009899 3300009553 Bacteria 8358
124 Ga0105249_10104431 3300009553 Bacteria 2670
125 Ga0105239_10512528 3300010375 Bacteria 1364
126 Ga0105246_10000171 3300011119 Bacteria 31499
127 Ga0157373_10013986 3300013100 Bacteria 5883
128 Ga0157373_10110194 3300013100 Bacteria 1935
129 Ga0157371_10004137 3300013102 Bacteria 12794
130 Ga0157371_10055059 3300013102 Bacteria 2823
131 Ga0157370_10002168 3300013104 Bacteria 23945
132 Ga0157370_10011556 3300013104 Bacteria 9217
133 Ga0157369_10035747 3300013105 Bacteria 5446
134 Ga0157369_10106368 3300013105 Bacteria 2986
135 Ga0157369_10174159 3300013105 Bacteria 2266
136 Ga0157372_10002807 3300013307 Bacteria 18810
137 Ga0157372_10044104 3300013307 Bacteria 4941
138 Ga0157375_10277765 3300013308 Bacteria 1838
139 Ga0163163_10015805 3300014325 Bacteria 6991
140 Ga0157380_10013630 3300014326 Bacteria 5933
141 Ga0157380_10338129 3300014326 Bacteria 1403
142 Ga0157376_10276150 3300014969 Bacteria 1581
143 Ga0207710_10000403 3300025900 Bacteria 28711
144 Ga0207710_10014222 3300025900 Unclassified 3354
145 Ga0207647_10104078 3300025904 Bacteria 1682
146 Ga0207705_10000948 3300025909 Bacteria 23681
147 Ga0207705_10005563 3300025909 Bacteria 9418
148 Ga0207707_10000052 3300025912 Bacteria 117200
149 Ga0207707_10006638 3300025912 Bacteria 10098
150 Ga0207707_10007630 3300025912 Bacteria 9428
151 Ga0207707_10010553 3300025912 Bacteria 8020
152 Ga0207695_10004526 3300025913 Bacteria 18921
153 Ga0207695_10079553 3300025913 Bacteria 3322
154 Ga0207695_10260481 3300025913 Bacteria 1632
155 Ga0207695_10348600 3300025913 Bacteria 1368
156 Ga0207671_10023230 3300025914 Unclassified 4678
157 Ga0207671_10025945 3300025914 Unclassified 4396
158 Ga0207671_10111297 3300025914 Bacteria 2083
159 Ga0207663_10004802 3300025916 Bacteria 6752
160 Ga0207660_10003561 3300025917 Bacteria 10142
161 Ga0207662_10029602 3300025918 Bacteria 3174
162 Ga0207657_10002943 3300025919 Bacteria 18270
163 Ga0207657_10023624 3300025919 Bacteria 5719
164 Ga0207657_10178182 3300025919 Bacteria 1719
165 Ga0207649_10050774 3300025920 Bacteria 2566
166 Ga0207652_10000816 3300025921 Bacteria 29752
167 Ga0207652_10001360 3300025921 Bacteria 21746
168 Ga0207652_10030341 3300025921 Bacteria 4526
169 Ga0207652_10151966 3300025921 Bacteria 2073
170 Ga0207694_10016711 3300025924 Bacteria 5547
171 Ga0207694_10118536 3300025924 Bacteria 2112
172 Ga0207694_10254820 3300025924 Unclassified 1437
173 Ga0207650_10163641 3300025925 Unclassified 1764
174 Ga0207687_10071468 3300025927 Bacteria 2479
175 Ga0207644_10036111 3300025931 Bacteria 3467
176 Ga0207690_10002833 3300025932 Bacteria 10461
177 Ga0207690_10122816 3300025932 Bacteria 1889
178 Ga0207706_10002054 3300025933 Bacteria 19742
179 Ga0207706_10109302 3300025933 Bacteria 2433
180 Ga0207709_10017215 3300025935 Bacteria 4030
181 Ga0207670_10062527 3300025936 Bacteria 2545
