F427979

General Info

Members Datasets Scaffolds Average Seq Length
378 220 363 378

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100003856|Ga0070716_1000038563
Length 406
Sequence MRIGMVCPYSFDVPGGVQSHVLQLAEVMDGRGHEVSVLAPSSPHVELPDYVVSGGKAVPIPYNGSVARLRFGPATHRMVKRWLAEGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFEPFLRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFAHAPLLDGYPRPGKSVLFLGRFDEPRKGMAVLLGALPTLVKAFPDIEILIVGRGDDDELRERAGELAGHLRFLGQVDDAEKASAMRSSDVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRRVLVDGRAGWLVPVDDAAGLAAGLVEVLENDVLRERYVDAAADAVRRYDWSVVARQVMRVYETVAGSGTKVRVAGTAGRGHRPPEAYGESVGSTARPKARGTTGEIR

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
8 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
9 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
10 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
11 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
12 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
13 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
14 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
15 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
218 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 0
Isolates 3.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 0.26
Rhizoplane 14.29
Rhizosphere 60.05
Stem 0
Stem Tuber 0
Unclassified 12.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1000065 3300003792 Bacteria 126812
2 Ga0055540_1002663 3300003792 Bacteria 9227
3 Ga0055540_1007058 3300003792 Bacteria 4319
4 Ga0070676_10008750 3300005328 Bacteria 5464
5 Ga0070683_100036789 3300005329 Bacteria 4480
6 Ga0070682_100020085 3300005337 Bacteria 3927
7 Ga0070689_100012605 3300005340 Bacteria 6095
8 Ga0070668_100000221 3300005347 Bacteria 36652
9 Ga0070668_100087228 3300005347 Bacteria 2455
10 Ga0070669_100002650 3300005353 Bacteria 12902
11 Ga0070669_100041173 3300005353 Bacteria 3360
12 Ga0070671_100080905 3300005355 Bacteria 2716
13 Ga0070674_100000904 3300005356 Bacteria 15513
14 Ga0070667_100000034 3300005367 Bacteria 173652
15 Ga0070667_100007381 3300005367 Bacteria 9130
16 Ga0070667_100010050 3300005367 Bacteria 7840
17 Ga0070667_100018351 3300005367 Bacteria 5801
18 Ga0070667_100319471 3300005367 Bacteria 1401
19 Ga0070709_10039663 3300005434 Bacteria 2891
20 Ga0070714_100050803 3300005435 Bacteria 3534
21 Ga0070714_100051834 3300005435 Bacteria 3499
22 Ga0070713_100038923 3300005436 Bacteria 3856
23 Ga0070701_10001197 3300005438 Bacteria 9506
24 Ga0070711_100000296 3300005439 Bacteria 25914
25 Ga0070694_100036851 3300005444 Bacteria 3242
26 Ga0070663_100015821 3300005455 Bacteria 4881
27 Ga0070678_100075819 3300005456 Bacteria 2531
28 Ga0068867_100001031 3300005459 Bacteria 19054
29 Ga0070685_10061526 3300005466 Bacteria 2199
30 Ga0068853_100005368 3300005539 Bacteria 10035
31 Ga0070696_100001316 3300005546 Bacteria 16215
32 Ga0070665_100002861 3300005548 Bacteria 18655
33 Ga0070665_100008076 3300005548 Bacteria 10654
34 Ga0070704_100000354 3300005549 Bacteria 20791
35 Ga0068855_100132198 3300005563 Bacteria 2849
36 Ga0068854_100001667 3300005578 Bacteria 13521
37 Ga0070702_100007299 3300005615 Bacteria 5285
38 Ga0068859_100000748 3300005617 Bacteria 32788
39 Ga0068859_100004924 3300005617 Bacteria 13579
40 Ga0068866_10001242 3300005718 Bacteria 11058
41 Ga0068861_100000711 3300005719 Bacteria 19861
42 Ga0068863_100000397 3300005841 Bacteria 44254
43 Ga0068863_100059910 3300005841 Bacteria 3601
44 Ga0068863_100128961 3300005841 Bacteria 2414
45 Ga0068858_100002282 3300005842 Bacteria 19413
46 Ga0068860_100000011 3300005843 Bacteria 328172
47 Ga0068860_100001677 3300005843 Bacteria 23657
48 Ga0068862_100000054 3300005844 Bacteria 143584
49 Ga0068862_100013892 3300005844 Bacteria 6675
50 Ga0081455_10137469 3300005937 Bacteria 1902
51 Ga0075365_10005614 3300006038 Bacteria 6789
52 Ga0075365_10034885 3300006038 Bacteria 3252
53 Ga0075363_100002449 3300006048 Bacteria 7586
54 Ga0075363_100052909 3300006048 Bacteria 2168
55 Ga0075364_10003423 3300006051 Bacteria 9020
56 Ga0075364_10018702 3300006051 Bacteria 4341
57 Ga0075364_10019748 3300006051 Bacteria 4232
58 Ga0075364_10037974 3300006051 Bacteria 3120
59 Ga0075364_10046713 3300006051 Bacteria 2819
60 Ga0075364_10079398 3300006051 Bacteria 2168
61 Ga0075364_10116793 3300006051 Bacteria 1784
62 Ga0070715_10003017 3300006163 Bacteria 5269
63 Ga0070716_100003856 3300006173 Bacteria 7115
64 Ga0070712_100002430 3300006175 Bacteria 11478
65 Ga0075362_10011813 3300006177 Bacteria 3449
66 Ga0075367_10024341 3300006178 Bacteria 3413
67 Ga0075367_10115360 3300006178 Bacteria 1651
68 Ga0075369_10000274 3300006186 Bacteria 15421
69 Ga0075369_10002813 3300006186 Bacteria 6256
70 Ga0075369_10010038 3300006186 Bacteria 3698
71 Ga0075369_10012892 3300006186 Bacteria 3307
72 Ga0075369_10029263 3300006186 Bacteria 2313
73 Ga0075370_10007629 3300006353 Bacteria 5521
74 Ga0075370_10010233 3300006353 Bacteria 4895
75 Ga0075428_100001708 3300006844 Bacteria 23445
76 Ga0075431_100016142 3300006847 Bacteria 7576
77 Ga0075429_100271505 3300006880 Bacteria 1485
78 Ga0068865_100000544 3300006881 Bacteria 20914
79 Ga0097620_100000748 3300006931 Bacteria 32788
80 Ga0097620_100004924 3300006931 Bacteria 13579
81 Ga0105245_10010773 3300009098 Bacteria 7956
82 Ga0105245_10185717 3300009098 Bacteria 1989
83 Ga0105247_10000085 3300009101 Bacteria 102010
84 Ga0105247_10000959 3300009101 Bacteria 21764
85 Ga0105247_10093844 3300009101 Bacteria 1908
86 Ga0105247_10144000 3300009101 Bacteria 1564
87 Ga0105243_10005467 3300009148 Bacteria 9910
88 Ga0105242_10001250 3300009176 Bacteria 20032
89 Ga0105248_10000233 3300009177 Bacteria 63881
90 Ga0105248_10031735 3300009177 Bacteria 5902
91 Ga0105237_10000883 3300009545 Bacteria 40461
92 Ga0105237_10028288 3300009545 Bacteria 5711
93 Ga0105249_10000001 3300009553 Bacteria 504948
94 Ga0105239_10016122 3300010375 Bacteria 8267
95 Ga0105239_10080295 3300010375 Bacteria 3589
96 Ga0105239_10135044 3300010375 Bacteria 2746
97 Ga0105239_10185799 3300010375 Bacteria 2326
