F428166

General Info

Members Datasets Scaffolds Average Seq Length
378 269 756 128

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0272770|Ga0501074_0272770_239_658
Length 139
Sequence MAEATNSSKSPPVTSLRTPIARVRGLGSAKEGAAHWWAQRVTAVALVPLLLWFVASVVALTGAGQTVVAAWIGQPVHAILLVLLVGAGLYHAQLGLQVVIEDYVHTKWLKLISIIAIKFAAVVIVAATVFAVLKIAFAA

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
171 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
185 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
199 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
204 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
214 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
215 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
216 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
217 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
218 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
268 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
269 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.06
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 0
Rhizoplane 2.38
Rhizosphere 80.95
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0272770 3300049590 Bacteria 1203
2 MBSR1b_contig_1511188 2162886012 Bacteria 984
3 ARcpr5oldR_c002450 3300000041 Bacteria 1712
4 ARcpr5yngRDRAFT_c001786 3300000043 Bacteria 2302
5 ARCol0yngRDRAFT_1009461 3300000652 Bacteria 706
6 JGI25150J39212_1000313 3300002774 Bacteria 23995
7 JGI25151J46595_10065158 3300003187 Bacteria 1136
8 JGI25153J46596_10000027 3300003215 Bacteria 210760
9 JGI25153J46596_10017687 3300003215 Bacteria 2799
10 Ga0055526_1007689 3300003771 Bacteria 5541
11 Ga0055537_1001210 3300003773 Bacteria 10889
12 Ga0055537_1004639 3300003773 Bacteria 3882
13 Ga0055524_1000409 3300003775 Bacteria 36411
14 Ga0055536_1015850 3300003781 Bacteria 2554
15 Ga0055530_10000638 3300003791 Bacteria 30190
16 Ga0055530_10039525 3300003791 Bacteria 1164
17 Ga0055530_10048148 3300003791 Bacteria 1004
18 Ga0055540_1002114 3300003792 Bacteria 10857
19 Ga0055531_10000640 3300003794 Bacteria 30187
20 Ga0055531_10013791 3300003794 Bacteria 3699
21 Ga0055531_10063070 3300003794 Bacteria 893
22 Ga0055543_1019303 3300004625 Bacteria 1262
23 Ga0065165_1010107 3300005262 Bacteria 4134
24 Ga0065165_1017322 3300005262 Bacteria 2659
25 Ga0065712_10002984 3300005290 Bacteria 4356
26 Ga0065715_10112838 3300005293 Bacteria 2513
27 Ga0070658_10000172 3300005327 Bacteria 56478
28 Ga0070658_10000826 3300005327 Bacteria 26516
29 Ga0070683_100117637 3300005329 Bacteria 2509
30 Ga0070690_100003382 3300005330 Bacteria 8712
31 Ga0070670_100195175 3300005331 Bacteria 1758
32 Ga0068869_100019038 3300005334 Bacteria 4683
33 Ga0068869_100831397 3300005334 Bacteria 796
34 Ga0070666_10097905 3300005335 Bacteria 2020
35 Ga0070680_100171468 3300005336 Bacteria 1826
36 Ga0070680_100401871 3300005336 Bacteria 1168
37 Ga0070680_100593321 3300005336 Bacteria 951
38 Ga0070682_100074675 3300005337 Bacteria 2178
39 Ga0068868_100115536 3300005338 Bacteria 2185
40 Ga0070660_100000399 3300005339 Bacteria 28896
41 Ga0070660_101049614 3300005339 Bacteria 689
42 Ga0070689_100006225 3300005340 Bacteria 8237
43 Ga0070691_10858211 3300005341 Bacteria 557
44 Ga0070687_100033301 3300005343 Bacteria 2542
45 Ga0070661_100006458 3300005344 Bacteria 8085
46 Ga0070692_10016156 3300005345 Bacteria 3547
47 Ga0070692_10059896 3300005345 Bacteria 2003
48 Ga0070692_10073046 3300005345 Bacteria 1832
49 Ga0070668_100019966 3300005347 Bacteria 5050
50 Ga0070669_100022189 3300005353 Bacteria 4539
51 Ga0070675_100071797 3300005354 Bacteria 2873
52 Ga0070671_100425830 3300005355 Bacteria 1137
53 Ga0070674_100905620 3300005356 Bacteria 768
54 Ga0070673_100000430 3300005364 Bacteria 22151
