F428008
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 378 | 275 | 756 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10178239|Ga0105243_101782392 |
| Length | 382 |
| Sequence | MDGFLLGERCALPMRAILRKAGIGAAVPCRSCDATYMARQRRRLPLVKLSILDLVRVREGGTPLSALEDSRSLAVHAESLGYGRFWVAEHHNMPGIASAATSVVIGYLAQATSRMRIGAGGIMLPNHAPIVIAEQFGTLAQLYPGRIDLGLGRAPGTDQPTMRALRRSLTNSDNFPQDVLELQAYFSAEQQAGQIQAVPAAGTDVPLWILGSSTYGAQLAAHLGLPYGFASHFAPDLLLDALAIYRSRFQLSAHCPRPYAMVGVNIIAADSDAEARRLATTQQMSFADLLRGARRLSRPPISNIEDYWSPTEKAQAQRMLARSIVGAPDTVQAGISALVEETGADELMIVSDIYDLEARKRSLEIIANSRALHGNAKMLSEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 74 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 124 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 140 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 142 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 143 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 144 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 145 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 193 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 194 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 195 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 196 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 197 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 198 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 199 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 200 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 201 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 202 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 227 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 242 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 243 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 244 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 245 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 246 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 247 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 248 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 249 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 250 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 251 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 252 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 255 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 256 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 257 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 258 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 259 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 260 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 261 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 262 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 263 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 264 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 265 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 266 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 267 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 268 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 269 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 270 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 271 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 272 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 273 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 274 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 275 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.92 |
| Metatranscriptomes | 0.26 |
| Isolates | 5.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.79 |
| Nodule | 0.26 |
| Rhizoplane | 2.12 |
| Rhizosphere | 74.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105243_10178239 | 3300009148 | Bacteria | 1846 |
| 2 | SwRhRL2b_contig_2129276 | 2162886007 | Bacteria | 6469 |
| 3 | JGI24741J21665_1000173 | 3300001915 | Bacteria | 18592 |
| 4 | JGI24740J21852_10026576 | 3300001979 | Bacteria | 1937 |
| 5 | JGI24739J22299_10000501 | 3300001989 | Bacteria | 13893 |
| 6 | JGI24737J22298_10006592 | 3300001990 | Bacteria | 3956 |
| 7 | JGI24735J21928_10013641 | 3300002067 | Bacteria | 2551 |
| 8 | JGI24738J21930_10000823 | 3300002075 | Bacteria | 8877 |
| 9 | JGI25165J46597_1000373 | 3300003214 | Bacteria | 49990 |
| 10 | Ga0055538_1000144 | 3300003751 | Bacteria | 49990 |
| 11 | Ga0055539_1000195 | 3300003752 | Bacteria | 49990 |
| 12 | Ga0055533_1000196 | 3300003756 | Bacteria | 49990 |
| 13 | Ga0055525_1000263 | 3300003759 | Bacteria | 49990 |
| 14 | Ga0055541_1000128 | 3300003841 | Bacteria | 49990 |
| 15 | Ga0065704_10002149 | 3300005289 | Bacteria | 9013 |
| 16 | Ga0065704_10002858 | 3300005289 | Bacteria | 6556 |
| 17 | Ga0065704_10116104 | 3300005289 | Bacteria | 1859 |
| 18 | Ga0070683_100049688 | 3300005329 | Bacteria | 3880 |
| 19 | Ga0070670_100000209 | 3300005331 | Bacteria | 54253 |
| 20 | Ga0070666_10180823 | 3300005335 | Bacteria | 1479 |