98 Ga0157369_10024810 3300013105 Bacteria 6661
99 Ga0157374_10234694 3300013296 Bacteria 1803
100 Ga0157378_10002314 3300013297 Bacteria 16946
101 Ga0163162_10001476 3300013306 Bacteria 21885
102 Ga0163162_10076126 3300013306 Bacteria 3417
103 Ga0163162_10224436 3300013306 Bacteria 2008
104 Ga0157375_10068024 3300013308 Bacteria 3561
105 Ga0163163_10078758 3300014325 Bacteria 3293
106 Ga0157380_10024456 3300014326 Bacteria 4572
107 Ga0157377_10084928 3300014745 Bacteria 1858
108 Ga0157379_10036024 3300014968 Bacteria 4412
109 Ga0163161_10072993 3300017792 Bacteria 2514
110 Ga0213876_10072413 3300021384 Bacteria 1820
111 Ga0209673_1026368 3300025273 Bacteria 1910
112 Ga0209051_1000042 3300025303 Bacteria 308486
113 Ga0209051_1001373 3300025303 Bacteria 21042
114 Ga0209051_1002075 3300025303 Bacteria 15149
115 Ga0209051_1002736 3300025303 Bacteria 12239
116 Ga0209051_1036513 3300025303 Bacteria 1814
117 Ga0207653_10011219 3300025885 Bacteria 2797
118 Ga0207692_10010771 3300025898 Bacteria 3868
119 Ga0207642_10000296 3300025899 Bacteria 14897
120 Ga0207710_10000125 3300025900 Bacteria 93726
121 Ga0207688_10003618 3300025901 Bacteria 8434
122 Ga0207645_10025181 3300025907 Bacteria 3851
123 Ga0207671_10008241 3300025914 Bacteria 8870
124 Ga0207663_10171015 3300025916 Bacteria 1543
125 Ga0207681_10001994 3300025923 Bacteria 13118
126 Ga0207681_10142180 3300025923 Bacteria 1788
127 Ga0207650_10094926 3300025925 Bacteria 2286
128 Ga0207700_10081134 3300025928 Bacteria 2532
129 Ga0207664_10038249 3300025929 Bacteria 3719
130 Ga0207664_10364630 3300025929 Bacteria 1280
131 Ga0207644_10061275 3300025931 Bacteria 2724
132 Ga0207690_10186123 3300025932 Bacteria 1567
133 Ga0207706_10013692 3300025933 Bacteria 7361
134 Ga0207686_10002058 3300025934 Bacteria 11081
135 Ga0207709_10001572 3300025935 Bacteria 15625
136 Ga0207670_10084031 3300025936 Bacteria 2234
137 Ga0207669_10000215 3300025937 Bacteria 26345
138 Ga0207704_10000504 3300025938 Bacteria 17408
139 Ga0207665_10150456 3300025939 Bacteria 1667
140 Ga0207711_10000356 3300025941 Bacteria 48645
141 Ga0207661_10048787 3300025944 Bacteria 3367
142 Ga0207712_10000006 3300025961 Bacteria 573204
143 Ga0207668_10000212 3300025972 Bacteria 39395
144 Ga0207668_10036679 3300025972 Bacteria 3274
145 Ga0207668_10139654 3300025972 Bacteria 1861
146 Ga0207640_10022457 3300025981 Bacteria 3777
147 Ga0207658_10000513 3300025986 Bacteria 35348
148 Ga0207658_10018755 3300025986 Bacteria 4782
149 Ga0207658_10061550 3300025986 Bacteria 2805
150 Ga0207703_10003750 3300026035 Bacteria 12648
151 Ga0207639_10031876 3300026041 Bacteria 3876
152 Ga0207678_10035919 3300026067 Bacteria 4314
153 Ga0207641_10000264 3300026088 Bacteria 66489
154 Ga0207641_10122190 3300026088 Bacteria 2325
155 Ga0207641_10326014 3300026088 Bacteria 1457
156 Ga0207648_10016153 3300026089 Bacteria 6835
157 Ga0207676_10102737 3300026095 Bacteria 2374
158 Ga0207675_100002085 3300026118 Bacteria 19858
159 Ga0207683_10000567 3300026121 Bacteria 34216
160 Ga0207698_10023683 3300026142 Bacteria 4294
161 Ga0268266_10015255 3300028379 Bacteria 6595
162 Ga0268266_10020032 3300028379 Bacteria 5702
163 Ga0268265_10000032 3300028380 Bacteria 225953
164 Ga0268265_10030083 3300028380 Bacteria 3906
165 Ga0268264_10000026 3300028381 Bacteria 459088
166 Ga0268264_10002509 3300028381 Bacteria 16132
167 Ga0265327_10000062 3300031251 Bacteria 234320
168 Ga0265327_10000064 3300031251 Bacteria 231983
169 Ga0265327_10005179 3300031251 Bacteria 11038
170 Ga0265327_10005264 3300031251 Bacteria 10897
171 Ga0307410_10175205 3300031852 Bacteria 1620
172 Ga0307406_10168297 3300031901 Bacteria 1583
173 Ga0307407_10083694 3300031903 Bacteria 1936
174 Ga0307409_100125836 3300031995 Bacteria 2180
175 Ga0307416_100089278 3300032002 Bacteria 2638
176 Ga0307415_100021289 3300032126 Bacteria 3982
177 Ga0373931_0002322 3300035691 Bacteria 8397
178 Ga0436364_0713047 3300037853 Bacteria 3309
179 Ga0436365_0163463 3300039437 Bacteria 4871
180 Ga0436365_0756863 3300039437 Bacteria 54771
181 Ga0436365_1027795 3300039437 Bacteria 37719
182 Ga0436365_1313876 3300039437 Bacteria 1451
183 Ga0436365_1666845 3300039437 Bacteria 12280
184 Ga0439466_0031890 3300041411 Bacteria 1799
185 Ga0439465_0001058 3300041413 Bacteria 8781
186 Ga0439465_0031500 3300041413 Bacteria 1689
187 Ga0439431_0001613 3300041997 Bacteria 5002
188 Ga0439445_0001719 3300042004 Bacteria 4817
189 Ga0466972_0003644 3300044658 Bacteria 7655
190 Ga0466972_0003756 3300044658 Bacteria 7551
191 Ga0466965_0001139 3300044683 Bacteria 10427
192 Ga0466965_0099612 3300044683 Bacteria 1485
193 Ga0466966_0044097 3300044684 Bacteria 2856
194 Ga0466961_0011614 3300044693 Bacteria 5629
195 Ga0466961_0067467 3300044693 Bacteria 2272
196 Ga0466963_0128983 3300044694 Bacteria 1746
197 Ga0466971_0018613 3300044719 Bacteria 3078
198 Ga0466971_0022527 3300044719 Bacteria 2807
199 Ga0466968_0016420 3300044735 Bacteria 2948
200 Ga0466970_0024716 3300044765 Bacteria 3142
201 Ga0466970_0033474 3300044765 Bacteria 2716
202 Ga0466957_0006151 3300044842 Bacteria 6776
203 Ga0466957_0011746 3300044842 Bacteria 5061
204 Ga0466957_0193300 3300044842 Bacteria 1334
205 Ga0466960_0001501 3300044901 Bacteria 8501
206 Ga0466960_0002735 3300044901 Bacteria 6668
207 Ga0466959_0020538 3300045049 Bacteria 4868
208 Ga0466959_0047982 3300045049 Bacteria 3139
209 Ga0466958_0018913 3300045836 Bacteria 4004
210 Ga0466958_0057369 3300045836 Bacteria 2366
211 Ga0466967_0020731 3300045976 Bacteria 5321
212 Ga0466967_0075986 3300045976 Bacteria 3020
213 Ga0466967_0155985 3300045976 Bacteria 2138
214 Ga0466967_0208261 3300045976 Bacteria 1854
215 Ga0466967_0404222 3300045976 Bacteria 1329
216 Ga0495603_0021891 3300046455 Bacteria 3870
217 Ga0495638_0011290 3300046460 Bacteria 6156
218 Ga0495638_0033356 3300046460 Bacteria 3293
219 Ga0495582_0059964 3300046473 Bacteria 2099
220 Ga0495648_0013666 3300046524 Bacteria 5987
221 Ga0495665_0042164 3300046531 Bacteria 2430
222 Ga0495640_0040448 3300046533 Bacteria 3265