182 Ga0207711_10004141 3300025941 Bacteria 12421
183 Ga0207711_10019068 3300025941 Bacteria 5707
184 Ga0207711_10041797 3300025941 Bacteria 3905
185 Ga0207689_10089452 3300025942 Bacteria 2529
186 Ga0207661_10027529 3300025944 Bacteria 4343
187 Ga0207679_10053846 3300025945 Bacteria 2959
188 Ga0207667_10002121 3300025949 Bacteria 24834
189 Ga0207667_10009948 3300025949 Bacteria 11155
190 Ga0207667_10026631 3300025949 Bacteria 6311
191 Ga0207667_10251221 3300025949 Unclassified 1809
192 Ga0207651_10133373 3300025960 Bacteria 1905
193 Ga0207651_10232047 3300025960 Bacteria 1499
194 Ga0207703_10000979 3300026035 Bacteria 27467
195 Ga0207703_10004449 3300026035 Bacteria 11514
196 Ga0207678_10065290 3300026067 Unclassified 3126
197 Ga0207708_10203466 3300026075 Bacteria 1580
198 Ga0207702_10048975 3300026078 Bacteria 3564
199 Ga0207641_10000174 3300026088 Bacteria 89117
200 Ga0207641_10009795 3300026088 Bacteria 7889
201 Ga0207641_10037489 3300026088 Bacteria 4049
202 Ga0207641_10160649 3300026088 Bacteria 2043
203 Ga0207641_10404129 3300026088 Bacteria 1312
204 Ga0207648_10018192 3300026089 Bacteria 6365
205 Ga0207648_10032508 3300026089 Bacteria 4606
206 Ga0207675_100000014 3300026118 Bacteria 133509
207 Ga0207675_100011870 3300026118 Bacteria 8139
208 Ga0207675_100094409 3300026118 Bacteria 2814
209 Ga0207698_10221025 3300026142 Bacteria 1712
210 Ga0207428_10041673 3300027907 Bacteria 3716
211 Ga0268266_10002628 3300028379 Bacteria 18968
212 Ga0268266_10102055 3300028379 Bacteria 2530
213 Ga0268266_10107403 3300028379 Unclassified 2468
214 Ga0268264_10000479 3300028381 Bacteria 53513
215 Ga0268264_10033189 3300028381 Bacteria 4238
216 Ga0268264_10146937 3300028381 Bacteria 2109
217 Ga0265334_10020114 3300028573 Bacteria 2737
218 Ga0265318_10004197 3300028577 Bacteria 7032
219 Ga0307517_10068953 3300028786 Bacteria 3212
220 Ga0307515_10048797 3300028794 Bacteria 6392
221 Ga0265338_10000014 3300028800 Bacteria 378751
222 Ga0265338_10011294 3300028800 Bacteria 10335
223 Ga0265338_10019884 3300028800 Bacteria 7094
224 Ga0265332_10052457 3300031238 Bacteria 1751
225 Ga0265332_10054387 3300031238 Bacteria 1717
226 Ga0265325_10000013 3300031241 Bacteria 142935
227 Ga0265331_10012185 3300031250 Bacteria 4668
228 Ga0265327_10002569 3300031251 Bacteria 18794
229 Ga0265327_10049270 3300031251 Bacteria 2210
230 Ga0307509_10000013 3300031507 Bacteria 283027
231 Ga0307509_10054620 3300031507 Bacteria 4251
232 Ga0307509_10143144 3300031507 Bacteria 2322
233 Ga0265313_10005414 3300031595 Bacteria 9407
234 Ga0307508_10016482 3300031616 Bacteria 6728
235 Ga0265314_10011952 3300031711 Bacteria 7121
236 Ga0316578_10091913 3300031728 Bacteria 1813
237 Ga0307516_10037129 3300031730 Bacteria 4872
238 Ga0307410_10084898 3300031852 Bacteria 2233
239 Ga0307409_100062527 3300031995 Bacteria 2915