| 21 | Ga0070689_100118674 | 3300005340 | Bacteria | 2111 |
| 22 | Ga0070669_100066733 | 3300005353 | Bacteria | 2653 |
| 23 | Ga0070669_100088659 | 3300005353 | Bacteria | 2316 |
| 24 | Ga0070669_100242954 | 3300005353 | Bacteria | 1431 |
| 25 | Ga0070675_100182423 | 3300005354 | Bacteria | 1815 |
| 26 | Ga0070671_100068643 | 3300005355 | Bacteria | 2957 |
| 27 | Ga0070674_100012678 | 3300005356 | Bacteria | 5182 |
| 28 | Ga0070674_100098056 | 3300005356 | Bacteria | 2130 |
| 29 | Ga0070673_100010949 | 3300005364 | Bacteria | 6170 |
| 30 | Ga0070659_100032876 | 3300005366 | Bacteria | 4027 |
| 31 | Ga0070667_100000127 | 3300005367 | Bacteria | 95853 |
| 32 | Ga0070667_100000174 | 3300005367 | Bacteria | 79730 |
| 33 | Ga0070663_100000434 | 3300005455 | Bacteria | 22038 |
| 34 | Ga0070681_10114160 | 3300005458 | Bacteria | 2640 |
| 35 | Ga0068867_100460520 | 3300005459 | Bacteria | 1086 |
| 36 | Ga0070684_100000769 | 3300005535 | Bacteria | 22213 |
| 37 | Ga0070697_100252347 | 3300005536 | Bacteria | 1509 |
| 38 | Ga0068853_100017446 | 3300005539 | Bacteria | 5924 |
| 39 | Ga0068855_100018266 | 3300005563 | Bacteria | 8422 |
| 40 | Ga0068855_100154177 | 3300005563 | Bacteria | 2611 |
| 41 | Ga0068855_100298539 | 3300005563 | Bacteria | 1784 |
| 42 | Ga0070664_100050610 | 3300005564 | Bacteria | 3517 |
| 43 | Ga0068857_100052595 | 3300005577 | Bacteria | 3613 |
| 44 | Ga0068854_100082969 | 3300005578 | Bacteria | 2369 |
| 45 | Ga0068856_100015610 | 3300005614 | Bacteria | 7343 |
| 46 | Ga0068856_100176121 | 3300005614 | Bacteria | 2151 |
| 47 | Ga0068852_100069656 | 3300005616 | Bacteria | 3084 |
| 48 | Ga0068859_100083309 | 3300005617 | Bacteria | 3241 |
| 49 | Ga0068864_100000062 | 3300005618 | Bacteria | 121206 |
| 50 | Ga0068864_100029288 | 3300005618 | Bacteria | 4660 |
| 51 | Ga0068851_10051788 | 3300005834 | Bacteria | 2086 |
| 52 | Ga0068851_10077548 | 3300005834 | Bacteria | 1730 |
| 53 | Ga0068863_100000064 | 3300005841 | Bacteria | 118153 |
| 54 | Ga0068863_100007816 | 3300005841 | Bacteria | 10459 |
| 55 | Ga0068860_100000125 | 3300005843 | Bacteria | 123363 |
| 56 | Ga0068860_100180705 | 3300005843 | Bacteria | 2039 |
| 57 | Ga0068862_100000079 | 3300005844 | Bacteria | 113551 |
| 58 | Ga0068862_100001663 | 3300005844 | Bacteria | 20201 |
| 59 | Ga0075365_10065842 | 3300006038 | Bacteria | 2429 |
| 60 | Ga0075364_10002199 | 3300006051 | Bacteria | 10935 |
| 61 | Ga0075364_10023205 | 3300006051 | Bacteria | 3927 |
| 62 | Ga0075370_10066739 | 3300006353 | Bacteria | 2053 |
| 63 | Ga0075430_100135925 | 3300006846 | Bacteria | 2048 |
| 64 | Ga0075431_100119732 | 3300006847 | Bacteria | 2716 |
| 65 | Ga0075434_100014840 | 3300006871 | Bacteria | 7453 |
| 66 | Ga0075429_100099539 | 3300006880 | Bacteria | 2537 |
| 67 | Ga0075436_100001741 | 3300006914 | Bacteria | 14907 |
| 68 | Ga0097620_100083309 | 3300006931 | Bacteria | 3241 |
| 69 | Ga0075435_100000018 | 3300007076 | Bacteria | 97506 |
| 70 | Ga0105251_10003959 | 3300009011 | Bacteria | 10495 |
| 71 | Ga0105240_10003721 | 3300009093 | Bacteria | 23562 |
| 72 | Ga0105240_10010397 | 3300009093 | Bacteria | 13079 |
| 73 | Ga0105247_10007723 | 3300009101 | Bacteria | 6581 |
| 74 | Ga0105243_10259795 | 3300009148 | Bacteria | 1554 |
| 75 | Ga0105241_10019325 | 3300009174 | Bacteria | 5023 |
| 76 | Ga0105248_10000014 | 3300009177 | Bacteria | 324729 |
| 77 | Ga0105248_10026633 | 3300009177 | Bacteria | 6429 |
| 78 | Ga0105248_10035276 | 3300009177 | Bacteria | 5595 |
| 79 | Ga0105248_10064034 | 3300009177 | Bacteria | 4127 |
| 80 | Ga0105237_10000130 | 3300009545 | Bacteria | 105282 |
| 81 | Ga0105237_10030003 | 3300009545 | Bacteria | 5525 |
| 82 | Ga0105237_10267976 | 3300009545 | Bacteria | 1711 |
| 83 | Ga0105238_10208247 | 3300009551 | Bacteria | 1931 |
| 84 | Ga0105238_10618100 | 3300009551 | Bacteria | 1092 |
| 85 | Ga0105249_10000907 | 3300009553 | Bacteria | 26174 |
| 86 | Ga0105148_100291 | 3300009978 | Bacteria | 6544 |
| 87 | Ga0105239_10000031 | 3300010375 | Bacteria | 226947 |
| 88 | Ga0105239_10615782 | 3300010375 | Bacteria | 1239 |
| 89 | Ga0157369_10001433 | 3300013105 | Bacteria | 29260 |
| 90 | Ga0163162_10014953 | 3300013306 | Bacteria | 7579 |
| 91 | Ga0157372_10059406 | 3300013307 | Bacteria | 4276 |
| 92 | Ga0157375_10394078 | 3300013308 | Bacteria | 1551 |
| 93 | Ga0163163_10053916 | 3300014325 | Bacteria | 3971 |
| 94 | Ga0157380_10012505 | 3300014326 | Bacteria | 6159 |
| 95 | Ga0182005_1004946 | 3300015265 | Bacteria | 4225 |
| 96 | Ga0213876_10000426 | 3300021384 | Bacteria | 34932 |
| 97 | Ga0213875_10098224 | 3300021388 | Bacteria | 1366 |
| 98 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 99 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 100 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 101 | Ga0209147_100678 | 3300025229 | Bacteria | 17543 |
| 102 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 103 | Ga0207427_102342 | 3300025231 | Bacteria | 5197 |