223 Ga0495668_0009080 3300046616 Bacteria 6135
224 Ga0495658_0047830 3300046683 Bacteria 2410
225 Ga0495671_0016529 3300046692 Bacteria 3938
226 Ga0495649_0053741 3300046694 Bacteria 2180
227 Ga0495674_0022110 3300047319 Bacteria 5870
228 Ga0495673_0001935 3300047469 Bacteria 15383
229 Ga0495686_0003370 3300047472 Bacteria 13916
230 Ga0495593_0005924 3300047673 Bacteria 7199
231 Ga0496100_0000115 3300048903 Bacteria 45942
232 Ga0496100_0003634 3300048903 Bacteria 8060
233 Ga0496100_0003897 3300048903 Bacteria 7835
234 Ga0496100_0217177 3300048903 Bacteria 1402
235 Ga0496101_0000011 3300048904 Bacteria 272153
236 Ga0496101_0000341 3300048904 Bacteria 31431
237 Ga0496101_0003223 3300048904 Bacteria 10118
238 Ga0496101_0006810 3300048904 Bacteria 7372
239 Ga0496101_0080080 3300048904 Bacteria 2412
240 Ga0496102_0000012 3300048905 Bacteria 315470
241 Ga0496102_0000344 3300048905 Bacteria 56680
242 Ga0496102_0000692 3300048905 Bacteria 33501
243 Ga0496102_0002073 3300048905 Bacteria 17271
244 Ga0496102_0014209 3300048905 Bacteria 6918
245 Ga0496102_0541971 3300048905 Bacteria 1086
246 Ga0496103_0000005 3300048906 Bacteria 505416
247 Ga0496103_0000193 3300048906 Bacteria 60690
248 Ga0496103_0000228 3300048906 Bacteria 54634
249 Ga0496103_0002396 3300048906 Bacteria 11803
250 Ga0496103_0032578 3300048906 Bacteria 3181
251 Ga0496104_0037742 3300048907 Bacteria 4517
252 Ga0496104_0320373 3300048907 Bacteria 1463
253 Ga0496105_0034540 3300048908 Bacteria 4159
254 Ga0496105_0037461 3300048908 Bacteria 3993
255 Ga0496105_0265276 3300048908 Bacteria 1388
256 Ga0496106_0000731 3300048909 Bacteria 23666
257 Ga0496106_0001724 3300048909 Bacteria 16310
258 Ga0496106_0009764 3300048909 Bacteria 7090
259 Ga0496106_0013059 3300048909 Bacteria 6129
260 Ga0496107_0000603 3300048910 Bacteria 20033
261 Ga0496107_0001789 3300048910 Bacteria 13550
262 Ga0496107_0013801 3300048910 Bacteria 5648
263 Ga0496107_0028516 3300048910 Bacteria 3968
264 Ga0496108_0002783 3300048911 Bacteria 14019
265 Ga0496108_0004026 3300048911 Bacteria 11796
266 Ga0496109_0014101 3300048912 Bacteria 6946
267 Ga0496109_0118742 3300048912 Bacteria 2462
268 Ga0496110_0037135 3300048913 Bacteria 4233
269 Ga0496110_0046461 3300048913 Bacteria 3799
270 Ga0496111_0004751 3300048914 Bacteria 8619
271 Ga0496111_0087076 3300048914 Bacteria 2286
272 Ga0496112_0016775 3300048915 Bacteria 6868
273 Ga0496112_0020942 3300048915 Bacteria 6209
274 Ga0496112_0034939 3300048915 Bacteria 4892
275 Ga0496113_0016038 3300048916 Bacteria 5169
276 Ga0496113_0067485 3300048916 Bacteria 2712
277 Ga0496114_0000178 3300048917 Bacteria 45143
278 Ga0496114_0000622 3300048917 Bacteria 26197
279 Ga0496114_0005972 3300048917 Bacteria 9582
280 Ga0496114_0033764 3300048917 Bacteria 4218
281 Ga0496114_0242014 3300048917 Bacteria 1587
282 Ga0496115_0002927 3300048918 Bacteria 12307
283 Ga0496115_0057180 3300048918 Bacteria 3137
284 Ga0496115_0238280 3300048918 Bacteria 1500
285 Ga0496116_0000050 3300048919 Bacteria 311670
286 Ga0496116_0003706 3300048919 Bacteria 14948
287 Ga0496117_0000042 3300048920 Bacteria 315470
288 Ga0496117_0001007 3300048920 Bacteria 43130
289 Ga0496117_0009464 3300048920 Bacteria 9063
290 Ga0496118_0000037 3300048921 Bacteria 315470
291 Ga0496118_0000516 3300048921 Bacteria 63445
292 Ga0496118_0003215 3300048921 Bacteria 20856
293 Ga0496118_0009859 3300048921 Bacteria 9555
294 Ga0496119_0000181 3300048922 Bacteria 88025
295 Ga0496119_0003014 3300048922 Bacteria 17830
296 Ga0496119_0015567 3300048922 Bacteria 5842
297 Ga0496120_0000121 3300048923 Bacteria 131612
298 Ga0496120_0004788 3300048923 Bacteria 11100
299 Ga0496120_0032763 3300048923 Bacteria 3129
300 Ga0496121_0000014 3300048924 Bacteria 609379
301 Ga0496121_0000250 3300048924 Bacteria 114145
302 Ga0496121_0003201 3300048924 Bacteria 23581
303 Ga0496121_0203353 3300048924 Bacteria 1410
304 Ga0496122_0000132 3300048925 Bacteria 172228
305 Ga0496123_0004562 3300048926 Bacteria 14445
306 Ga0496123_0008515 3300048926 Bacteria 9406
307 Ga0496124_0000106 3300048927 Bacteria 172511
308 Ga0496125_0000014 3300048928 Bacteria 610124
309 Ga0496126_0000017 3300048929 Bacteria 610676
310 Ga0496126_0000317 3300048929 Bacteria 102866
311 Ga0496126_0006121 3300048929 Bacteria 13496
312 Ga0496126_0018202 3300048929 Bacteria 6971
313 Ga0496126_0044372 3300048929 Bacteria 4094
314 Ga0501032_0001482 3300049569 Bacteria 18716
315 Ga0501032_0004083 3300049569 Bacteria 11063
316 Ga0501033_0033920 3300049570 Bacteria 3831
317 Ga0501034_0000604 3300049571 Bacteria 56560
318 Ga0501034_0009705 3300049571 Bacteria 10064
319 Ga0501034_0023258 3300049571 Bacteria 6315
320 Ga0501036_0027243 3300049572 Bacteria 4828
321 Ga0501037_0001556 3300049573 Bacteria 16741
322 Ga0501037_0034437 3300049573 Bacteria 3737
323 Ga0501038_0002139 3300049574 Bacteria 18342
324 Ga0501039_0001432 3300049575 Bacteria 17579
325 Ga0501043_0004142 3300049579 Bacteria 11846
326 Ga0501043_0016771 3300049579 Bacteria 5740
327 Ga0501046_0002708 3300049580 Bacteria 16487
328 Ga0501047_0002562 3300049581 Bacteria 17335
329 Ga0501047_0034848 3300049581 Bacteria 4860
330 Ga0501047_0092787 3300049581 Bacteria 2898
331 Ga0501048_0084656 3300049582 Bacteria 2236
332 Ga0501067_0012454 3300049583 Bacteria 4719
333 Ga0501070_0002019 3300049586 Bacteria 17836
334 Ga0501070_0018095 3300049586 Bacteria 5911
335 Ga0501070_0116289 3300049586 Bacteria 2209
336 Ga0501073_0012454 3300049589 Bacteria 6205
337 Ga0501035_0001705 3300049822 Bacteria 22196
338 Ga0501035_0010791 3300049822 Bacteria 8460
339 Ga0501044_0005564 3300049823 Bacteria 13985
340 Ga0501044_0007638 3300049823 Bacteria 11888
341 Ga0501044_0024231 3300049823 Bacteria 6448
342 Ga0501044_0028712 3300049823 Bacteria 5869
343 nmdc:mga03n38_20366_c1 3300050490 Bacteria 2653
344 nmdc:mga03n38_9664_c1 3300050490 Bacteria 3516
345 nmdc:mga00v17_101599_c1 3300050491 Bacteria 1816
346 nmdc:mga00v17_1927_c1 3300050491 Bacteria 10722
347 nmdc:mga00v17_4066_c1 3300050491 Bacteria 7562
348 nmdc:mga00v17_42904_c1 3300050491 Bacteria 2722