240 Ga0316583_10007593 3300032133 Bacteria 3905
241 Ga0307507_10072835 3300033179 Bacteria 3093
242 Ga0307510_10004928 3300033180 Bacteria 15801
243 Ga0373930_0004992 3300034816 Bacteria 2184
244 Ga0373950_0000633 3300034818 Bacteria 4353
245 Ga0373958_0000812 3300034819 Bacteria 4001
246 Ga0373938_0000483 3300034957 Bacteria 6450
247 Ga0373929_0001465 3300035085 Bacteria 4492
248 Ga0373940_0018908 3300035088 Bacteria 1734
249 Ga0373949_0001293 3300035090 Bacteria 7268
250 Ga0373949_0001313 3300035090 Bacteria 7182
251 Ga0373951_0001639 3300035091 Bacteria 5871
252 Ga0373932_0003955 3300035112 Bacteria 3530
253 Ga0373936_0000094 3300035113 Bacteria 32178
254 Ga0373936_0033350 3300035113 Unclassified 2041
255 Ga0373939_0001162 3300035114 Bacteria 6446
256 Ga0373941_0003415 3300035115 Bacteria 3596
257 Ga0373941_0032248 3300035115 Bacteria 1567
258 Ga0373960_0000274 3300035121 Bacteria 9848
259 Ga0373955_0148281 3300035172 Bacteria 1379
260 Ga0373942_0000581 3300035207 Bacteria 10292
261 Ga0373961_0000083 3300035241 Bacteria 50796
262 Ga0373961_0002866 3300035241 Bacteria 4378
263 Ga0373962_0001377 3300035242 Bacteria 5731
264 Ga0373931_0010565 3300035691 Bacteria 4438
265 Ga0373933_0044473 3300035724 Bacteria 2631
266 Ga0373933_0067972 3300035724 Bacteria 2163
267 Ga0316584_0054532 3300036712 Bacteria 2992
268 Ga0316584_0090559 3300036712 Bacteria 2290
269 Ga0316584_0091080 3300036712 Bacteria 2283
270 Ga0316584_0109623 3300036712 Bacteria 2066
271 Ga0373925_0145774 3300037068 Bacteria 1856
272 Ga0395900_0326124 3300037418 Bacteria 1514
273 Ga0395898_0190111 3300037466 Bacteria 1962
274 Ga0395901_0077249 3300038443 Bacteria 3475
275 Ga0439462_0000110 3300042015 Bacteria 12759
276 Ga0451577_0012112 3300042876 Bacteria 8112
277 Ga0453684_0398370 3300044712 Bacteria 1542
278 Ga0451576_0051700 3300045051 Bacteria 4307
279 Ga0495651_0247039 3300046462 Bacteria 1221
280 Ga0495583_0000154 3300046506 Bacteria 115360
281 Ga0495606_0007157 3300046507 Bacteria 10076
282 Ga0495632_0052961 3300046519 Bacteria 1994
283 Ga0495643_0023557 3300046522 Bacteria 3500
284 Ga0495621_0017740 3300046539 Bacteria 2305
285 Ga0495645_0013673 3300046543 Bacteria 5750
286 Ga0495622_0012565 3300046557 Bacteria 3923
287 Ga0495622_0097204 3300046557 Bacteria 1351
288 Ga0495667_0062224 3300046559 Bacteria 2446
289 Ga0495625_0004506 3300046660 Bacteria 13141
290 Ga0495661_0083733 3300046665 Bacteria 1833
291 Ga0495658_0178086 3300046683 Bacteria 1318
292 Ga0495670_0112150 3300046691 Bacteria 1412
293 Ga0495673_0013798 3300047469 Bacteria 4223
294 Ga0495686_0000183 3300047472 Bacteria 119585
295 Ga0495686_0007003 3300047472 Bacteria 8520
296 Ga0495686_0011698 3300047472 Bacteria 6180
297 Ga0496102_0123584 3300048905 Bacteria 2418
298 Ga0496102_0174212 3300048905 Unclassified 2025
299 Ga0496104_0014663 3300048907 Bacteria 7079