| 104 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 105 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 106 | Ga0209759_1006849 | 3300025256 | Bacteria | 3768 |
| 107 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 108 | Ga0209050_1001457 | 3300025298 | Bacteria | 25353 |
| 109 | Ga0209257_1000323 | 3300025304 | Bacteria | 100164 |
| 110 | Ga0207713_1024525 | 3300025735 | Bacteria | 2810 |
| 111 | Ga0207710_10008534 | 3300025900 | Bacteria | 4319 |
| 112 | Ga0207680_10163172 | 3300025903 | Bacteria | 1496 |
| 113 | Ga0207680_10251035 | 3300025903 | Bacteria | 1222 |
| 114 | Ga0207647_10040595 | 3300025904 | Bacteria | 2929 |
| 115 | Ga0207699_10102334 | 3300025906 | Bacteria | 1820 |
| 116 | Ga0207654_10014003 | 3300025911 | Bacteria | 4136 |
| 117 | Ga0207695_10004043 | 3300025913 | Bacteria | 20183 |
| 118 | Ga0207695_10006617 | 3300025913 | Bacteria | 14973 |
| 119 | Ga0207671_10005191 | 3300025914 | Bacteria | 12103 |
| 120 | Ga0207671_10031981 | 3300025914 | Bacteria | 3917 |
| 121 | Ga0207657_10022904 | 3300025919 | Bacteria | 5828 |
| 122 | Ga0207681_10013617 | 3300025923 | Bacteria | 5036 |
| 123 | Ga0207650_10000367 | 3300025925 | Bacteria | 42933 |
| 124 | Ga0207650_10030393 | 3300025925 | Bacteria | 3891 |
| 125 | Ga0207659_10159493 | 3300025926 | Bacteria | 1769 |
| 126 | Ga0207644_10265678 | 3300025931 | Bacteria | 1373 |
| 127 | Ga0207670_10095661 | 3300025936 | Bacteria | 2110 |
| 128 | Ga0207711_10000021 | 3300025941 | Bacteria | 355952 |
| 129 | Ga0207711_10037844 | 3300025941 | Bacteria | 4101 |
| 130 | Ga0207661_10073470 | 3300025944 | Bacteria | 2801 |
| 131 | Ga0207667_10125398 | 3300025949 | Bacteria | 2644 |
| 132 | Ga0207651_10000189 | 3300025960 | Bacteria | 26894 |
| 133 | Ga0207712_10000687 | 3300025961 | Bacteria | 26162 |
| 134 | Ga0207668_10000448 | 3300025972 | Bacteria | 26029 |
| 135 | Ga0207640_10068006 | 3300025981 | Bacteria | 2386 |
| 136 | Ga0207640_10085938 | 3300025981 | Bacteria | 2164 |
| 137 | Ga0207658_10000122 | 3300025986 | Bacteria | 84415 |
| 138 | Ga0207658_10000424 | 3300025986 | Bacteria | 40038 |
| 139 | Ga0207658_10097918 | 3300025986 | Bacteria | 2291 |
| 140 | Ga0207703_10025810 | 3300026035 | Bacteria | 4624 |
| 141 | Ga0207639_10001222 | 3300026041 | Bacteria | 17439 |
| 142 | Ga0207639_10011556 | 3300026041 | Bacteria | 6136 |
| 143 | Ga0207678_10000584 | 3300026067 | Bacteria | 33400 |
| 144 | Ga0207641_10000107 | 3300026088 | Bacteria | 121220 |
| 145 | Ga0207641_10000956 | 3300026088 | Bacteria | 29693 |
| 146 | Ga0207676_10000057 | 3300026095 | Bacteria | 121220 |
| 147 | Ga0207674_10080708 | 3300026116 | Bacteria | 3255 |
| 148 | Ga0207698_10003129 | 3300026142 | Bacteria | 9923 |
| 149 | Ga0268266_10012111 | 3300028379 | Bacteria | 7464 |
| 150 | Ga0268265_10000080 | 3300028380 | Bacteria | 121220 |
| 151 | Ga0268265_10004207 | 3300028380 | Bacteria | 10066 |
| 152 | Ga0268265_10237620 | 3300028380 | Bacteria | 1606 |
| 153 | Ga0268264_10000166 | 3300028381 | Bacteria | 146960 |
| 154 | Ga0265318_10012020 | 3300028577 | Bacteria | 3698 |
| 155 | Ga0265336_10000028 | 3300028666 | Bacteria | 179201 |
| 156 | Ga0265324_10003212 | 3300029957 | Bacteria | 7905 |
| 157 | Ga0265765_1004811 | 3300030879 | Bacteria | 1400 |
| 158 | Ga0265328_10024616 | 3300031239 | Bacteria | 2272 |
| 159 | Ga0265328_10033179 | 3300031239 | Bacteria | 1914 |
| 160 | Ga0265325_10000136 | 3300031241 | Bacteria | 50918 |
| 161 | Ga0265340_10018526 | 3300031247 | Bacteria | 3590 |
| 162 | Ga0265331_10049539 | 3300031250 | Bacteria | 2017 |
| 163 | Ga0265316_10004957 | 3300031344 | Bacteria | 13086 |
| 164 | Ga0265313_10009036 | 3300031595 | Bacteria | 6528 |
| 165 | Ga0307405_10006287 | 3300031731 | Bacteria | 5829 |
| 166 | Ga0307405_10072302 | 3300031731 | Bacteria | 2223 |
| 167 | Ga0307410_10075228 | 3300031852 | Bacteria | 2354 |
| 168 | Ga0307406_10232848 | 3300031901 | Bacteria | 1377 |
| 169 | Ga0307412_10096394 | 3300031911 | Bacteria | 2082 |
| 170 | Ga0307409_100140181 | 3300031995 | Bacteria | 2082 |
| 171 | Ga0307414_10003996 | 3300032004 | Bacteria | 7959 |
| 172 | Ga0307414_10094439 | 3300032004 | Bacteria | 2232 |
| 173 | Ga0307411_10065648 | 3300032005 | Bacteria | 2435 |
| 174 | Ga0395898_0159932 | 3300037466 | Bacteria | 2154 |
| 175 | Ga0436364_0616084 | 3300037853 | Bacteria | 3184 |
| 176 | Ga0395901_0374006 | 3300038443 | Bacteria | 1467 |
| 177 | Ga0436365_0245367 | 3300039437 | Bacteria | 43680 |
| 178 | Ga0436363_1707107 | 3300039450 | Bacteria | 2854 |
| 179 | Ga0451807_2621016 | 3300041486 | Bacteria | 1879 |
| 180 | Ga0451837_0503711 | 3300041494 | Bacteria | 2667 |
| 181 | Ga0450904_000183 | 3300042139 | Bacteria | 13617 |
| 182 | Ga0450904_000416 | 3300042139 | Bacteria | 8661 |
| 183 | Ga0439446_0014133 | 3300042156 | Bacteria | 2200 |
| 184 | Ga0453684_0123452 | 3300044712 | Bacteria | 3122 |
| 185 | Ga0466968_0019104 | 3300044735 | Bacteria | 2755 |
| 186 | Ga0466959_0149633 | 3300045049 | Bacteria | 1646 |