55 Ga0070688_100060641 3300005365 Bacteria 2389
56 Ga0070659_100002584 3300005366 Bacteria 12872
57 Ga0070659_101594034 3300005366 Bacteria 583
58 Ga0070710_10628937 3300005437 Bacteria 750
59 Ga0070701_10013099 3300005438 Bacteria 3762
60 Ga0070705_100003246 3300005440 Bacteria 7991
61 Ga0070700_100461721 3300005441 Bacteria 968
62 Ga0070694_100123326 3300005444 Bacteria 1862
63 Ga0070678_100078523 3300005456 Bacteria 2494
64 Ga0070662_100026278 3300005457 Bacteria 4030
65 Ga0070662_100308214 3300005457 Bacteria 1288
66 Ga0070681_10001208 3300005458 Bacteria 22475
67 Ga0070681_10302878 3300005458 Bacteria 1508
68 Ga0068867_100016655 3300005459 Bacteria 5221
69 Ga0070685_10011323 3300005466 Bacteria 4671
70 Ga0070679_100002407 3300005530 Bacteria 16967
71 Ga0070679_100085690 3300005530 Bacteria 3137
72 Ga0070679_100361616 3300005530 Bacteria 1399
73 Ga0070679_100769939 3300005530 Bacteria 905
74 Ga0070679_101064721 3300005530 Bacteria 753
75 Ga0070684_100052756 3300005535 Bacteria 3537
76 Ga0070672_100035707 3300005543 Bacteria 3780
77 Ga0070686_100004718 3300005544 Bacteria 7517
78 Ga0070665_100058966 3300005548 Bacteria 3847
79 Ga0070704_101823568 3300005549 Bacteria 563
80 Ga0068855_100027732 3300005563 Bacteria 6776
81 Ga0068855_100305030 3300005563 Bacteria 1763
82 Ga0070664_100003466 3300005564 Bacteria 12739
83 Ga0070664_100189358 3300005564 Bacteria 1833
84 Ga0068857_100029446 3300005577 Bacteria 4845
85 Ga0068857_102405987 3300005577 Bacteria 517
86 Ga0068854_101592235 3300005578 Bacteria 595
87 Ga0070702_100153313 3300005615 Bacteria 1482
88 Ga0068859_100002119 3300005617 Bacteria 20213
89 Ga0068859_100002396 3300005617 Bacteria 19088
90 Ga0068864_100052238 3300005618 Bacteria 3522
91 Ga0068861_100000678 3300005719 Bacteria 20317
92 Ga0068861_100037252 3300005719 Bacteria 3615
93 Ga0068861_100336678 3300005719 Bacteria 1319
94 Ga0068870_10010534 3300005840 Bacteria 4253
95 Ga0068870_10447761 3300005840 Bacteria 851
96 Ga0068863_100001397 3300005841 Bacteria 23940
97 Ga0068858_100034877 3300005842 Bacteria 4667
98 Ga0068858_100451818 3300005842 Bacteria 1238
99 Ga0068860_100054783 3300005843 Bacteria 3791
100 Ga0068862_100007923 3300005844 Bacteria 8787
101 Ga0068862_100012284 3300005844 Bacteria 7081
102 Ga0075362_10291026 3300006177 Bacteria 809
103 Ga0097621_100062474 3300006237 Bacteria 3058
104 Ga0068871_100116256 3300006358 Bacteria 2255
105 Ga0068871_101051577 3300006358 Bacteria 760
106 Ga0075428_100016530 3300006844 Bacteria 8148
107 Ga0075430_100076166 3300006846 Bacteria 2811
108 Ga0075431_100015034 3300006847 Bacteria 7837
109 Ga0075431_100019809 3300006847 Bacteria 6868
110 Ga0075431_101132371 3300006847 Bacteria 747
111 Ga0075434_100552943 3300006871 Bacteria 1170
112 Ga0075429_100007843 3300006880 Bacteria 9274
113 Ga0068865_100138739 3300006881 Bacteria 1831
114 Ga0097620_100002119 3300006931 Bacteria 20213
115 Ga0105250_10104944 3300009092 Bacteria 1155
116 Ga0105240_10035052 3300009093 Bacteria 6471
117 Ga0105240_10128165 3300009093 Bacteria 3047
118 Ga0105240_11180889 3300009093 Bacteria 811
119 Ga0111539_10018303 3300009094 Bacteria 8678
120 Ga0111539_10096186 3300009094 Bacteria 3478
121 Ga0111539_10422800 3300009094 Bacteria 1552
122 Ga0111539_11526724 3300009094 Bacteria 775
123 Ga0105245_12435910 3300009098 Bacteria 577
124 Ga0105245_13054126 3300009098 Bacteria 519
125 Ga0114129_10003651 3300009147 Bacteria 21648
126 Ga0105243_13071824 3300009148 Bacteria 506
127 Ga0105248_10041090 3300009177 Bacteria 5184
128 Ga0105237_12153969 3300009545 Unclassified 567
129 Ga0105238_10002428 3300009551 Bacteria 18694
130 Ga0105238_11051042 3300009551 Bacteria 836
131 Ga0105249_10037769 3300009553 Bacteria 4382