300 Ga0496106_0126698 3300048909 Bacteria 2000
301 Ga0496106_0206058 3300048909 Bacteria 1566
302 Ga0496112_0041335 3300048915 Bacteria 4511
303 Ga0496112_0074597 3300048915 Bacteria 3354
304 Ga0496114_0004381 3300048917 Bacteria 10938
305 Ga0496114_0012184 3300048917 Bacteria 6881
306 Ga0496116_0032113 3300048919 Bacteria 3747
307 Ga0496117_0000044 3300048920 Bacteria 301076
308 Ga0496117_0024255 3300048920 Bacteria 4803
309 Ga0496118_0000025 3300048921 Bacteria 379363
310 Ga0496118_0009344 3300048921 Bacteria 9934
311 Ga0496119_0001611 3300048922 Bacteria 26732
312 Ga0496119_0002085 3300048922 Bacteria 22585
313 Ga0496120_0000098 3300048923 Bacteria 145165
314 Ga0496120_0016497 3300048923 Bacteria 4827
315 Ga0496121_0006316 3300048924 Bacteria 14794
316 Ga0496121_0016649 3300048924 Bacteria 7571
317 Ga0496121_0017522 3300048924 Bacteria 7308
318 Ga0496121_0021357 3300048924 Bacteria 6345
319 Ga0496121_0064951 3300048924 Unclassified 2973
320 Ga0496125_0000726 3300048928 Bacteria 54615
321 Ga0496125_0002830 3300048928 Bacteria 21865
322 Ga0496126_0004135 3300048929 Bacteria 17553
323 Ga0496126_0157944 3300048929 Bacteria 1939
324 Ga0495682_0008001 3300049460 Bacteria 4181
325 Ga0501034_0260220 3300049571 Bacteria 1678
326 Ga0501037_0122268 3300049573 Bacteria 1871
327 Ga0501069_0003339 3300049585 Bacteria 8235
328 Ga0501070_0012800 3300049586 Bacteria 7072
329 Ga0501075_0058239 3300049591 Bacteria 2910
330 Ga0501077_0024473 3300049593 Bacteria 3834
331 Ga0501044_0049582 3300049823 Bacteria 4334
332 nmdc:mga00v17_62837_c1 3300050491 Bacteria 2286
333 nmdc:mga0k408_45096_c1 3300050493 Bacteria 2544
334 nmdc:mga09592_101880_c1 3300050508 Bacteria 2460
335 nmdc:mga06r32_18952_c1 3300050510 Bacteria 6310
336 nmdc:mga08y16_235661_c1 3300050511 Bacteria 1893
337 nmdc:mga08y16_44610_c1 3300050511 Bacteria 4645
338 nmdc:mga0n895_9_c1 3300050512 Bacteria 119566
339 nmdc:mga0rr50_106158_c1 3300050513 Unclassified 2216
340 nmdc:mga0rr50_3595_c1 3300050513 Bacteria 8961
341 nmdc:mga0rr50_4690_c1 3300050513 Bacteria 6560
342 nmdc:mga0rr50_62_c1 3300050513 Bacteria 64188
343 nmdc:mga0rr50_95946_c1 3300050513 Bacteria 2319
344 nmdc:mga08x19_16336_c1 3300050514 Bacteria 4526
345 nmdc:mga08x19_461_c1 3300050514 Bacteria 27502
346 nmdc:mga0a205_268100_c1 3300050515 Bacteria 1585
347 nmdc:mga0a205_34802_c1 3300050515 Bacteria 4833
348 Ga0500643_000005 3300053087 Bacteria 539775
349 Ga0500643_001606 3300053087 Bacteria 12705
350 Ga0500643_011611 3300053087 Bacteria 3200
351 Ga0500646_0005542 3300053090 Bacteria 3193
352 Ga0500647_0031513 3300053091 Bacteria 2523
353 Ga0500566_0005892 3300053094 Bacteria 7288
354 Ga0500640_000140 3300053095 Bacteria 13933
355 Ga0500554_000123 3300053102 Bacteria 15320
356 Ga0500555_000747 3300053103 Bacteria 11922
357 Ga0500556_0000522 3300053104 Bacteria 26239