| 187 | Ga0451576_0002071 | 3300045051 | Bacteria | 31414 |
| 188 | Ga0466967_0063054 | 3300045976 | Bacteria | 3292 |
| 189 | Ga0495617_012675 | 3300046452 | Bacteria | 2875 |
| 190 | Ga0495627_000431 | 3300046453 | Bacteria | 36399 |
| 191 | Ga0495627_001658 | 3300046453 | Bacteria | 12330 |
| 192 | Ga0495590_0048525 | 3300046457 | Bacteria | 1481 |
| 193 | Ga0495638_0087707 | 3300046460 | Bacteria | 1879 |
| 194 | Ga0495651_0089742 | 3300046462 | Bacteria | 2306 |
| 195 | Ga0495653_0008157 | 3300046463 | Bacteria | 8576 |
| 196 | Ga0495584_0077553 | 3300046491 | Bacteria | 1671 |
| 197 | Ga0495607_0000021 | 3300046501 | Bacteria | 164571 |
| 198 | Ga0495607_0011163 | 3300046501 | Bacteria | 5999 |
| 199 | Ga0495583_0000276 | 3300046506 | Bacteria | 82963 |
| 200 | Ga0495608_0007994 | 3300046511 | Bacteria | 7436 |
| 201 | Ga0495610_0000068 | 3300046512 | Bacteria | 122949 |
| 202 | Ga0495618_0037908 | 3300046514 | Bacteria | 3028 |
| 203 | Ga0495628_0063264 | 3300046516 | Bacteria | 2899 |
| 204 | Ga0495632_0000007 | 3300046519 | Bacteria | 343246 |
| 205 | Ga0495637_0000791 | 3300046520 | Bacteria | 21154 |
| 206 | Ga0495643_0000005 | 3300046522 | Bacteria | 443135 |
| 207 | Ga0495648_0005531 | 3300046524 | Bacteria | 10486 |
| 208 | Ga0495648_0041713 | 3300046524 | Bacteria | 2895 |
| 209 | Ga0495663_0000005 | 3300046525 | Bacteria | 342265 |
| 210 | Ga0495645_0156512 | 3300046543 | Bacteria | 1578 |
| 211 | Ga0495633_0000256 | 3300046558 | Bacteria | 62904 |
| 212 | Ga0495633_0000766 | 3300046558 | Bacteria | 28930 |
| 213 | Ga0495633_0012426 | 3300046558 | Bacteria | 4530 |
| 214 | Ga0495611_0098993 | 3300046648 | Bacteria | 1353 |
| 215 | Ga0495625_0000751 | 3300046660 | Bacteria | 45255 |
| 216 | Ga0495625_0002958 | 3300046660 | Bacteria | 17693 |
| 217 | Ga0495635_0201640 | 3300046663 | Bacteria | 1349 |
| 218 | Ga0495661_0000284 | 3300046665 | Bacteria | 57616 |
| 219 | Ga0495599_0043117 | 3300046678 | Bacteria | 2831 |
| 220 | Ga0495646_0010736 | 3300046680 | Bacteria | 5820 |
| 221 | Ga0495669_0061680 | 3300046684 | Bacteria | 1697 |
| 222 | Ga0495624_0031206 | 3300046690 | Bacteria | 3467 |
| 223 | Ga0495671_0000007 | 3300046692 | Bacteria | 443069 |
| 224 | Ga0495649_0005498 | 3300046694 | Bacteria | 8038 |
| 225 | Ga0495589_0004605 | 3300046794 | Bacteria | 7329 |
| 226 | Ga0495600_0008875 | 3300046809 | Bacteria | 6194 |
| 227 | Ga0495604_0101360 | 3300047317 | Bacteria | 2115 |
| 228 | Ga0495672_0095743 | 3300047320 | Bacteria | 1620 |
| 229 | Ga0495683_0022396 | 3300047323 | Bacteria | 3249 |
| 230 | Ga0495681_0000055 | 3300047470 | Bacteria | 104502 |
| 231 | Ga0495681_0002657 | 3300047470 | Bacteria | 12672 |
| 232 | Ga0495686_0000164 | 3300047472 | Bacteria | 126101 |
| 233 | Ga0495686_0036460 | 3300047472 | Bacteria | 3156 |
| 234 | Ga0495686_0074650 | 3300047472 | Bacteria | 2080 |
| 235 | Ga0496102_0092039 | 3300048905 | Bacteria | 2808 |
| 236 | Ga0496102_0341784 | 3300048905 | Bacteria | 1409 |
| 237 | Ga0496105_0058925 | 3300048908 | Bacteria | 3169 |
| 238 | Ga0496108_0001299 | 3300048911 | Bacteria | 19625 |
| 239 | Ga0496109_0105581 | 3300048912 | Bacteria | 2616 |
| 240 | Ga0496113_0052840 | 3300048916 | Bacteria | 3036 |
| 241 | Ga0496114_0141806 | 3300048917 | Bacteria | 2081 |
| 242 | Ga0496117_0002505 | 3300048920 | Bacteria | 23035 |
| 243 | Ga0496117_0008867 | 3300048920 | Bacteria | 9490 |
| 244 | Ga0496117_0039058 | 3300048920 | Bacteria | 3508 |
| 245 | Ga0496118_0000253 | 3300048921 | Bacteria | 94328 |
| 246 | Ga0496118_0000597 | 3300048921 | Bacteria | 59798 |
| 247 | Ga0496118_0011548 | 3300048921 | Bacteria | 8605 |
| 248 | Ga0496119_0052742 | 3300048922 | Bacteria | 2489 |
| 249 | Ga0496120_0166115 | 3300048923 | Bacteria | 1096 |
| 250 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 251 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 252 | Ga0496121_0000069 | 3300048924 | Bacteria | 253087 |
| 253 | Ga0496121_0000293 | 3300048924 | Bacteria | 103372 |
| 254 | Ga0496121_0002582 | 3300048924 | Bacteria | 27397 |
| 255 | Ga0496121_0037747 | 3300048924 | Bacteria | 4286 |
| 256 | Ga0496121_0053446 | 3300048924 | Bacteria | 3384 |
| 257 | Ga0496121_0056968 | 3300048924 | Bacteria | 3242 |
| 258 | Ga0496122_0006942 | 3300048925 | Bacteria | 12766 |
| 259 | Ga0496122_0171879 | 3300048925 | Bacteria | 1305 |
| 260 | Ga0496122_0236635 | 3300048925 | Bacteria | 1033 |
| 261 | Ga0496123_0198667 | 3300048926 | Bacteria | 1030 |
| 262 | Ga0496124_0000458 | 3300048927 | Bacteria | 70719 |
| 263 | Ga0496124_0007043 | 3300048927 | Bacteria | 12044 |
| 264 | Ga0496124_0020337 | 3300048927 | Bacteria | 6139 |
| 265 | Ga0496125_0022777 | 3300048928 | Bacteria | 5807 |
| 266 | Ga0496125_0044095 | 3300048928 | Bacteria | 3777 |
| 267 | Ga0496126_0007655 | 3300048929 | Bacteria | 11788 |
| 268 | Ga0496126_0018009 | 3300048929 | Bacteria | 7021 |
| 269 | Ga0496126_0029082 | 3300048929 | Bacteria | 5253 |
| 270 | Ga0496126_0194511 | 3300048929 | Bacteria | 1716 |