132 Ga0105249_10102879 3300009553 Bacteria 2689
133 Ga0105239_10246697 3300010375 Bacteria 2005
134 Ga0105239_10440405 3300010375 Bacteria 1477
135 Ga0105246_10591389 3300011119 Bacteria 957
136 Ga0157373_10437037 3300013100 Bacteria 940
137 Ga0157370_10001569 3300013104 Bacteria 28272
138 Ga0157370_10002636 3300013104 Bacteria 21556
139 Ga0157374_10399758 3300013296 Bacteria 1370
140 Ga0157374_10699475 3300013296 Bacteria 1027
141 Ga0157378_10397996 3300013297 Bacteria 1356
142 Ga0157378_11139795 3300013297 Bacteria 818
143 Ga0163162_10178353 3300013306 Bacteria 2250
144 Ga0157372_10257677 3300013307 Bacteria 2025
145 Ga0157372_11014697 3300013307 Bacteria 961
146 Ga0157375_10084022 3300013308 Bacteria 3231
147 Ga0163163_10003527 3300014325 Bacteria 13287
148 Ga0157379_10091536 3300014968 Bacteria 2728
149 Ga0157379_10165218 3300014968 Bacteria 1997
150 Ga0157376_10079286 3300014969 Bacteria 2815
151 Ga0157376_10626850 3300014969 Bacteria 1073
152 Ga0213874_10030436 3300021377 Bacteria 1555
153 Ga0213876_10000486 3300021384 Bacteria 31448
154 Ga0207425_1000005 3300025245 Bacteria 900502
155 Ga0207425_1053617 3300025245 Bacteria 729
156 Ga0209129_1002457 3300025258 Bacteria 9079
157 Ga0209565_1000007 3300025263 Bacteria 784361
158 Ga0209565_1000231 3300025263 Bacteria 61384
159 Ga0209673_1006153 3300025273 Bacteria 5879
160 Ga0209673_1035094 3300025273 Bacteria 1506
161 Ga0209675_1005570 3300025291 Bacteria 5244
162 Ga0209675_1040024 3300025291 Bacteria 1034
163 Ga0209676_1021147 3300025292 Bacteria 2192
164 Ga0209025_1000515 3300025294 Bacteria 73801
165 Ga0209564_1000619 3300025295 Bacteria 54397
166 Ga0209758_1000002 3300025297 Bacteria 1400310
167 Ga0209758_1058536 3300025297 Bacteria 1288
168 Ga0209050_1000001 3300025298 Bacteria 3563507
169 Ga0209050_1000010 3300025298 Bacteria 980454
170 Ga0209050_1000483 3300025298 Bacteria 69796
171 Ga0209050_1004560 3300025298 Bacteria 9297
172 Ga0209256_1000008 3300025299 Bacteria 975723
173 Ga0207426_1068947 3300025302 Bacteria 992
174 Ga0209051_1000817 3300025303 Bacteria 32251
175 Ga0209257_1000027 3300025304 Bacteria 703541
176 Ga0209257_1000820 3300025304 Bacteria 45043
177 Ga0209257_1020410 3300025304 Bacteria 2450
178 Ga0207692_10718564 3300025898 Unclassified 649
179 Ga0207688_11013213 3300025901 Bacteria 525
180 Ga0207680_10071056 3300025903 Bacteria 2157
181 Ga0207645_10009699 3300025907 Bacteria 6651
182 Ga0207645_11184858 3300025907 Bacteria 513
183 Ga0207643_10006565 3300025908 Bacteria 6236
184 Ga0207643_10057239 3300025908 Bacteria 2219
185 Ga0207705_10000002 3300025909 Bacteria 2046852
186 Ga0207705_10000711 3300025909 Bacteria 27463
187 Ga0207707_10040851 3300025912 Bacteria 4050
188 Ga0207707_10707565 3300025912 Bacteria 845
189 Ga0207707_10897367 3300025912 Bacteria 733
190 Ga0207695_10080851 3300025913 Bacteria 3290
191 Ga0207671_11571740 3300025914 Unclassified 506
192 Ga0207660_10148084 3300025917 Bacteria 1801
193 Ga0207660_11007599 3300025917 Bacteria 679
194 Ga0207660_11174918 3300025917 Bacteria 625
195 Ga0207662_10019154 3300025918 Bacteria 3890
196 Ga0207657_10000579 3300025919 Bacteria 38919
197 Ga0207652_10001336 3300025921 Bacteria 21912
198 Ga0207652_10834022 3300025921 Bacteria 817
199 Ga0207681_10015049 3300025923 Bacteria 4822
200 Ga0207681_10186579 3300025923 Bacteria 1583
201 Ga0207694_10009783 3300025924 Bacteria 7236
202 Ga0207650_10267094 3300025925 Bacteria 1389
203 Ga0207659_10007508 3300025926 Bacteria 6710
204 Ga0207687_11959858 3300025927 Bacteria 500
205 Ga0207644_10483133 3300025931 Bacteria 1020
206 Ga0207690_10048394 3300025932 Bacteria 2827
207 Ga0207690_10459802 3300025932 Bacteria 1024
208 Ga0207690_11619554 3300025932 Unclassified 541