358 Ga0500597_054394 3300053120 Bacteria 1710
359 Ga0500614_000157 3300053123 Bacteria 17296
360 Ga0500614_006361 3300053123 Bacteria 2482
361 Ga0500618_002804 3300053125 Bacteria 6301
362 Ga0500642_0000007 3300053130 Bacteria 294238
363 Ga0500655_004493 3300053133 Bacteria 2512
364 Ga0500559_0003761 3300053136 Bacteria 7368
365 Ga0500559_0023657 3300053136 Bacteria 2609
366 Ga0500568_0000916 3300053139 Bacteria 20348
367 Ga0500577_0053418 3300053142 Bacteria 1527
368 Ga0500603_029211 3300053150 Bacteria 1412
369 Ga0500604_0000011 3300053151 Bacteria 104892
370 Ga0500616_0000123 3300053153 Bacteria 140214
371 Ga0500616_0085152 3300053153 Bacteria 1579
372 Ga0500636_0055850 3300053177 Bacteria 2314
373 Ga0500645_000980 3300053730 Bacteria 16169
374 Ga0500587_000693 3300053739 Bacteria 4297
375 Ga0501084_0233051 3300054114 Bacteria 1554
376 Ga0530510_0074058 3300061734 Bacteria 2472
377 2643951253 2643221588 Bacteria 3692460
378 2870783577 2870782633 Bacteria 9624083
379 Ga0068861_100075627
380 JGI25406J46586_10017401
381 rootL2_10216185
382 JGI25407J50210_10001267
383 Ga0065707_10015712
384 Ga0065707_10086702
385 Ga0070658_10161937
386 Ga0070683_100240912
387 Ga0070670_100169673
388 Ga0070680_100011867
389 Ga0070680_100046832
390 Ga0070680_100263223
391 Ga0068868_100288957
392 Ga0070660_100016109
393 Ga0070660_100025691
394 Ga0070689_100098854
395 Ga0070691_10016326
396 Ga0070661_100017959
397 Ga0070661_100044203
398 Ga0070668_100085971
399 Ga0070675_100092174
400 Ga0070671_100005164
401 Ga0070674_100009447
402 Ga0070673_100006622
403 Ga0070659_100073685
404 Ga0070667_100001893
405 Ga0070713_100130087
406 Ga0070705_100154534
407 Ga0070694_100157520
408 Ga0070663_100005660
409 Ga0070662_100005615
410 Ga0070662_100055343
411 Ga0070662_100135550
412 Ga0070681_10009282
413 Ga0070681_10009287
414 Ga0070681_10026967
415 Ga0070681_10034978
416 Ga0070681_10056911
417 Ga0070707_100220871
418 Ga0070707_100359107
419 Ga0070699_100353712
420 Ga0070679_100000605
421 Ga0070679_100005220
422 Ga0070679_100070263
423 Ga0070679_100074041
424 Ga0070679_100132446
425 Ga0070679_100191893
426 Ga0070684_100035423
427 Ga0070684_100164486
428 Ga0070697_100094543
429 Ga0068853_100007057
430 Ga0068853_100207578
431 Ga0070695_100159981
432 Ga0070665_100053497
433 Ga0070665_100122264
434 Ga0070665_100195833
435 Ga0068855_100006506
436 Ga0068855_100031395
437 Ga0068855_100041951
438 Ga0068855_100129698
439 Ga0070664_100037782
440 Ga0068856_100030184
441 Ga0068856_100328975
442 Ga0070702_100184187
443 Ga0068852_100111339
444 Ga0068859_100000153
445 Ga0068859_100000422
446 Ga0068859_100014799
447 Ga0068859_100016046
448 Ga0068859_100178375
449 Ga0068861_100020933
450 Ga0068861_100037304
451 Ga0068863_100003923
452 Ga0068858_100004045
453 Ga0068858_100010041
454 Ga0068860_100004110
455 Ga0068860_100187371
456 Ga0081538_10000655