349 nmdc:mga00v17_45210_c1 3300050491 Bacteria 2659
350 nmdc:mga07m45_10297_c1 3300050496 Bacteria 4879
351 nmdc:mga07m45_21732_c1 3300050496 Bacteria 3497
352 nmdc:mga07m45_63514_c1 3300050496 Bacteria 2094
353 nmdc:mga05p37_60464_c1 3300050507 Bacteria 4665
354 nmdc:mga09592_266568_c1 3300050508 Bacteria 1485
355 nmdc:mga0qj67_6085_c1 3300050509 Bacteria 8838
356 nmdc:mga0sz30_38912_c1 3300050516 Bacteria 1994
357 nmdc:mga0sz30_67521_c1 3300050516 Bacteria 1535
358 nmdc:mga0sz30_7376_c1 3300050516 Bacteria 4120
359 nmdc:mga0sz30_899_c2 3300050516 Bacteria 8542
360 Ga0500635_0002144 3300053080 Bacteria 4852
361 Ga0500652_002137 3300053131 Bacteria 5943
362 Ga0500616_0033831 3300053153 Bacteria 2788
363 Ga0500645_000171 3300053730 Bacteria 51112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10224436 Ga0163162_102244362 327
2 3300044765 Ga0466970_0033474 Ga0466970_0033474_16_1008 330
3 3300053080 Ga0500635_0002144 Ga0500635_0002144_3388_4512 333
4 3300053131 Ga0500652_002137 Ga0500652_002137_1437_2561 333
5 3300045976 Ga0466967_0208261 Ga0466967_0208261_627_1751 334
6 3300006048 Ga0075363_100002449 Ga0075363_1000024493 335
7 3300006051 Ga0075364_10003423 Ga0075364_100034239 335
8 3300006186 Ga0075369_10010038 Ga0075369_100100385 335
9 3300049581 Ga0501047_0092787 Ga0501047_0092787_1509_2633 335
10 3300050490 nmdc:mga03n38_9664_c1 nmdc:mga03n38_9664_c1_958_2082 335
11 3300050496 nmdc:mga07m45_63514_c1 nmdc:mga07m45_63514_c1_787_1911 335
12 3300045976 Ga0466967_0404222 Ga0466967_0404222_13_1095 349
13 3300048905 Ga0496102_0541971 Ga0496102_0541971_27_1076 349
14 3300006048 Ga0075363_100052909 Ga0075363_1000529092 353
15 3300006051 Ga0075364_10079398 Ga0075364_100793981 353
16 3300006051 Ga0075364_10018702 Ga0075364_100187023 354
17 3300006353 Ga0075370_10010233 Ga0075370_100102336 354
18 3300017792 Ga0163161_10072993 Ga0163161_100729932 354
19 3300048917 Ga0496114_0033764 Ga0496114_0033764_1330_2460 354
20 3300050496 nmdc:mga07m45_10297_c1 nmdc:mga07m45_10297_c1_839_2017 354
21 3300050491 nmdc:mga00v17_45210_c1 nmdc:mga00v17_45210_c1_944_2122 355
22 3300005841 Ga0068863_100128961 Ga0068863_1001289612 356
23 3300005435 Ga0070714_100051834 Ga0070714_1000518345 362
24 3300044901 Ga0466960_0001501 Ga0466960_0001501_5912_7072 365
25 3300048908 Ga0496105_0265276 Ga0496105_0265276_254_1351 365
26 3300048924 Ga0496121_0203353 Ga0496121_0203353_170_1294 365
27 3300050516 nmdc:mga0sz30_67521_c1 nmdc:mga0sz30_67521_c1_142_1266 365
28 3300053730 Ga0500645_000171 Ga0500645_000171_28883_30007 365
29 iso_pu_bacteria 2523231044 2523382707 366
30 3300005434 Ga0070709_10039663 Ga0070709_100396632 367
31 3300005436 Ga0070713_100038923 Ga0070713_1000389234 367
32 3300025928 Ga0207700_10081134 Ga0207700_100811342 367
33 3300025929 Ga0207664_10038249 Ga0207664_100382492 367
34 3300025939 Ga0207665_10150456 Ga0207665_101504562 367
35 3300006186 Ga0075369_10002813 Ga0075369_100028132 370
36 3300031251 Ga0265327_10000062 Ga0265327_10000062154 370
37 3300048905 Ga0496102_0014209 Ga0496102_0014209_2470_3582 370
38 3300048921 Ga0496118_0003215 Ga0496118_0003215_5009_6121 370
39 3300049569 Ga0501032_0004083 Ga0501032_0004083_6968_8119 370
40 3300049571 Ga0501034_0009705 Ga0501034_0009705_5650_6801 370
41 3300049572 Ga0501036_0027243 Ga0501036_0027243_2427_3578 370
42 3300049573 Ga0501037_0001556 Ga0501037_0001556_1577_2728 370
43 3300049574 Ga0501038_0002139 Ga0501038_0002139_10194_11345 370
44 3300049575 Ga0501039_0001432 Ga0501039_0001432_8891_10042 370
45 3300049579 Ga0501043_0004142 Ga0501043_0004142_6974_8125 370
46 3300049583 Ga0501067_0012454 Ga0501067_0012454_2687_3838 370
47 3300049586 Ga0501070_0002019 Ga0501070_0002019_6954_8105 370
48 3300049589 Ga0501073_0012454 Ga0501073_0012454_2493_3644 370
49 3300049823 Ga0501044_0024231 Ga0501044_0024231_2013_3164 370
50 iso_pu_bacteria 2738541274 2738705231 370
51 iso_pu_bacteria 2738543028 2739334795 370
52 iso_pu_bacteria 2751185725 2753035049 370
53 iso_pu_bacteria 2751185792 2753323566 370
54 iso_pu_bacteria 2842134933 2842138171 370
55 iso_pu_bacteria 2902792274 2902796163 370
56 iso_pu_bacteria 2902799365 2902801315 370
57 iso_pu_bacteria 2928142448 2928144681 370
58 iso_pu_bacteria 2929212328 2929215256 370
59 iso_pu_bacteria 2939582691 2939587693 370
60 3300047673 Ga0495593_0005924 Ga0495593_0005924_4555_5736 371
61 3300047472 Ga0495686_0003370 Ga0495686_0003370_429_1655 372
62 3300049823 Ga0501044_0028712 Ga0501044_0028712_2352_3530 372
63 iso_pu_bacteria 2643221715 2644637713 372
64 iso_pu_bacteria 2738541264 2738666807 372
65 iso_pu_bacteria 2738541356 2739145651 372
66 iso_pu_bacteria 2902810491 2902815211 372
67 3300003792 Ga0055540_1002663 Ga0055540_10026637 374
68 3300003792 Ga0055540_1007058 Ga0055540_10070583 374
69 3300005328 Ga0070676_10008750 Ga0070676_100087506 374
70 3300005329 Ga0070683_100036789 Ga0070683_1000367895 374
71 3300005337 Ga0070682_100020085 Ga0070682_1000200852 374
72 3300005340 Ga0070689_100012605 Ga0070689_1000126052 374
73 3300005347 Ga0070668_100087228 Ga0070668_1000872282 374
74 3300005353 Ga0070669_100002650 Ga0070669_10000265011 374
75 3300005353 Ga0070669_100041173 Ga0070669_1000411732 374
76 3300005355 Ga0070671_100080905 Ga0070671_1000809052 374
77 3300005356 Ga0070674_100000904 Ga0070674_10000090413 374
78 3300005367 Ga0070667_100000034 Ga0070667_1000000345 374
79 3300005367 Ga0070667_100007381 Ga0070667_1000073811 374
80 3300005367 Ga0070667_100018351 Ga0070667_1000183516 374
81 3300005435 Ga0070714_100050803 Ga0070714_1000508034 374
82 3300005438 Ga0070701_10001197 Ga0070701_100011974 374
83 3300005439 Ga0070711_100000296 Ga0070711_1000002966 374
84 3300005444 Ga0070694_100036851 Ga0070694_1000368512 374
85 3300005455 Ga0070663_100015821 Ga0070663_1000158214 374
86 3300005456 Ga0070678_100075819 Ga0070678_1000758192 374
87 3300005459 Ga0068867_100001031 Ga0068867_10000103110 374
88 3300005466 Ga0070685_10061526 Ga0070685_100615262 374
89 3300005539 Ga0068853_100005368 Ga0068853_1000053682 374
90 3300005546 Ga0070696_100001316 Ga0070696_10000131612 374