209 Ga0207706_10019088 3300025933 Bacteria 6168
210 Ga0207706_10230528 3300025933 Bacteria 1620
211 Ga0207709_10562890 3300025935 Bacteria 898
212 Ga0207670_10003454 3300025936 Bacteria 8378
213 Ga0207669_10137689 3300025937 Bacteria 1689
214 Ga0207704_10523786 3300025938 Bacteria 959
215 Ga0207691_10136961 3300025940 Bacteria 2159
216 Ga0207711_10008818 3300025941 Bacteria 8433
217 Ga0207689_10101227 3300025942 Bacteria 2367
218 Ga0207661_10188182 3300025944 Bacteria 1808
219 Ga0207679_10003913 3300025945 Bacteria 9242
220 Ga0207679_10646388 3300025945 Bacteria 956
221 Ga0207667_10300951 3300025949 Bacteria 1639
222 Ga0207651_10015594 3300025960 Bacteria 4422
223 Ga0207712_10061997 3300025961 Bacteria 2656
224 Ga0207712_10108351 3300025961 Bacteria 2079
225 Ga0207668_10012496 3300025972 Bacteria 5199
226 Ga0207658_10184706 3300025986 Bacteria 1728
227 Ga0207677_10178570 3300026023 Bacteria 1668
228 Ga0207703_10020059 3300026035 Bacteria 5224
229 Ga0207703_10605693 3300026035 Bacteria 1036
230 Ga0207708_10054456 3300026075 Bacteria 3050
231 Ga0207708_10068905 3300026075 Bacteria 2708
232 Ga0207702_10222570 3300026078 Bacteria 1759
233 Ga0207641_10002890 3300026088 Bacteria 15549
234 Ga0207648_10018924 3300026089 Bacteria 6221
235 Ga0207648_10511495 3300026089 Bacteria 1100
236 Ga0207676_10008243 3300026095 Bacteria 7412
237 Ga0207674_10037824 3300026116 Bacteria 5014
238 Ga0207674_10165238 3300026116 Bacteria 2167
239 Ga0207675_100000584 3300026118 Bacteria 35641
240 Ga0207675_100058985 3300026118 Bacteria 3582
241 Ga0207675_100227659 3300026118 Bacteria 1798
242 Ga0207683_10075714 3300026121 Bacteria 2979
243 Ga0207428_10017747 3300027907 Bacteria 6103
244 Ga0207428_10439171 3300027907 Bacteria 952
245 Ga0268266_10192746 3300028379 Bacteria 1861
246 Ga0268265_10000723 3300028380 Bacteria 32332
247 Ga0268265_10003337 3300028380 Bacteria 11612
248 Ga0268264_10659216 3300028381 Bacteria 1036
249 Ga0265338_10646345 3300028800 Bacteria 733
250 Ga0314311_1000754 3300030733 Bacteria 720
251 Ga0316182_1200252 3300030745 Bacteria 658
252 Ga0307513_10032872 3300031456 Bacteria 5841
253 Ga0307513_10810740 3300031456 Bacteria 642
254 Ga0307509_10000675 3300031507 Bacteria 58150
255 Ga0307408_100019209 3300031548 Bacteria 4599
256 Ga0307408_100704643 3300031548 Bacteria 908
257 Ga0316579_10114115 3300031691 Bacteria 1297
258 Ga0316579_10508470 3300031691 Bacteria 583
259 Ga0265314_10294784 3300031711 Bacteria 912
260 Ga0316576_10109429 3300031727 Bacteria 2070
261 Ga0316578_10106601 3300031728 Bacteria 1682
262 Ga0316577_10118140 3300031733 Bacteria 1489
263 Ga0307406_10132645 3300031901 Bacteria 1751
264 Ga0307412_10404766 3300031911 Bacteria 1112
265 Ga0307416_100037362 3300032002 Bacteria 3736
266 Ga0307415_101596220 3300032126 Bacteria 627
267 Ga0307415_102473585 3300032126 Bacteria 511
268 Ga0316585_10038597 3300032137 Bacteria 1518
269 Ga0316593_10409011 3300032168 Unclassified 525
270 Ga0316592_1011707 3300033524 Bacteria 1788
271 Ga0316596_1008866 3300033541 Bacteria 2406
272 Ga0316596_1080595 3300033541 Bacteria 875
273 Ga0373958_0002274 3300034819 Bacteria 2673
274 Ga0373954_0352539 3300035118 Unclassified 727
275 Ga0316574_0017337 3300035398 Bacteria 4214
276 Ga0373931_0231781 3300035691 Bacteria 1116
277 Ga0373933_0370517 3300035724 Bacteria 932
278 Ga0316582_0067581 3300036647 Bacteria 2306
279 Ga0316584_0009771 3300036712 Bacteria 6675
280 Ga0316584_1146601 3300036712 Unclassified 514
281 Ga0395899_0026316 3300037312 Bacteria 4389
282 Ga0395900_0011340 3300037418 Bacteria 9118
283 Ga0395900_0172047 3300037418 Bacteria 2204
284 Ga0395900_1468451 3300037418 Bacteria 594
285 Ga0395901_0058907 3300038443 Bacteria 3995
286 Ga0400491_25494 3300038727 Bacteria 1099