457 Ga0081539_10000142
458 Ga0081539_10000215
459 Ga0081539_10003297
460 Ga0075364_10095808
461 Ga0075432_10016578
462 Ga0070715_10085026
463 Ga0075366_10056819
464 Ga0075366_10111838
465 Ga0075370_10027212
466 Ga0075431_100018646
467 Ga0075434_100001879
468 Ga0075434_100005719
469 Ga0075434_100038255
470 Ga0075429_100042687
471 Ga0075436_100003764
472 Ga0075436_100024987
473 Ga0075436_100032943
474 Ga0097620_100000153
475 Ga0097620_100000422
476 Ga0097620_100014799
477 Ga0097620_100016045
478 Ga0097620_100178376
479 Ga0075435_100000043
480 Ga0075435_100018173
481 Ga0105250_10018801
482 Ga0105240_10007240
483 Ga0105240_10007408
484 Ga0105240_10011593
485 Ga0105240_10139677
486 Ga0111539_10020559
487 Ga0105247_10000157
488 Ga0114129_10134282
489 Ga0114129_10195835
490 Ga0105243_10082273
491 Ga0105242_10155615
492 Ga0105248_10002210
493 Ga0105248_10008979
494 Ga0105248_10121345
495 Ga0105237_10045468
496 Ga0105237_10111826
497 Ga0105237_10212701
498 Ga0105238_10006833
499 Ga0105238_10166606
500 Ga0105238_10251330
501 Ga0105249_10009899
502 Ga0105249_10104431
503 Ga0105239_10512528
504 Ga0105246_10000171
505 Ga0157373_10013986
506 Ga0157373_10110194
507 Ga0157371_10004137
508 Ga0157371_10055059
509 Ga0157370_10002168
510 Ga0157370_10011556
511 Ga0157369_10035747
512 Ga0157369_10106368
513 Ga0157369_10174159
514 Ga0157372_10002807
515 Ga0157372_10044104
516 Ga0157375_10277765
517 Ga0163163_10015805
518 Ga0157380_10013630
519 Ga0157380_10338129
520 Ga0157376_10276150
521 Ga0207710_10000403
522 Ga0207710_10014222
523 Ga0207647_10104078
524 Ga0207705_10000948
525 Ga0207705_10005563
526 Ga0207707_10000052
527 Ga0207707_10006638
528 Ga0207707_10007630
529 Ga0207707_10010553
530 Ga0207695_10004526
531 Ga0207695_10079553
532 Ga0207695_10260481
533 Ga0207695_10348600
534 Ga0207671_10023230
535 Ga0207671_10025945
536 Ga0207671_10111297
537 Ga0207663_10004802
538 Ga0207660_10003561
539 Ga0207662_10029602
540 Ga0207657_10002943
541 Ga0207657_10023624
542 Ga0207657_10178182
543 Ga0207649_10050774
544 Ga0207652_10000816
545 Ga0207652_10001360
546 Ga0207652_10030341
547 Ga0207652_10151966
548 Ga0207694_10016711
549 Ga0207694_10118536
550 Ga0207694_10254820
551 Ga0207650_10163641
552 Ga0207687_10071468
553 Ga0207644_10036111
554 Ga0207690_10002833
555 Ga0207690_10122816
556 Ga0207706_10002054
557 Ga0207706_10109302
558 Ga0207709_10017215
559 Ga0207670_10062527
560 Ga0207711_10004141
561 Ga0207711_10019068
562 Ga0207711_10041797
563 Ga0207689_10089452
564 Ga0207661_10027529
565 Ga0207679_10053846
566 Ga0207667_10002121
567 Ga0207667_10009948
568 Ga0207667_10026631
569 Ga0207667_10251221
570 Ga0207651_10133373
571 Ga0207651_10232047
572 Ga0207703_10000979
573 Ga0207703_10004449
574 Ga0207678_10065290
575 Ga0207708_10203466
576 Ga0207702_10048975
577 Ga0207641_10000174
578 Ga0207641_10009795
579 Ga0207641_10037489