91 3300005548 Ga0070665_100002861 Ga0070665_1000028613 374
92 3300005548 Ga0070665_100008076 Ga0070665_1000080764 374
93 3300005549 Ga0070704_100000354 Ga0070704_1000003549 374
94 3300005563 Ga0068855_100132198 Ga0068855_1001321982 374
95 3300005578 Ga0068854_100001667 Ga0068854_10000166716 374
96 3300005615 Ga0070702_100007299 Ga0070702_1000072993 374
97 3300005617 Ga0068859_100000748 Ga0068859_10000074822 374
98 3300005617 Ga0068859_100004924 Ga0068859_1000049249 374
99 3300005718 Ga0068866_10001242 Ga0068866_100012422 374
100 3300005719 Ga0068861_100000711 Ga0068861_10000071116 374
101 3300005841 Ga0068863_100000397 Ga0068863_10000039746 374
102 3300005841 Ga0068863_100059910 Ga0068863_1000599102 374
103 3300005842 Ga0068858_100002282 Ga0068858_10000228213 374
104 3300005843 Ga0068860_100000011 Ga0068860_10000001149 374
105 3300005843 Ga0068860_100001677 Ga0068860_1000016775 374
106 3300005844 Ga0068862_100000054 Ga0068862_100000054126 374
107 3300005844 Ga0068862_100013892 Ga0068862_1000138925 374
108 3300005937 Ga0081455_10137469 Ga0081455_101374691 374
109 3300006051 Ga0075364_10046713 Ga0075364_100467132 374
110 3300006051 Ga0075364_10116793 Ga0075364_101167932 374
111 3300006163 Ga0070715_10003017 Ga0070715_100030172 374
112 3300006173 Ga0070716_100003856 Ga0070716_1000038563 374
113 3300006175 Ga0070712_100002430 Ga0070712_1000024306 374
114 3300006186 Ga0075369_10000274 Ga0075369_1000027413 374
115 3300006186 Ga0075369_10012892 Ga0075369_100128924 374
116 3300006186 Ga0075369_10029263 Ga0075369_100292632 374
117 3300006844 Ga0075428_100001708 Ga0075428_10000170814 374
118 3300006847 Ga0075431_100016142 Ga0075431_1000161422 374
119 3300006880 Ga0075429_100271505 Ga0075429_1002715052 374
120 3300006881 Ga0068865_100000544 Ga0068865_10000054416 374
121 3300006931 Ga0097620_100000748 Ga0097620_10000074822 374
122 3300006931 Ga0097620_100004924 Ga0097620_1000049249 374
123 3300009098 Ga0105245_10010773 Ga0105245_100107733 374
124 3300009098 Ga0105245_10185717 Ga0105245_101857172 374
125 3300009101 Ga0105247_10000085 Ga0105247_1000008522 374
126 3300009101 Ga0105247_10000959 Ga0105247_1000095921 374
127 3300009148 Ga0105243_10005467 Ga0105243_1000546710 374
128 3300009176 Ga0105242_10001250 Ga0105242_100012509 374
129 3300009177 Ga0105248_10000233 Ga0105248_1000023347 374
130 3300009177 Ga0105248_10031735 Ga0105248_100317355 374
131 3300009545 Ga0105237_10000883 Ga0105237_100008835 374
132 3300009553 Ga0105249_10000001 Ga0105249_10000001101 374
133 3300010375 Ga0105239_10016122 Ga0105239_100161226 374
134 3300010375 Ga0105239_10080295 Ga0105239_100802954 374
135 3300013105 Ga0157369_10024810 Ga0157369_100248102 374
136 3300013296 Ga0157374_10234694 Ga0157374_102346941 374
137 3300013297 Ga0157378_10002314 Ga0157378_100023142 374
138 3300013306 Ga0163162_10001476 Ga0163162_100014769 374
139 3300013306 Ga0163162_10076126 Ga0163162_100761263 374
140 3300013308 Ga0157375_10068024 Ga0157375_100680244 374
141 3300014326 Ga0157380_10024456 Ga0157380_100244563 374
142 3300014745 Ga0157377_10084928 Ga0157377_100849282 374
143 3300014968 Ga0157379_10036024 Ga0157379_100360242 374
144 3300021384 Ga0213876_10072413 Ga0213876_100724132 374
145 3300025273 Ga0209673_1026368 Ga0209673_10263682 374
146 3300025303 Ga0209051_1001373 Ga0209051_100137315 374
147 3300025303 Ga0209051_1002075 Ga0209051_10020754 374
148 3300025303 Ga0209051_1002736 Ga0209051_10027362 374
149 3300025303 Ga0209051_1036513 Ga0209051_10365132 374
150 3300025885 Ga0207653_10011219 Ga0207653_100112192 374
151 3300025898 Ga0207692_10010771 Ga0207692_100107715 374
152 3300025899 Ga0207642_10000296 Ga0207642_100002965 374
153 3300025900 Ga0207710_10000125 Ga0207710_1000012511 374
154 3300025901 Ga0207688_10003618 Ga0207688_100036189 374
155 3300025907 Ga0207645_10025181 Ga0207645_100251813 374
156 3300025914 Ga0207671_10008241 Ga0207671_100082416 374
157 3300025916 Ga0207663_10171015 Ga0207663_101710152 374
158 3300025923 Ga0207681_10001994 Ga0207681_1000199410 374
159 3300025923 Ga0207681_10142180 Ga0207681_101421802 374
160 3300025925 Ga0207650_10094926 Ga0207650_100949262 374
161 3300025929 Ga0207664_10364630 Ga0207664_103646302 374
162 3300025931 Ga0207644_10061275 Ga0207644_100612753 374
163 3300025932 Ga0207690_10186123 Ga0207690_101861231 374
164 3300025933 Ga0207706_10013692 Ga0207706_100136928 374
165 3300025934 Ga0207686_10002058 Ga0207686_100020587 374
166 3300025935 Ga0207709_10001572 Ga0207709_1000157212 374
167 3300025936 Ga0207670_10084031 Ga0207670_100840312 374
168 3300025937 Ga0207669_10000215 Ga0207669_1000021524 374
169 3300025938 Ga0207704_10000504 Ga0207704_100005047 374
170 3300025941 Ga0207711_10000356 Ga0207711_1000035646 374
171 3300025944 Ga0207661_10048787 Ga0207661_100487874 374
172 3300025961 Ga0207712_10000006 Ga0207712_10000006393 374
173 3300025972 Ga0207668_10139654 Ga0207668_101396542 374
174 3300025981 Ga0207640_10022457 Ga0207640_100224572 374
175 3300025986 Ga0207658_10000513 Ga0207658_100005135 374
176 3300025986 Ga0207658_10018755 Ga0207658_100187552 374
177 3300026035 Ga0207703_10003750 Ga0207703_1000375013 374
178 3300026041 Ga0207639_10031876 Ga0207639_100318763 374
179 3300026067 Ga0207678_10035919 Ga0207678_100359193 374
180 3300026088 Ga0207641_10000264 Ga0207641_1000026485 374
181 3300026088 Ga0207641_10122190 Ga0207641_101221902 374
182 3300026089 Ga0207648_10016153 Ga0207648_100161536 374
183 3300026095 Ga0207676_10102737 Ga0207676_101027372 374
184 3300026118 Ga0207675_100002085 Ga0207675_10000208514 374
185 3300026121 Ga0207683_10000567 Ga0207683_1000056722 374
186 3300026142 Ga0207698_10023683 Ga0207698_100236833 374
187 3300028379 Ga0268266_10015255 Ga0268266_100152553 374
188 3300028379 Ga0268266_10020032 Ga0268266_100200323 374
189 3300028380 Ga0268265_10000032 Ga0268265_10000032124 374
190 3300028380 Ga0268265_10030083 Ga0268265_100300832 374
191 3300028381 Ga0268264_10000026 Ga0268264_10000026391 374
192 3300028381 Ga0268264_10002509 Ga0268264_1000250912 374