287 Ga0400483_204542 3300039062 Bacteria 1677
288 Ga0400483_276003 3300039062 Unclassified 1033
289 Ga0436365_1047135 3300039437 Bacteria 31623
290 Ga0436363_0593086 3300039450 Bacteria 2040
291 Ga0439436_0018298 3300041404 Bacteria 2094
292 Ga0439436_0036247 3300041404 Bacteria 1423
293 Ga0439447_044256 3300041407 Bacteria 1077
294 Ga0439461_0002704 3300041410 Bacteria 2858
295 Ga0439461_0003451 3300041410 Bacteria 2600
296 Ga0439465_0023416 3300041413 Bacteria 1943
297 Ga0439465_0096710 3300041413 Bacteria 1015
298 Ga0451800_0367495 3300041459 Bacteria 2184
299 Ga0451807_0991499 3300041486 Bacteria 512
300 Ga0451807_2334594 3300041486 Bacteria 798
301 Ga0439431_0003924 3300041997 Bacteria 3281
302 Ga0439442_066775 3300042002 Bacteria 764
303 Ga0439445_0008866 3300042004 Bacteria 2362
304 Ga0439445_0178417 3300042004 Bacteria 623
305 Ga0439445_0242166 3300042004 Bacteria 537
306 Ga0439448_0382067 3300042005 Unclassified 503
307 Ga0439432_000489 3300042006 Bacteria 14770
308 Ga0439452_044218 3300042010 Bacteria 1039
309 Ga0439457_007031 3300042014 Bacteria 2717
310 Ga0439462_0003560 3300042015 Bacteria 3746
311 Ga0439462_0041099 3300042015 Bacteria 1234
312 Ga0450920_018568 3300042122 Bacteria 1332
313 Ga0450910_041856 3300042147 Bacteria 742
314 Ga0450909_005567 3300042185 Bacteria 1812
315 Ga0439434_0015129 3300042435 Bacteria 2299
316 Ga0439434_0018363 3300042435 Bacteria 2093
317 Ga0451577_0066116 3300042876 Bacteria 3225
318 Ga0453684_0006801 3300044712 Bacteria 21511
319 Ga0451576_1399447 3300045051 Bacteria 728
320 Ga0495627_029314 3300046453 Bacteria 1752
321 Ga0495638_0126306 3300046460 Bacteria 1507
322 Ga0495651_0064578 3300046462 Bacteria 2797
323 Ga0495608_0099311 3300046511 Bacteria 1878
324 Ga0495628_0246388 3300046516 Unclassified 1335
325 Ga0495652_0264235 3300046529 Bacteria 1269
326 Ga0495635_0717180 3300046663 Unclassified 648
327 Ga0495657_0078357 3300046675 Bacteria 2142
328 Ga0495670_0000165 3300046691 Bacteria 28951
329 Ga0495600_0104285 3300046809 Bacteria 1848
330 Ga0495604_0093547 3300047317 Bacteria 2224
331 Ga0495636_0329616 3300047318 Bacteria 718
332 Ga0495681_0183554 3300047470 Bacteria 858
333 Ga0495602_0026310 3300048088 Bacteria 5614
334 Ga0496101_0163179 3300048904 Bacteria 1710
335 Ga0496106_0186111 3300048909 Bacteria 1650
336 Ga0496108_0355893 3300048911 Bacteria 1278
337 Ga0496114_0162790 3300048917 Bacteria 1941
338 Ga0496115_0000817 3300048918 Bacteria 22834
339 Ga0496115_0447540 3300048918 Unclassified 1044
340 Ga0501298_005599 3300049521 Bacteria 2022
341 Ga0501043_1033649 3300049579 Bacteria 583
342 Ga0501047_0356795 3300049581 Bacteria 1298
343 Ga0501070_0379689 3300049586 Bacteria 1145
344 Ga0501073_0191870 3300049589 Bacteria 1414
345 Ga0501074_0158923 3300049590 Bacteria 1614
346 Ga0501239_005984 3300049672 Bacteria 1239
347 Ga0501249_012762 3300049679 Bacteria 1779
348 Ga0501225_0185928 3300049705 Bacteria 652
349 Ga0501083_0327374 3300049744 Bacteria 996
350 Ga0501083_0555199 3300049744 Bacteria 747
351 Ga0501241_012359 3300049758 Bacteria 1552
352 nmdc:mga03683_462310_c1 3300050489 Bacteria 611
353 nmdc:mga05p37_12919_c1 3300050507 Bacteria 9988
354 nmdc:mga09592_1753_c1 3300050508 Bacteria 17437
355 nmdc:mga09592_323043_c1 3300050508 Bacteria 1337
356 nmdc:mga09592_374784_c1 3300050508 Bacteria 1231
357 nmdc:mga0qj67_5998_c1 3300050509 Bacteria 8905
358 nmdc:mga06r32_173362_c1 3300050510 Bacteria 2141
359 nmdc:mga06r32_21720_c1 3300050510 Bacteria 5927
360 nmdc:mga06r32_3866_c1 3300050510 Bacteria 13403
361 nmdc:mga06r32_511616_c1 3300050510 Bacteria 1177
362 nmdc:mga08y16_21928_c1 3300050511 Bacteria 6742
363 nmdc:mga08y16_70105_c1 3300050511 Bacteria 3654