| 271 | Ga0501031_0007010 | 3300049568 | Bacteria | 7356 |
| 272 | Ga0501032_0026099 | 3300049569 | Bacteria | 4023 |
| 273 | Ga0501032_0113783 | 3300049569 | Bacteria | 1790 |
| 274 | Ga0501032_0129509 | 3300049569 | Bacteria | 1665 |
| 275 | Ga0501033_0001910 | 3300049570 | Bacteria | 18130 |
| 276 | Ga0501033_0002876 | 3300049570 | Bacteria | 14423 |
| 277 | Ga0501034_0094384 | 3300049571 | Bacteria | 2988 |
| 278 | Ga0501034_0282958 | 3300049571 | Bacteria | 1597 |
| 279 | Ga0501036_0014234 | 3300049572 | Bacteria | 6619 |
| 280 | Ga0501036_0036910 | 3300049572 | Bacteria | 4134 |
| 281 | Ga0501036_0142882 | 3300049572 | Bacteria | 2019 |
| 282 | Ga0501037_0009629 | 3300049573 | Bacteria | 7089 |
| 283 | Ga0501037_0092109 | 3300049573 | Bacteria | 2192 |
| 284 | Ga0501038_0042747 | 3300049574 | Bacteria | 3945 |
| 285 | Ga0501039_0030064 | 3300049575 | Bacteria | 4186 |
| 286 | Ga0501039_0223868 | 3300049575 | Bacteria | 1479 |
| 287 | Ga0501039_0324982 | 3300049575 | Bacteria | 1209 |
| 288 | Ga0501041_0109425 | 3300049577 | Bacteria | 1714 |
| 289 | Ga0501043_0003239 | 3300049579 | Bacteria | 13442 |
| 290 | Ga0501046_0068526 | 3300049580 | Bacteria | 2761 |
| 291 | Ga0501046_0277376 | 3300049580 | Bacteria | 1228 |
| 292 | Ga0501047_0348995 | 3300049581 | Bacteria | 1316 |
| 293 | Ga0501048_0048450 | 3300049582 | Bacteria | 3030 |
| 294 | Ga0501067_0002648 | 3300049583 | Bacteria | 9914 |
| 295 | Ga0501068_0004826 | 3300049584 | Bacteria | 7339 |
| 296 | Ga0501069_0028516 | 3300049585 | Bacteria | 3061 |
| 297 | Ga0501069_0040054 | 3300049585 | Bacteria | 2589 |
| 298 | Ga0501069_0185592 | 3300049585 | Bacteria | 1203 |
| 299 | Ga0501070_0004856 | 3300049586 | Bacteria | 11487 |
| 300 | Ga0501070_0109405 | 3300049586 | Bacteria | 2283 |
| 301 | Ga0501070_0281988 | 3300049586 | Bacteria | 1355 |
| 302 | Ga0501071_0101407 | 3300049587 | Bacteria | 2122 |
| 303 | Ga0501071_0117920 | 3300049587 | Bacteria | 1966 |
| 304 | Ga0501072_0120745 | 3300049588 | Bacteria | 2088 |
| 305 | Ga0501072_0195718 | 3300049588 | Bacteria | 1612 |
| 306 | Ga0501072_0260448 | 3300049588 | Bacteria | 1380 |
| 307 | Ga0501073_0020321 | 3300049589 | Bacteria | 4791 |
| 308 | Ga0501074_0038839 | 3300049590 | Bacteria | 3448 |
| 309 | Ga0501075_0065423 | 3300049591 | Bacteria | 2743 |
| 310 | Ga0501075_0073524 | 3300049591 | Bacteria | 2585 |
| 311 | Ga0501076_0222603 | 3300049592 | Bacteria | 1542 |
| 312 | Ga0501077_0113752 | 3300049593 | Bacteria | 1716 |
| 313 | Ga0501211_000862 | 3300049658 | Bacteria | 3171 |
| 314 | Ga0501223_000021 | 3300049663 | Bacteria | 66697 |
| 315 | Ga0501225_0000011 | 3300049705 | Bacteria | 74084 |
| 316 | Ga0501225_0001072 | 3300049705 | Bacteria | 8586 |
| 317 | Ga0501079_0001769 | 3300049741 | Bacteria | 15409 |
| 318 | Ga0501079_0012807 | 3300049741 | Bacteria | 6403 |
| 319 | Ga0501080_0131445 | 3300049742 | Bacteria | 2318 |
| 320 | Ga0501080_0216997 | 3300049742 | Bacteria | 1751 |
| 321 | Ga0501080_0300822 | 3300049742 | Bacteria | 1455 |
| 322 | Ga0501081_0114632 | 3300049743 | Bacteria | 1915 |
| 323 | Ga0501083_0051518 | 3300049744 | Bacteria | 2767 |
| 324 | Ga0501035_0000826 | 3300049822 | Bacteria | 33043 |
| 325 | Ga0501035_0332086 | 3300049822 | Bacteria | 1275 |
| 326 | Ga0501044_0116084 | 3300049823 | Bacteria | 2682 |
| 327 | Ga0501044_0153294 | 3300049823 | Bacteria | 2285 |
| 328 | Ga0501045_0008986 | 3300049824 | Bacteria | 6979 |
| 329 | Ga0501045_0221420 | 3300049824 | Bacteria | 1409 |
| 330 | nmdc:mga00v17_5679_c1 | 3300050491 | Bacteria | 6586 |
| 331 | nmdc:mga0n895_112_c1 | 3300050512 | Bacteria | 48224 |
| 332 | nmdc:mga0rr50_5_c1 | 3300050513 | Bacteria | 327169 |
| 333 | nmdc:mga08x19_77_c1 | 3300050514 | Bacteria | 91801 |
| 334 | Ga0495601_0135964 | 3300053077 | Bacteria | 1602 |
| 335 | Ga0500643_005656 | 3300053087 | Bacteria | 5346 |
| 336 | Ga0500643_010138 | 3300053087 | Bacteria | 3535 |
| 337 | Ga0500643_012984 | 3300053087 | Bacteria | 2962 |
| 338 | Ga0500562_003548 | 3300053108 | Bacteria | 3912 |
| 339 | Ga0500595_001521 | 3300053119 | Bacteria | 12313 |
| 340 | Ga0500607_105110 | 3300053121 | Bacteria | 1395 |
| 341 | Ga0500559_0010851 | 3300053136 | Bacteria | 3905 |
| 342 | Ga0500559_0018683 | 3300053136 | Bacteria | 2927 |
| 343 | Ga0500574_005208 | 3300053141 | Bacteria | 2510 |
| 344 | Ga0500590_011772 | 3300053148 | Bacteria | 4441 |
| 345 | Ga0500604_0004420 | 3300053151 | Bacteria | 3733 |
| 346 | Ga0500619_000818 | 3300053154 | Bacteria | 5293 |
| 347 | Ga0500624_000065 | 3300053157 | Bacteria | 63944 |
| 348 | Ga0500636_0012490 | 3300053177 | Bacteria | 4978 |
| 349 | Ga0500636_0038289 | 3300053177 | Bacteria | 2837 |
| 350 | Ga0501084_0021158 | 3300054114 | Bacteria | 5424 |
| 351 | Ga0501084_0142140 | 3300054114 | Bacteria | 2021 |
| 352 | Ga0501084_0325446 | 3300054114 | Bacteria | 1298 |
| 353 | Ga0501082_0002539 | 3300060353 | Bacteria | 15986 |
| 354 | Ga0501082_0034027 | 3300060353 | Bacteria | 4395 |