193 3300031251 Ga0265327_10000064 Ga0265327_10000064110 374
194 3300031251 Ga0265327_10005264 Ga0265327_1000526410 374
195 3300031852 Ga0307410_10175205 Ga0307410_101752052 374
196 3300031995 Ga0307409_100125836 Ga0307409_1001258362 374
197 3300035691 Ga0373931_0002322 Ga0373931_0002322_4305_5489 374
198 3300037853 Ga0436364_0713047 Ga0436364_0713047_1103_2227 374
199 3300039437 Ga0436365_0163463 Ga0436365_0163463_2573_3697 374
200 3300039437 Ga0436365_0756863 Ga0436365_0756863_52139_53263 374
201 3300039437 Ga0436365_1027795 Ga0436365_1027795_23044_24168 374
202 3300039437 Ga0436365_1313876 Ga0436365_1313876_72_1196 374
203 3300039437 Ga0436365_1666845 Ga0436365_1666845_4380_5504 374
204 3300041411 Ga0439466_0031890 Ga0439466_0031890_332_1456 374
205 3300041413 Ga0439465_0001058 Ga0439465_0001058_2109_3233 374
206 3300044658 Ga0466972_0003644 Ga0466972_0003644_1744_2925 374
207 3300044658 Ga0466972_0003756 Ga0466972_0003756_1922_3046 374
208 3300044683 Ga0466965_0001139 Ga0466965_0001139_3829_4953 374
209 3300044684 Ga0466966_0044097 Ga0466966_0044097_798_1979 374
210 3300044693 Ga0466961_0011614 Ga0466961_0011614_1930_3054 374
211 3300044693 Ga0466961_0067467 Ga0466961_0067467_628_1809 374
212 3300044694 Ga0466963_0128983 Ga0466963_0128983_336_1460 374
213 3300044719 Ga0466971_0018613 Ga0466971_0018613_461_1585 374
214 3300044719 Ga0466971_0022527 Ga0466971_0022527_1341_2522 374
215 3300044735 Ga0466968_0016420 Ga0466968_0016420_1326_2450 374
216 3300044765 Ga0466970_0024716 Ga0466970_0024716_142_1323 374
217 3300044842 Ga0466957_0006151 Ga0466957_0006151_3941_5065 374
218 3300044842 Ga0466957_0011746 Ga0466957_0011746_2416_3540 374
219 3300044842 Ga0466957_0193300 Ga0466957_0193300_28_1185 374
220 3300044901 Ga0466960_0002735 Ga0466960_0002735_1394_2518 374
221 3300045049 Ga0466959_0020538 Ga0466959_0020538_425_1549 374
222 3300045049 Ga0466959_0047982 Ga0466959_0047982_1830_2954 374
223 3300045836 Ga0466958_0018913 Ga0466958_0018913_627_1808 374
224 3300045836 Ga0466958_0057369 Ga0466958_0057369_661_1785 374
225 3300045976 Ga0466967_0020731 Ga0466967_0020731_695_1819 374
226 3300045976 Ga0466967_0155985 Ga0466967_0155985_689_1813 374
227 3300046455 Ga0495603_0021891 Ga0495603_0021891_1026_2219 374
228 3300046460 Ga0495638_0011290 Ga0495638_0011290_1347_2507 374
229 3300046460 Ga0495638_0033356 Ga0495638_0033356_980_2104 374
230 3300046473 Ga0495582_0059964 Ga0495582_0059964_283_1476 374
231 3300046524 Ga0495648_0013666 Ga0495648_0013666_155_1387 374
232 3300046531 Ga0495665_0042164 Ga0495665_0042164_650_1843 374
233 3300046533 Ga0495640_0040448 Ga0495640_0040448_862_2055 374
234 3300046616 Ga0495668_0009080 Ga0495668_0009080_4116_5312 374
235 3300046683 Ga0495658_0047830 Ga0495658_0047830_571_1764 374
236 3300046692 Ga0495671_0016529 Ga0495671_0016529_1599_2795 374
237 3300046694 Ga0495649_0053741 Ga0495649_0053741_830_2020 374
238 3300047319 Ga0495674_0022110 Ga0495674_0022110_2954_4147 374
239 3300047469 Ga0495673_0001935 Ga0495673_0001935_5031_6227 374
240 3300048903 Ga0496100_0003634 Ga0496100_0003634_4393_5517 374
241 3300048903 Ga0496100_0003897 Ga0496100_0003897_2398_3582 374
242 3300048903 Ga0496100_0217177 Ga0496100_0217177_45_1169 374
243 3300048904 Ga0496101_0000011 Ga0496101_0000011_62481_63605 374
244 3300048904 Ga0496101_0003223 Ga0496101_0003223_1820_3004 374
245 3300048904 Ga0496101_0006810 Ga0496101_0006810_4008_5132 374
246 3300048905 Ga0496102_0000012 Ga0496102_0000012_244028_245152 374
247 3300048905 Ga0496102_0000344 Ga0496102_0000344_30324_31448 374
248 3300048905 Ga0496102_0000692 Ga0496102_0000692_8282_9466 374
249 3300048906 Ga0496103_0000005 Ga0496103_0000005_70311_71435 374
250 3300048906 Ga0496103_0000193 Ga0496103_0000193_9661_10845 374
251 3300048906 Ga0496103_0002396 Ga0496103_0002396_3535_4659 374
252 3300048906 Ga0496103_0032578 Ga0496103_0032578_1066_2250 374
253 3300048907 Ga0496104_0037742 Ga0496104_0037742_2832_4028 374
254 3300048908 Ga0496105_0034540 Ga0496105_0034540_75_1271 374
255 3300048908 Ga0496105_0037461 Ga0496105_0037461_1222_2406 374
256 3300048909 Ga0496106_0000731 Ga0496106_0000731_3315_4499 374
257 3300048909 Ga0496106_0001724 Ga0496106_0001724_3836_4960 374
258 3300048909 Ga0496106_0013059 Ga0496106_0013059_2508_3704 374
259 3300048910 Ga0496107_0001789 Ga0496107_0001789_10902_12086 374
260 3300048910 Ga0496107_0013801 Ga0496107_0013801_743_1939 374
261 3300048910 Ga0496107_0028516 Ga0496107_0028516_2008_3132 374
262 3300048911 Ga0496108_0002783 Ga0496108_0002783_1778_2953 374
263 3300048913 Ga0496110_0046461 Ga0496110_0046461_904_2088 374
264 3300048914 Ga0496111_0087076 Ga0496111_0087076_405_1589 374
265 3300048915 Ga0496112_0016775 Ga0496112_0016775_3455_4630 374
266 3300048915 Ga0496112_0034939 Ga0496112_0034939_3337_4461 374
267 3300048916 Ga0496113_0016038 Ga0496113_0016038_428_1552 374
268 3300048917 Ga0496114_0000622 Ga0496114_0000622_19883_21028 374
269 3300048917 Ga0496114_0005972 Ga0496114_0005972_4049_5245 374
270 3300048917 Ga0496114_0242014 Ga0496114_0242014_362_1537 374
271 3300048918 Ga0496115_0002927 Ga0496115_0002927_1489_2673 374
272 3300048918 Ga0496115_0057180 Ga0496115_0057180_263_1459 374
273 3300048918 Ga0496115_0238280 Ga0496115_0238280_107_1288 374
274 3300048919 Ga0496116_0000050 Ga0496116_0000050_240249_241373 374
275 3300048920 Ga0496117_0000042 Ga0496117_0000042_70319_71443 374
276 3300048920 Ga0496117_0009464 Ga0496117_0009464_4743_5867 374
277 3300048921 Ga0496118_0000037 Ga0496118_0000037_70319_71443 374
278 3300048921 Ga0496118_0000516 Ga0496118_0000516_44440_45564 374
279 3300048922 Ga0496119_0000181 Ga0496119_0000181_62907_64031 374
280 3300048922 Ga0496119_0015567 Ga0496119_0015567_114_1238 374
281 3300048923 Ga0496120_0000121 Ga0496120_0000121_52220_53344 374
282 3300048923 Ga0496120_0004788 Ga0496120_0004788_8322_9446 374
283 3300048924 Ga0496121_0000250 Ga0496121_0000250_42732_43856 374
284 3300048924 Ga0496121_0003201 Ga0496121_0003201_3656_4780 374
285 3300048926 Ga0496123_0004562 Ga0496123_0004562_10697_11824 374