364 nmdc:mga08y16_92069_c1 3300050511 Bacteria 3159
365 nmdc:mga08y16_934941_c1 3300050511 Bacteria 851
366 nmdc:mga0n895_91673_c1 3300050512 Bacteria 3041
367 nmdc:mga0a205_574665_c1 3300050515 Bacteria 981
368 Ga0495601_0131456 3300053077 Bacteria 1630
369 Ga0495595_0084192 3300053084 Bacteria 1519
370 Ga0500643_014433 3300053087 Bacteria 2746
371 Ga0500566_0004958 3300053094 Bacteria 7929
372 Ga0500658_0067635 3300053134 Bacteria 1500
373 Ga0500568_0007329 3300053139 Bacteria 5423
374 Ga0500577_0057929 3300053142 Bacteria 1480
375 Ga0500577_0406207 3300053142 Bacteria 596
376 Ga0500588_0413387 3300053146 Bacteria 514
377 2644125513 2643221622 Bacteria 4212502
378 2885430456 2885429604 Bacteria 3642894
379 Ga0501074_0272770
380 MBSR1b_contig_1511188
381 ARcpr5oldR_c002450
382 ARcpr5yngRDRAFT_c001786
383 ARCol0yngRDRAFT_1009461
384 JGI25150J39212_1000313
385 JGI25151J46595_10065158
386 JGI25153J46596_10000027
387 JGI25153J46596_10017687
388 Ga0055526_1007689
389 Ga0055537_1001210
390 Ga0055537_1004639
391 Ga0055524_1000409
392 Ga0055536_1015850
393 Ga0055530_10000638
394 Ga0055530_10039525
395 Ga0055530_10048148
396 Ga0055540_1002114
397 Ga0055531_10000640
398 Ga0055531_10013791
399 Ga0055531_10063070
400 Ga0055543_1019303
401 Ga0065165_1010107
402 Ga0065165_1017322
403 Ga0065712_10002984
404 Ga0065715_10112838
405 Ga0070658_10000172
406 Ga0070658_10000826
407 Ga0070683_100117637
408 Ga0070690_100003382
409 Ga0070670_100195175
410 Ga0068869_100019038
411 Ga0068869_100831397
412 Ga0070666_10097905
413 Ga0070680_100171468
414 Ga0070680_100401871
415 Ga0070680_100593321
416 Ga0070682_100074675
417 Ga0068868_100115536
418 Ga0070660_100000399
419 Ga0070660_101049614
420 Ga0070689_100006225
421 Ga0070691_10858211
422 Ga0070687_100033301
423 Ga0070661_100006458
424 Ga0070692_10016156
425 Ga0070692_10059896
426 Ga0070692_10073046
427 Ga0070668_100019966
428 Ga0070669_100022189
429 Ga0070675_100071797
430 Ga0070671_100425830
431 Ga0070674_100905620
432 Ga0070673_100000430
433 Ga0070688_100060641
434 Ga0070659_100002584
435 Ga0070659_101594034
436 Ga0070710_10628937
437 Ga0070701_10013099
438 Ga0070705_100003246
439 Ga0070700_100461721
440 Ga0070694_100123326
441 Ga0070678_100078523
442 Ga0070662_100026278
443 Ga0070662_100308214
444 Ga0070681_10001208
445 Ga0070681_10302878
446 Ga0068867_100016655
447 Ga0070685_10011323
448 Ga0070679_100002407
449 Ga0070679_100085690
450 Ga0070679_100361616
451 Ga0070679_100769939
452 Ga0070679_101064721
453 Ga0070684_100052756
454 Ga0070672_100035707
455 Ga0070686_100004718
456 Ga0070665_100058966
457 Ga0070704_101823568
458 Ga0068855_100027732
459 Ga0068855_100305030
460 Ga0070664_100003466
461 Ga0070664_100189358
462 Ga0068857_100029446
463 Ga0068857_102405987
464 Ga0068854_101592235
465 Ga0070702_100153313
466 Ga0068859_100002119
467 Ga0068859_100002396
468 Ga0068864_100052238
469 Ga0068861_100000678
470 Ga0068861_100037252
471 Ga0068861_100336678
472 Ga0068870_10010534
473 Ga0068870_10447761
474 Ga0068863_100001397
475 Ga0068858_100034877
476 Ga0068858_100451818
477 Ga0068860_100054783
478 Ga0068862_100007923
479 Ga0068862_100012284
480 Ga0075362_10291026
481 Ga0097621_100062474
482 Ga0068871_100116256
483 Ga0068871_101051577
484 Ga0075428_100016530
485 Ga0075430_100076166
486 Ga0075431_100015034
487 Ga0075431_100019809
488 Ga0075431_101132371
489 Ga0075434_100552943
490 Ga0075429_100007843
491 Ga0068865_100138739
492 Ga0097620_100002119
493 Ga0105250_10104944
494 Ga0105240_10035052
495 Ga0105240_10128165
496 Ga0105240_11180889
497 Ga0111539_10018303
498 Ga0111539_10096186
499 Ga0111539_10422800
500 Ga0111539_11526724
501 Ga0105245_12435910
502 Ga0105245_13054126
503 Ga0114129_10003651
504 Ga0105243_13071824
505 Ga0105248_10041090