| 355 | Ga0501082_0035440 | 3300060353 | Bacteria | 4301 |
| 356 | Ga0501082_0144840 | 3300060353 | Bacteria | 2062 |
| 357 | 2513589563 | 2513237087 | Bacteria | 5817514 |
| 358 | 2643835560 | 2643221563 | Bacteria | 4726935 |
| 359 | 2644040630 | 2643221605 | Bacteria | 4772303 |
| 360 | 2644056486 | 2643221608 | Bacteria | 4724829 |
| 361 | 2644520062 | 2643221693 | Bacteria | 5513853 |
| 362 | 2738747257 | 2738541281 | Bacteria | 5112672 |
| 363 | 2739356486 | 2738543032 | Bacteria | 5115625 |
| 364 | 2778124737 | 2775507255 | Bacteria | 3945731 |
| 365 | 2809064312 | 2808606401 | Bacteria | 4586670 |
| 366 | 2809080280 | 2808606404 | Bacteria | 4652788 |
| 367 | 2809084644 | 2808606405 | Bacteria | 4586632 |
| 368 | 2819542034 | 2818991436 | Bacteria | 5376622 |
| 369 | 2828309713 | 2828305725 | Bacteria | 4916900 |
| 370 | 2852678094 | 2852677369 | Bacteria | 3768884 |
| 371 | 2857576760 | 2857576091 | Bacteria | 5465855 |
| 372 | 2880522119 | 2880518877 | Bacteria | 5012590 |
| 373 | 2919139371 | 2919138771 | Bacteria | 5281312 |
| 374 | 2919494973 | 2919493220 | Bacteria | 4598500 |
| 375 | 2919545927 | 2919543075 | Bacteria | 4728703 |
| 376 | 2919712231 | 2919709256 | Bacteria | 4318106 |
| 377 | 2923529777 | 2923525760 | Bacteria | 4472324 |
| 378 | 8054568930 | 8054563764 | Bacteria | 5592885 |
| 379 | Ga0105243_10178239 | |||
| 380 | SwRhRL2b_contig_2129276 | |||
| 381 | JGI24741J21665_1000173 | |||
| 382 | JGI24740J21852_10026576 | |||
| 383 | JGI24739J22299_10000501 | |||
| 384 | JGI24737J22298_10006592 | |||
| 385 | JGI24735J21928_10013641 | |||
| 386 | JGI24738J21930_10000823 | |||
| 387 | JGI25165J46597_1000373 | |||
| 388 | Ga0055538_1000144 | |||
| 389 | Ga0055539_1000195 | |||
| 390 | Ga0055533_1000196 | |||
| 391 | Ga0055525_1000263 | |||
| 392 | Ga0055541_1000128 | |||
| 393 | Ga0065704_10002149 | |||
| 394 | Ga0065704_10002858 | |||
| 395 | Ga0065704_10116104 | |||
| 396 | Ga0070683_100049688 | |||
| 397 | Ga0070670_100000209 | |||
| 398 | Ga0070666_10180823 | |||
| 399 | Ga0070689_100118674 | |||
| 400 | Ga0070669_100066733 | |||
| 401 | Ga0070669_100088659 | |||
| 402 | Ga0070669_100242954 | |||
| 403 | Ga0070675_100182423 | |||
| 404 | Ga0070671_100068643 | |||
| 405 | Ga0070674_100012678 | |||
| 406 | Ga0070674_100098056 | |||
| 407 | Ga0070673_100010949 | |||
| 408 | Ga0070659_100032876 | |||
| 409 | Ga0070667_100000127 | |||
| 410 | Ga0070667_100000174 | |||
| 411 | Ga0070663_100000434 | |||
| 412 | Ga0070681_10114160 | |||
| 413 | Ga0068867_100460520 | |||
| 414 | Ga0070684_100000769 | |||
| 415 | Ga0070697_100252347 | |||
| 416 | Ga0068853_100017446 | |||
| 417 | Ga0068855_100018266 | |||
| 418 | Ga0068855_100154177 | |||
| 419 | Ga0068855_100298539 | |||
| 420 | Ga0070664_100050610 | |||
| 421 | Ga0068857_100052595 | |||
| 422 | Ga0068854_100082969 | |||
| 423 | Ga0068856_100015610 | |||
| 424 | Ga0068856_100176121 | |||
| 425 | Ga0068852_100069656 | |||
| 426 | Ga0068859_100083309 | |||
| 427 | Ga0068864_100000062 | |||
| 428 | Ga0068864_100029288 | |||
| 429 | Ga0068851_10051788 | |||
| 430 | Ga0068851_10077548 | |||
| 431 | Ga0068863_100000064 | |||
| 432 | Ga0068863_100007816 | |||
| 433 | Ga0068860_100000125 | |||
| 434 | Ga0068860_100180705 | |||
| 435 | Ga0068862_100000079 | |||
| 436 | Ga0068862_100001663 | |||
| 437 | Ga0075365_10065842 | |||
| 438 | Ga0075364_10002199 | |||
| 439 | Ga0075364_10023205 | |||
| 440 | Ga0075370_10066739 | |||
| 441 | Ga0075430_100135925 | |||
| 442 | Ga0075431_100119732 | |||
| 443 | Ga0075434_100014840 | |||
| 444 | Ga0075429_100099539 | |||
| 445 | Ga0075436_100001741 | |||
| 446 | Ga0097620_100083309 | |||
| 447 | Ga0075435_100000018 | |||
| 448 | Ga0105251_10003959 | |||
| 449 | Ga0105240_10003721 | |||
| 450 | Ga0105240_10010397 | |||
| 451 | Ga0105247_10007723 | |||
| 452 | Ga0105243_10259795 | |||
| 453 | Ga0105241_10019325 | |||
| 454 | Ga0105248_10000014 | |||
| 455 | Ga0105248_10026633 | |||
| 456 | Ga0105248_10035276 | |||
| 457 | Ga0105248_10064034 | |||
| 458 | Ga0105237_10000130 | |||
| 459 | Ga0105237_10030003 | |||
| 460 | Ga0105237_10267976 | |||
| 461 | Ga0105238_10208247 | |||
| 462 | Ga0105238_10618100 | |||
| 463 | Ga0105249_10000907 | |||
| 464 | Ga0105148_100291 | |||
| 465 | Ga0105239_10000031 | |||
| 466 | Ga0105239_10615782 | |||
| 467 | Ga0157369_10001433 | |||
| 468 | Ga0163162_10014953 | |||
| 469 | Ga0157372_10059406 | |||
| 470 | Ga0157375_10394078 | |||
| 471 | Ga0163163_10053916 | |||
| 472 | Ga0157380_10012505 | |||
| 473 | Ga0182005_1004946 | |||
| 474 | Ga0213876_10000426 | |||
| 475 | Ga0213875_10098224 | |||
| 476 | Ga0209784_100010 | |||
| 477 | Ga0209566_100008 | |||
| 478 | Ga0209674_100019 | |||
| 479 | Ga0209147_100678 | |||
| 480 | Ga0209563_100021 | |||
| 481 | Ga0207427_102342 | |||
| 482 | Ga0209437_100019 | |||
| 483 | Ga0209677_100011 | |||
| 484 | Ga0209759_1006849 | |||
| 485 | Ga0209233_1000025 | |||
| 486 | Ga0209050_1001457 | |||
| 487 | Ga0209257_1000323 | |||