286 3300048929 Ga0496126_0000317 Ga0496126_0000317_62820_63944 374
287 3300048929 Ga0496126_0006121 Ga0496126_0006121_3822_4949 374
288 3300048929 Ga0496126_0018202 Ga0496126_0018202_5551_6675 374
289 3300048929 Ga0496126_0044372 Ga0496126_0044372_237_1361 374
290 3300049569 Ga0501032_0001482 Ga0501032_0001482_12699_13823 374
291 3300049570 Ga0501033_0033920 Ga0501033_0033920_1652_2776 374
292 3300049571 Ga0501034_0000604 Ga0501034_0000604_19312_20436 374
293 3300049571 Ga0501034_0023258 Ga0501034_0023258_3881_5005 374
294 3300049573 Ga0501037_0034437 Ga0501037_0034437_279_1403 374
295 3300049579 Ga0501043_0016771 Ga0501043_0016771_2674_3798 374
296 3300049580 Ga0501046_0002708 Ga0501046_0002708_13135_14259 374
297 3300049581 Ga0501047_0002562 Ga0501047_0002562_14203_15327 374
298 3300049581 Ga0501047_0034848 Ga0501047_0034848_2598_3722 374
299 3300049582 Ga0501048_0084656 Ga0501048_0084656_186_1310 374
300 3300049586 Ga0501070_0018095 Ga0501070_0018095_4636_5760 374
301 3300049586 Ga0501070_0116289 Ga0501070_0116289_404_1540 374
302 3300049822 Ga0501035_0001705 Ga0501035_0001705_12277_13401 374
303 3300049822 Ga0501035_0010791 Ga0501035_0010791_2031_3155 374
304 3300049823 Ga0501044_0005564 Ga0501044_0005564_5767_6891 374
305 3300049823 Ga0501044_0007638 Ga0501044_0007638_10346_11470 374
306 3300050491 nmdc:mga00v17_4066_c1 nmdc:mga00v17_4066_c1_5827_7017 374
307 3300050507 nmdc:mga05p37_60464_c1 nmdc:mga05p37_60464_c1_3455_4579 374
308 3300050508 nmdc:mga09592_266568_c1 nmdc:mga09592_266568_c1_62_1186 374
309 3300050509 nmdc:mga0qj67_6085_c1 nmdc:mga0qj67_6085_c1_4335_5459 374
310 3300050516 nmdc:mga0sz30_38912_c1 nmdc:mga0sz30_38912_c1_271_1431 374
311 3300050516 nmdc:mga0sz30_7376_c1 nmdc:mga0sz30_7376_c1_2672_3862 374
312 3300050516 nmdc:mga0sz30_899_c2 nmdc:mga0sz30_899_c2_4468_5592 374
313 3300053153 Ga0500616_0033831 Ga0500616_0033831_298_1458 374
314 3300003792 Ga0055540_1000065 Ga0055540_100006580 376
315 3300005347 Ga0070668_100000221 Ga0070668_10000022125 376
316 3300005367 Ga0070667_100010050 Ga0070667_1000100502 376
317 3300005367 Ga0070667_100319471 Ga0070667_1003194712 376
318 3300006038 Ga0075365_10005614 Ga0075365_100056145 376
319 3300006038 Ga0075365_10034885 Ga0075365_100348852 376
320 3300006051 Ga0075364_10019748 Ga0075364_100197484 376
321 3300006051 Ga0075364_10037974 Ga0075364_100379741 376
322 3300006177 Ga0075362_10011813 Ga0075362_100118132 376
323 3300006178 Ga0075367_10024341 Ga0075367_100243414 376
324 3300006178 Ga0075367_10115360 Ga0075367_101153602 376
325 3300006353 Ga0075370_10007629 Ga0075370_100076295 376
326 3300009101 Ga0105247_10093844 Ga0105247_100938442 376
327 3300009101 Ga0105247_10144000 Ga0105247_101440002 376
328 3300009545 Ga0105237_10028288 Ga0105237_100282883 376
329 3300010375 Ga0105239_10135044 Ga0105239_101350443 376
330 3300010375 Ga0105239_10185799 Ga0105239_101857991 376
331 3300014325 Ga0163163_10078758 Ga0163163_100787584 376
332 3300025303 Ga0209051_1000042 Ga0209051_100004281 376
333 3300025972 Ga0207668_10000212 Ga0207668_1000021232 376
334 3300025972 Ga0207668_10036679 Ga0207668_100366793 376
335 3300025986 Ga0207658_10061550 Ga0207658_100615502 376
336 3300026088 Ga0207641_10326014 Ga0207641_103260142 376
337 3300031251 Ga0265327_10005179 Ga0265327_100051797 376
338 3300031901 Ga0307406_10168297 Ga0307406_101682972 376
339 3300031903 Ga0307407_10083694 Ga0307407_100836942 376
340 3300032002 Ga0307416_100089278 Ga0307416_1000892783 376
341 3300032126 Ga0307415_100021289 Ga0307415_1000212893 376
342 3300041413 Ga0439465_0031500 Ga0439465_0031500_424_1554 376
343 3300041997 Ga0439431_0001613 Ga0439431_0001613_3543_4673 376
344 3300042004 Ga0439445_0001719 Ga0439445_0001719_2377_3507 376
345 3300044683 Ga0466965_0099612 Ga0466965_0099612_105_1235 376
346 3300045976 Ga0466967_0075986 Ga0466967_0075986_1677_2807 376
347 3300048903 Ga0496100_0000115 Ga0496100_0000115_38601_39731 376
348 3300048904 Ga0496101_0000341 Ga0496101_0000341_6301_7431 376
349 3300048904 Ga0496101_0080080 Ga0496101_0080080_642_1772 376
350 3300048905 Ga0496102_0002073 Ga0496102_0002073_5783_6913 376
351 3300048906 Ga0496103_0000228 Ga0496103_0000228_46496_47626 376
352 3300048907 Ga0496104_0320373 Ga0496104_0320373_206_1336 376
353 3300048909 Ga0496106_0009764 Ga0496106_0009764_5736_6866 376
354 3300048910 Ga0496107_0000603 Ga0496107_0000603_638_1768 376
355 3300048911 Ga0496108_0004026 Ga0496108_0004026_5752_6882 376
356 3300048912 Ga0496109_0014101 Ga0496109_0014101_61_1191 376
357 3300048912 Ga0496109_0118742 Ga0496109_0118742_1003_2133 376
358 3300048913 Ga0496110_0037135 Ga0496110_0037135_1385_2515 376
359 3300048914 Ga0496111_0004751 Ga0496111_0004751_7418_8548 376
360 3300048915 Ga0496112_0020942 Ga0496112_0020942_4221_5387 376
361 3300048916 Ga0496113_0067485 Ga0496113_0067485_641_1807 376
362 3300048917 Ga0496114_0000178 Ga0496114_0000178_38283_39413 376
363 3300048919 Ga0496116_0003706 Ga0496116_0003706_8100_9230 376
364 3300048920 Ga0496117_0001007 Ga0496117_0001007_5713_6843 376
365 3300048921 Ga0496118_0009859 Ga0496118_0009859_6835_7965 376
366 3300048922 Ga0496119_0003014 Ga0496119_0003014_10487_11617 376
367 3300048923 Ga0496120_0032763 Ga0496120_0032763_938_2068 376
368 3300048924 Ga0496121_0000014 Ga0496121_0000014_602481_603611 376
369 3300048925 Ga0496122_0000132 Ga0496122_0000132_165342_166472 376
370 3300048926 Ga0496123_0008515 Ga0496123_0008515_4978_6108 376
371 3300048927 Ga0496124_0000106 Ga0496124_0000106_5769_6899 376
372 3300048928 Ga0496125_0000014 Ga0496125_0000014_602481_603611 376
373 3300048929 Ga0496126_0000017 Ga0496126_0000017_7066_8196 376
374 3300050490 nmdc:mga03n38_20366_c1 nmdc:mga03n38_20366_c1_609_1739 376
375 3300050491 nmdc:mga00v17_101599_c1 nmdc:mga00v17_101599_c1_76_1206 376
376 3300050491 nmdc:mga00v17_1927_c1 nmdc:mga00v17_1927_c1_4175_5305 376
377 3300050491 nmdc:mga00v17_42904_c1 nmdc:mga00v17_42904_c1_1389_2567 376
378 3300050496 nmdc:mga07m45_21732_c1 nmdc:mga07m45_21732_c1_2109_3287 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