506 Ga0105237_12153969
507 Ga0105238_10002428
508 Ga0105238_11051042
509 Ga0105249_10037769
510 Ga0105249_10102879
511 Ga0105239_10246697
512 Ga0105239_10440405
513 Ga0105246_10591389
514 Ga0157373_10437037
515 Ga0157370_10001569
516 Ga0157370_10002636
517 Ga0157374_10399758
518 Ga0157374_10699475
519 Ga0157378_10397996
520 Ga0157378_11139795
521 Ga0163162_10178353
522 Ga0157372_10257677
523 Ga0157372_11014697
524 Ga0157375_10084022
525 Ga0163163_10003527
526 Ga0157379_10091536
527 Ga0157379_10165218
528 Ga0157376_10079286
529 Ga0157376_10626850
530 Ga0213874_10030436
531 Ga0213876_10000486
532 Ga0207425_1000005
533 Ga0207425_1053617
534 Ga0209129_1002457
535 Ga0209565_1000007
536 Ga0209565_1000231
537 Ga0209673_1006153
538 Ga0209673_1035094
539 Ga0209675_1005570
540 Ga0209675_1040024
541 Ga0209676_1021147
542 Ga0209025_1000515
543 Ga0209564_1000619
544 Ga0209758_1000002
545 Ga0209758_1058536
546 Ga0209050_1000001
547 Ga0209050_1000010
548 Ga0209050_1000483
549 Ga0209050_1004560
550 Ga0209256_1000008
551 Ga0207426_1068947
552 Ga0209051_1000817
553 Ga0209257_1000027
554 Ga0209257_1000820
555 Ga0209257_1020410
556 Ga0207692_10718564
557 Ga0207688_11013213
558 Ga0207680_10071056
559 Ga0207645_10009699
560 Ga0207645_11184858
561 Ga0207643_10006565
562 Ga0207643_10057239
563 Ga0207705_10000002
564 Ga0207705_10000711
565 Ga0207707_10040851
566 Ga0207707_10707565
567 Ga0207707_10897367
568 Ga0207695_10080851
569 Ga0207671_11571740
570 Ga0207660_10148084
571 Ga0207660_11007599
572 Ga0207660_11174918
573 Ga0207662_10019154
574 Ga0207657_10000579
575 Ga0207652_10001336
576 Ga0207652_10834022
577 Ga0207681_10015049
578 Ga0207681_10186579
579 Ga0207694_10009783
580 Ga0207650_10267094
581 Ga0207659_10007508
582 Ga0207687_11959858
583 Ga0207644_10483133
584 Ga0207690_10048394
585 Ga0207690_10459802
586 Ga0207690_11619554
587 Ga0207706_10019088
588 Ga0207706_10230528
589 Ga0207709_10562890
590 Ga0207670_10003454
591 Ga0207669_10137689
592 Ga0207704_10523786
593 Ga0207691_10136961
594 Ga0207711_10008818
595 Ga0207689_10101227
596 Ga0207661_10188182
597 Ga0207679_10003913
598 Ga0207679_10646388
599 Ga0207667_10300951
600 Ga0207651_10015594
601 Ga0207712_10061997
602 Ga0207712_10108351
603 Ga0207668_10012496
604 Ga0207658_10184706
605 Ga0207677_10178570
606 Ga0207703_10020059
607 Ga0207703_10605693
608 Ga0207708_10054456
609 Ga0207708_10068905
610 Ga0207702_10222570
611 Ga0207641_10002890
612 Ga0207648_10018924
613 Ga0207648_10511495
614 Ga0207676_10008243
615 Ga0207674_10037824
616 Ga0207674_10165238
617 Ga0207675_100000584
618 Ga0207675_100058985
619 Ga0207675_100227659
620 Ga0207683_10075714
621 Ga0207428_10017747
622 Ga0207428_10439171
623 Ga0268266_10192746
624 Ga0268265_10000723
625 Ga0268265_10003337
626 Ga0268264_10659216
627 Ga0265338_10646345
628 Ga0314311_1000754
629 Ga0316182_1200252
630 Ga0307513_10032872
631 Ga0307513_10810740
632 Ga0307509_10000675
633 Ga0307408_100019209
634 Ga0307408_100704643
635 Ga0316579_10114115
636 Ga0316579_10508470
637 Ga0265314_10294784
638 Ga0316576_10109429
639 Ga0316578_10106601
640 Ga0316577_10118140
641 Ga0307406_10132645
642 Ga0307412_10404766
643 Ga0307416_100037362
644 Ga0307415_101596220
645 Ga0307415_102473585
646 Ga0316585_10038597
647 Ga0316593_10409011
648 Ga0316592_1011707
649 Ga0316596_1008866
650 Ga0316596_1080595
651 Ga0373958_0002274
652 Ga0373954_0352539
653 Ga0316574_0017337
654 Ga0373931_0231781
655 Ga0373933_0370517
656 Ga0316582_0067581
657 Ga0316584_0009771
658 Ga0316584_1146601
659 Ga0395899_0026316
660 Ga0395900_0011340
661 Ga0395900_0172047
662 Ga0395900_1468451
663 Ga0395901_0058907
664 Ga0400491_25494
665 Ga0400483_204542
666 Ga0400483_276003
667 Ga0436365_1047135
668 Ga0436363_0593086