| 488 | Ga0207713_1024525 | |||
| 489 | Ga0207710_10008534 | |||
| 490 | Ga0207680_10163172 | |||
| 491 | Ga0207680_10251035 | |||
| 492 | Ga0207647_10040595 | |||
| 493 | Ga0207699_10102334 | |||
| 494 | Ga0207654_10014003 | |||
| 495 | Ga0207695_10004043 | |||
| 496 | Ga0207695_10006617 | |||
| 497 | Ga0207671_10005191 | |||
| 498 | Ga0207671_10031981 | |||
| 499 | Ga0207657_10022904 | |||
| 500 | Ga0207681_10013617 | |||
| 501 | Ga0207650_10000367 | |||
| 502 | Ga0207650_10030393 | |||
| 503 | Ga0207659_10159493 | |||
| 504 | Ga0207644_10265678 | |||
| 505 | Ga0207670_10095661 | |||
| 506 | Ga0207711_10000021 | |||
| 507 | Ga0207711_10037844 | |||
| 508 | Ga0207661_10073470 | |||
| 509 | Ga0207667_10125398 | |||
| 510 | Ga0207651_10000189 | |||
| 511 | Ga0207712_10000687 | |||
| 512 | Ga0207668_10000448 | |||
| 513 | Ga0207640_10068006 | |||
| 514 | Ga0207640_10085938 | |||
| 515 | Ga0207658_10000122 | |||
| 516 | Ga0207658_10000424 | |||
| 517 | Ga0207658_10097918 | |||
| 518 | Ga0207703_10025810 | |||
| 519 | Ga0207639_10001222 | |||
| 520 | Ga0207639_10011556 | |||
| 521 | Ga0207678_10000584 | |||
| 522 | Ga0207641_10000107 | |||
| 523 | Ga0207641_10000956 | |||
| 524 | Ga0207676_10000057 | |||
| 525 | Ga0207674_10080708 | |||
| 526 | Ga0207698_10003129 | |||
| 527 | Ga0268266_10012111 | |||
| 528 | Ga0268265_10000080 | |||
| 529 | Ga0268265_10004207 | |||
| 530 | Ga0268265_10237620 | |||
| 531 | Ga0268264_10000166 | |||
| 532 | Ga0265318_10012020 | |||
| 533 | Ga0265336_10000028 | |||
| 534 | Ga0265324_10003212 | |||
| 535 | Ga0265765_1004811 | |||
| 536 | Ga0265328_10024616 | |||
| 537 | Ga0265328_10033179 | |||
| 538 | Ga0265325_10000136 | |||
| 539 | Ga0265340_10018526 | |||
| 540 | Ga0265331_10049539 | |||
| 541 | Ga0265316_10004957 | |||
| 542 | Ga0265313_10009036 | |||
| 543 | Ga0307405_10006287 | |||
| 544 | Ga0307405_10072302 | |||
| 545 | Ga0307410_10075228 | |||
| 546 | Ga0307406_10232848 | |||
| 547 | Ga0307412_10096394 | |||
| 548 | Ga0307409_100140181 | |||
| 549 | Ga0307414_10003996 | |||
| 550 | Ga0307414_10094439 | |||
| 551 | Ga0307411_10065648 | |||
| 552 | Ga0395898_0159932 | |||
| 553 | Ga0436364_0616084 | |||
| 554 | Ga0395901_0374006 | |||
| 555 | Ga0436365_0245367 | |||
| 556 | Ga0436363_1707107 | |||
| 557 | Ga0451807_2621016 | |||
| 558 | Ga0451837_0503711 | |||
| 559 | Ga0450904_000183 | |||
| 560 | Ga0450904_000416 | |||
| 561 | Ga0439446_0014133 | |||
| 562 | Ga0453684_0123452 | |||
| 563 | Ga0466968_0019104 | |||
| 564 | Ga0466959_0149633 | |||
| 565 | Ga0451576_0002071 | |||
| 566 | Ga0466967_0063054 | |||
| 567 | Ga0495617_012675 | |||
| 568 | Ga0495627_000431 | |||
| 569 | Ga0495627_001658 | |||
| 570 | Ga0495590_0048525 | |||
| 571 | Ga0495638_0087707 | |||
| 572 | Ga0495651_0089742 | |||
| 573 | Ga0495653_0008157 | |||
| 574 | Ga0495584_0077553 | |||
| 575 | Ga0495607_0000021 | |||
| 576 | Ga0495607_0011163 | |||
| 577 | Ga0495583_0000276 | |||
| 578 | Ga0495608_0007994 | |||
| 579 | Ga0495610_0000068 | |||
| 580 | Ga0495618_0037908 | |||
| 581 | Ga0495628_0063264 | |||
| 582 | Ga0495632_0000007 | |||
| 583 | Ga0495637_0000791 | |||
| 584 | Ga0495643_0000005 | |||
| 585 | Ga0495648_0005531 | |||
| 586 | Ga0495648_0041713 | |||
| 587 | Ga0495663_0000005 | |||
| 588 | Ga0495645_0156512 | |||
| 589 | Ga0495633_0000256 | |||
| 590 | Ga0495633_0000766 | |||
| 591 | Ga0495633_0012426 | |||
| 592 | Ga0495611_0098993 | |||
| 593 | Ga0495625_0000751 | |||
| 594 | Ga0495625_0002958 | |||
| 595 | Ga0495635_0201640 | |||
| 596 | Ga0495661_0000284 | |||
| 597 | Ga0495599_0043117 | |||
| 598 | Ga0495646_0010736 | |||
| 599 | Ga0495669_0061680 | |||
| 600 | Ga0495624_0031206 | |||
| 601 | Ga0495671_0000007 | |||
| 602 | Ga0495649_0005498 | |||
| 603 | Ga0495589_0004605 | |||
| 604 | Ga0495600_0008875 | |||
| 605 | Ga0495604_0101360 | |||
| 606 | Ga0495672_0095743 | |||
| 607 | Ga0495683_0022396 | |||
| 608 | Ga0495681_0000055 | |||
| 609 | Ga0495681_0002657 | |||
| 610 | Ga0495686_0000164 | |||
| 611 | Ga0495686_0036460 | |||
| 612 | Ga0495686_0074650 | |||
| 613 | Ga0496102_0092039 | |||
| 614 | Ga0496102_0341784 | |||
| 615 | Ga0496105_0058925 | |||
| 616 | Ga0496108_0001299 | |||
| 617 | Ga0496109_0105581 | |||
| 618 | Ga0496113_0052840 | |||
| 619 | Ga0496114_0141806 | |||
| 620 | Ga0496117_0002505 | |||
| 621 | Ga0496117_0008867 | |||
| 622 | Ga0496117_0039058 | |||
| 623 | Ga0496118_0000253 | |||
| 624 | Ga0496118_0000597 | |||
| 625 | Ga0496118_0011548 | |||
| 626 | Ga0496119_0052742 | |||
| 627 | Ga0496120_0166115 | |||
| 628 | Ga0496121_0000009 | |||
| 629 | Ga0496121_0000017 | |||
| 630 | Ga0496121_0000069 | |||
| 631 | Ga0496121_0000293 | |||
| 632 | Ga0496121_0002582 | |||
| 633 | Ga0496121_0037747 | |||
| 634 | Ga0496121_0053446 | |||
| 635 | Ga0496121_0056968 | |||
| 636 | Ga0496122_0006942 | |||
| 637 | Ga0496122_0171879 | |||
| 638 | Ga0496122_0236635 | |||
| 639 | Ga0496123_0198667 | |||
| 640 | Ga0496124_0000458 | |||
| 641 | Ga0496124_0007043 | |||