14

174

0.96

PF00534

Glycos_transf_1

Glycosyl transferases group 1

184

343

0.93

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

188

329

0.93

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

201

358

0.87

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

15

169

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gek-assembly1.cif.gz_A crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp 0.9334 1 375
2gek-assembly1.cif.gz_A crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp 0.9309 1 375
4n9w-assembly1.cif.gz_A crystal structure of phosphatidyl mannosyltransferase pima 0.8954 1 375
4n9w-assembly1.cif.gz_A crystal structure of phosphatidyl mannosyltransferase pima 0.8907 1 375
4nc9-assembly6.cif.gz_D crystal structure of phosphatidyl mannosyltransferase pima 0.879 1 375
ID Description Score Start End Superfamily
4nc9C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9605 173 350 3.40.50.2000
4nc9C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9547 173 350 3.40.50.2000
af_P9WMZ5_1_160_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9222 1 162 3.40.50.2000
af_P9WMZ5_1_160_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9167 1 162 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9061 194 347 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7K1UTQ1-F1-model_v4 Glycosyltransferase 0.9702 1 376 GO:0016758
AF-A0A7K1UTQ1-F1-model_v4 Glycosyltransferase 0.9677 1 376 GO:0016758
AF-A0A2T0T3U2-F1-model_v4 Phosphatidylinositol alpha-mannosyltransferase 0.9556 1 376 GO:0009058
GO:0016758
AF-A0A2T0T3U2-F1-model_v4 Phosphatidylinositol alpha-mannosyltransferase 0.9531 1 376 GO:0009058
GO:0016758
AF-A0A428YRR8-F1-model_v4 Glycosyltransferase family 1 protein 0.9508 1 376 GO:0009058
GO:0016757

Feature Viewer

pLDDT pTM Quality
86.17 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map