669 Ga0439436_0018298
670 Ga0439436_0036247
671 Ga0439447_044256
672 Ga0439461_0002704
673 Ga0439461_0003451
674 Ga0439465_0023416
675 Ga0439465_0096710
676 Ga0451800_0367495
677 Ga0451807_0991499
678 Ga0451807_2334594
679 Ga0439431_0003924
680 Ga0439442_066775
681 Ga0439445_0008866
682 Ga0439445_0178417
683 Ga0439445_0242166
684 Ga0439448_0382067
685 Ga0439432_000489
686 Ga0439452_044218
687 Ga0439457_007031
688 Ga0439462_0003560
689 Ga0439462_0041099
690 Ga0450920_018568
691 Ga0450910_041856
692 Ga0450909_005567
693 Ga0439434_0015129
694 Ga0439434_0018363
695 Ga0451577_0066116
696 Ga0453684_0006801
697 Ga0451576_1399447
698 Ga0495627_029314
699 Ga0495638_0126306
700 Ga0495651_0064578
701 Ga0495608_0099311
702 Ga0495628_0246388
703 Ga0495652_0264235
704 Ga0495635_0717180
705 Ga0495657_0078357
706 Ga0495670_0000165
707 Ga0495600_0104285
708 Ga0495604_0093547
709 Ga0495636_0329616
710 Ga0495681_0183554
711 Ga0495602_0026310
712 Ga0496101_0163179
713 Ga0496106_0186111
714 Ga0496108_0355893
715 Ga0496114_0162790
716 Ga0496115_0000817
717 Ga0496115_0447540
718 Ga0501298_005599
719 Ga0501043_1033649
720 Ga0501047_0356795
721 Ga0501070_0379689
722 Ga0501073_0191870
723 Ga0501074_0158923
724 Ga0501239_005984
725 Ga0501249_012762
726 Ga0501225_0185928
727 Ga0501083_0327374
728 Ga0501083_0555199
729 Ga0501241_012359
730 nmdc:mga03683_462310_c1
731 nmdc:mga05p37_12919_c1
732 nmdc:mga09592_1753_c1
733 nmdc:mga09592_323043_c1
734 nmdc:mga09592_374784_c1
735 nmdc:mga0qj67_5998_c1
736 nmdc:mga06r32_173362_c1
737 nmdc:mga06r32_21720_c1
738 nmdc:mga06r32_3866_c1
739 nmdc:mga06r32_511616_c1
740 nmdc:mga08y16_21928_c1
741 nmdc:mga08y16_70105_c1
742 nmdc:mga08y16_92069_c1
743 nmdc:mga08y16_934941_c1
744 nmdc:mga0n895_91673_c1
745 nmdc:mga0a205_574665_c1
746 Ga0495601_0131456
747 Ga0495595_0084192
748 Ga0500643_014433
749 Ga0500566_0004958
750 Ga0500658_0067635
751 Ga0500568_0007329
752 Ga0500577_0057929
753 Ga0500577_0406207
754 Ga0500588_0413387
755 2644125513
756 2885430456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

14

132

0.92

PF05328

CybS

CybS, succinate dehydrogenase cytochrome B small subunit

13

138

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wdr-assembly1.cif.gz_D e. coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound 0.9265 20 119
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.9234 22 119
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.9228 20 119
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.9102 18 119
4ytp-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide 0.8862 22 121
ID Description Score Start End Superfamily
2wu5L00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9228 20 119 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9215 20 119 1.20.1300.10
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9112 20 119 1.20.1300.10
4ytpD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8862 22 121 1.20.1300.10
af_P0AC44_1_115_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8817 12 119 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A838UDD3-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9881 51 125 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A2E5H4T6-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9853 21 125 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A382SNI6-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9805 20 124 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A2D7KTS3-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9768 20 123 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872
AF-A0A4U7EYN9-F1-model_v4 Succinate dehydrogenase, hydrophobic membrane anchor protein 0.9765 52 126 GO:0006099
GO:0016020
GO:0020037
GO:0046872

Map