580 Ga0207641_10160649
581 Ga0207641_10404129
582 Ga0207648_10018192
583 Ga0207648_10032508
584 Ga0207675_100000014
585 Ga0207675_100011870
586 Ga0207675_100094409
587 Ga0207698_10221025
588 Ga0207428_10041673
589 Ga0268266_10002628
590 Ga0268266_10102055
591 Ga0268266_10107403
592 Ga0268264_10000479
593 Ga0268264_10033189
594 Ga0268264_10146937
595 Ga0265334_10020114
596 Ga0265318_10004197
597 Ga0307517_10068953
598 Ga0307515_10048797
599 Ga0265338_10000014
600 Ga0265338_10011294
601 Ga0265338_10019884
602 Ga0265332_10052457
603 Ga0265332_10054387
604 Ga0265325_10000013
605 Ga0265331_10012185
606 Ga0265327_10002569
607 Ga0265327_10049270
608 Ga0307509_10000013
609 Ga0307509_10054620
610 Ga0307509_10143144
611 Ga0265313_10005414
612 Ga0307508_10016482
613 Ga0265314_10011952
614 Ga0316578_10091913
615 Ga0307516_10037129
616 Ga0307410_10084898
617 Ga0307409_100062527
618 Ga0316583_10007593
619 Ga0307507_10072835
620 Ga0307510_10004928
621 Ga0373930_0004992
622 Ga0373950_0000633
623 Ga0373958_0000812
624 Ga0373938_0000483
625 Ga0373929_0001465
626 Ga0373940_0018908
627 Ga0373949_0001293
628 Ga0373949_0001313
629 Ga0373951_0001639
630 Ga0373932_0003955
631 Ga0373936_0000094
632 Ga0373936_0033350
633 Ga0373939_0001162
634 Ga0373941_0003415
635 Ga0373941_0032248
636 Ga0373960_0000274
637 Ga0373955_0148281
638 Ga0373942_0000581
639 Ga0373961_0000083
640 Ga0373961_0002866
641 Ga0373962_0001377
642 Ga0373931_0010565
643 Ga0373933_0044473
644 Ga0373933_0067972
645 Ga0316584_0054532
646 Ga0316584_0090559
647 Ga0316584_0091080
648 Ga0316584_0109623
649 Ga0373925_0145774
650 Ga0395900_0326124
651 Ga0395898_0190111
652 Ga0395901_0077249
653 Ga0439462_0000110
654 Ga0451577_0012112
655 Ga0453684_0398370
656 Ga0451576_0051700
657 Ga0495651_0247039
658 Ga0495583_0000154
659 Ga0495606_0007157
660 Ga0495632_0052961
661 Ga0495643_0023557
662 Ga0495621_0017740
663 Ga0495645_0013673
664 Ga0495622_0012565
665 Ga0495622_0097204
666 Ga0495667_0062224
667 Ga0495625_0004506
668 Ga0495661_0083733
669 Ga0495658_0178086
670 Ga0495670_0112150
671 Ga0495673_0013798
672 Ga0495686_0000183
673 Ga0495686_0007003
674 Ga0495686_0011698
675 Ga0496102_0123584
676 Ga0496102_0174212
677 Ga0496104_0014663
678 Ga0496106_0126698
679 Ga0496106_0206058
680 Ga0496112_0041335
681 Ga0496112_0074597
682 Ga0496114_0004381
683 Ga0496114_0012184
684 Ga0496116_0032113
685 Ga0496117_0000044
686 Ga0496117_0024255
687 Ga0496118_0000025
688 Ga0496118_0009344
689 Ga0496119_0001611
690 Ga0496119_0002085
691 Ga0496120_0000098
692 Ga0496120_0016497
693 Ga0496121_0006316
694 Ga0496121_0016649
695 Ga0496121_0017522
696 Ga0496121_0021357
697 Ga0496121_0064951
698 Ga0496125_0000726
699 Ga0496125_0002830
700 Ga0496126_0004135
701 Ga0496126_0157944
702 Ga0495682_0008001
703 Ga0501034_0260220
704 Ga0501037_0122268
705 Ga0501069_0003339