| 642 | Ga0496124_0020337 | |||
| 643 | Ga0496125_0022777 | |||
| 644 | Ga0496125_0044095 | |||
| 645 | Ga0496126_0007655 | |||
| 646 | Ga0496126_0018009 | |||
| 647 | Ga0496126_0029082 | |||
| 648 | Ga0496126_0194511 | |||
| 649 | Ga0501031_0007010 | |||
| 650 | Ga0501032_0026099 | |||
| 651 | Ga0501032_0113783 | |||
| 652 | Ga0501032_0129509 | |||
| 653 | Ga0501033_0001910 | |||
| 654 | Ga0501033_0002876 | |||
| 655 | Ga0501034_0094384 | |||
| 656 | Ga0501034_0282958 | |||
| 657 | Ga0501036_0014234 | |||
| 658 | Ga0501036_0036910 | |||
| 659 | Ga0501036_0142882 | |||
| 660 | Ga0501037_0009629 | |||
| 661 | Ga0501037_0092109 | |||
| 662 | Ga0501038_0042747 | |||
| 663 | Ga0501039_0030064 | |||
| 664 | Ga0501039_0223868 | |||
| 665 | Ga0501039_0324982 | |||
| 666 | Ga0501041_0109425 | |||
| 667 | Ga0501043_0003239 | |||
| 668 | Ga0501046_0068526 | |||
| 669 | Ga0501046_0277376 | |||
| 670 | Ga0501047_0348995 | |||
| 671 | Ga0501048_0048450 | |||
| 672 | Ga0501067_0002648 | |||
| 673 | Ga0501068_0004826 | |||
| 674 | Ga0501069_0028516 | |||
| 675 | Ga0501069_0040054 | |||
| 676 | Ga0501069_0185592 | |||
| 677 | Ga0501070_0004856 | |||
| 678 | Ga0501070_0109405 | |||
| 679 | Ga0501070_0281988 | |||
| 680 | Ga0501071_0101407 | |||
| 681 | Ga0501071_0117920 | |||
| 682 | Ga0501072_0120745 | |||
| 683 | Ga0501072_0195718 | |||
| 684 | Ga0501072_0260448 | |||
| 685 | Ga0501073_0020321 | |||
| 686 | Ga0501074_0038839 | |||
| 687 | Ga0501075_0065423 | |||
| 688 | Ga0501075_0073524 | |||
| 689 | Ga0501076_0222603 | |||
| 690 | Ga0501077_0113752 | |||
| 691 | Ga0501211_000862 | |||
| 692 | Ga0501223_000021 | |||
| 693 | Ga0501225_0000011 | |||
| 694 | Ga0501225_0001072 | |||
| 695 | Ga0501079_0001769 | |||
| 696 | Ga0501079_0012807 | |||
| 697 | Ga0501080_0131445 | |||
| 698 | Ga0501080_0216997 | |||
| 699 | Ga0501080_0300822 | |||
| 700 | Ga0501081_0114632 | |||
| 701 | Ga0501083_0051518 | |||
| 702 | Ga0501035_0000826 | |||
| 703 | Ga0501035_0332086 | |||
| 704 | Ga0501044_0116084 | |||
| 705 | Ga0501044_0153294 | |||
| 706 | Ga0501045_0008986 | |||
| 707 | Ga0501045_0221420 | |||
| 708 | nmdc:mga00v17_5679_c1 | |||
| 709 | nmdc:mga0n895_112_c1 | |||
| 710 | nmdc:mga0rr50_5_c1 | |||
| 711 | nmdc:mga08x19_77_c1 | |||
| 712 | Ga0495601_0135964 | |||
| 713 | Ga0500643_005656 | |||
| 714 | Ga0500643_010138 | |||
| 715 | Ga0500643_012984 | |||
| 716 | Ga0500562_003548 | |||
| 717 | Ga0500595_001521 | |||
| 718 | Ga0500607_105110 | |||
| 719 | Ga0500559_0010851 | |||
| 720 | Ga0500559_0018683 | |||
| 721 | Ga0500574_005208 | |||
| 722 | Ga0500590_011772 | |||
| 723 | Ga0500604_0004420 | |||
| 724 | Ga0500619_000818 | |||
| 725 | Ga0500624_000065 | |||
| 726 | Ga0500636_0012490 | |||
| 727 | Ga0500636_0038289 | |||
| 728 | Ga0501084_0021158 | |||
| 729 | Ga0501084_0142140 | |||
| 730 | Ga0501084_0325446 | |||
| 731 | Ga0501082_0002539 | |||
| 732 | Ga0501082_0034027 | |||
| 733 | Ga0501082_0035440 | |||
| 734 | Ga0501082_0144840 | |||
| 735 | 2513589563 | |||
| 736 | 2643835560 | |||
| 737 | 2644040630 | |||
| 738 | 2644056486 | |||
| 739 | 2644520062 | |||
| 740 | 2738747257 | |||
| 741 | 2739356486 | |||
| 742 | 2778124737 | |||
| 743 | 2809064312 | |||
| 744 | 2809080280 | |||
| 745 | 2809084644 | |||
| 746 | 2819542034 | |||
| 747 | 2828309713 | |||
| 748 | 2852678094 | |||
| 749 | 2857576760 | |||
| 750 | 2880522119 | |||
| 751 | 2919139371 | |||
| 752 | 2919494973 | |||
| 753 | 2919545927 | |||
| 754 | 2919712231 | |||
| 755 | 2923529777 | |||
| 756 | 8054568930 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.8984 | 5 | 329 |
| 4us5-assembly2.cif.gz_D | crystal structure of apo-msno8 | 0.8892 | 1 | 329 |
| 4us5-assembly1.cif.gz_A | crystal structure of apo-msno8 | 0.8838 | 5 | 329 |
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.8776 | 5 | 329 |
| 4us5-assembly2.cif.gz_D | crystal structure of apo-msno8 | 0.8763 | 1 | 329 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9727 | 1 | 327 | 3.20.20.30 |
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9669 | 1 | 327 | 3.20.20.30 |
| af_Q2FXV3_1_329_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9573 | 4 | 328 | 3.20.20.30 |
| af_Q2FXV3_1_329_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9432 | 4 | 328 | 3.20.20.30 |
| 4us5A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9306 | 5 | 329 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A418ZSE9-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9937 | 6 | 78 |
GO:0005829
GO:0016705 |
| AF-A0A4Q2YTM3-F1-model_v4 | Alkane 1-monooxygenase | 0.9919 | 216 | 330 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A534XP08-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9916 | 4 | 97 |
GO:0005829
GO:0016705 |
| AF-A0A379W1Y8-F1-model_v4 | Monooxygenase | 0.9897 | 6 | 77 |
GO:0004497
GO:0005829 GO:0016020 GO:0016705 |
| AF-A0A3S1Z7A8-F1-model_v4 | MsnO8 family LLM class oxidoreductase (EC 1.-.-.-) | 0.9893 | 4 | 145 |
GO:0005829
GO:0016705 |