706 Ga0501070_0012800
707 Ga0501075_0058239
708 Ga0501077_0024473
709 Ga0501044_0049582
710 nmdc:mga00v17_62837_c1
711 nmdc:mga0k408_45096_c1
712 nmdc:mga09592_101880_c1
713 nmdc:mga06r32_18952_c1
714 nmdc:mga08y16_235661_c1
715 nmdc:mga08y16_44610_c1
716 nmdc:mga0n895_9_c1
717 nmdc:mga0rr50_106158_c1
718 nmdc:mga0rr50_3595_c1
719 nmdc:mga0rr50_4690_c1
720 nmdc:mga0rr50_62_c1
721 nmdc:mga0rr50_95946_c1
722 nmdc:mga08x19_16336_c1
723 nmdc:mga08x19_461_c1
724 nmdc:mga0a205_268100_c1
725 nmdc:mga0a205_34802_c1
726 Ga0500643_000005
727 Ga0500643_001606
728 Ga0500643_011611
729 Ga0500646_0005542
730 Ga0500647_0031513
731 Ga0500566_0005892
732 Ga0500640_000140
733 Ga0500554_000123
734 Ga0500555_000747
735 Ga0500556_0000522
736 Ga0500597_054394
737 Ga0500614_000157
738 Ga0500614_006361
739 Ga0500618_002804
740 Ga0500642_0000007
741 Ga0500655_004493
742 Ga0500559_0003761
743 Ga0500559_0023657
744 Ga0500568_0000916
745 Ga0500577_0053418
746 Ga0500603_029211
747 Ga0500604_0000011
748 Ga0500616_0000123
749 Ga0500616_0085152
750 Ga0500636_0055850
751 Ga0500645_000980
752 Ga0500587_000693
753 Ga0501084_0233051
754 Ga0530510_0074058
755 2643951253
756 2870783577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

40

386

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xpg-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and methyltetrahydrofolate 0.8871 6 377
3bq6-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8858 7 376
1t7l-assembly2.cif.gz_B crystal structure of cobalamin-independent methionine synthase from t. maritima 0.8815 7 376
1t7l-assembly1.cif.gz_A crystal structure of cobalamin-independent methionine synthase from t. maritima 0.8791 6 377
1xdj-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine 0.8783 7 377
ID Description Score Start End Superfamily
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8637 5 373 3.20.20.210
1xdjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8581 7 377 3.20.20.210
3rpdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8343 4 378 3.20.20.210
2nq5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8259 6 376 3.20.20.210
3rpdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.818 4 378 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A2V7EV45-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9927 3 379 GO:0000155
GO:0003871
GO:0008270
GO:0009086
GO:0016020
AF-A0A7V2I7X4-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.991 3 379 GO:0003871
GO:0008270
GO:0009086
AF-A0A1F4CK68-F1-model_v4 Enterotoxin 0.9903 53 380 GO:0003871
GO:0008270
GO:0009086
AF-A0A258I8Z0-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.989 5 379 GO:0003871
GO:0008270
GO:0009086
AF-A0A520XS04-F1-model_v4 Cobalamin-independent methionine synthase II family protein (Epoxyalkane--coenzyme M transferase) 0.9888 4 378 GO:0003871
GO:0008270
GO:0009086

Map