F428205

General Info

Members Datasets Scaffolds Average Seq Length
378 267 756 221

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904479285|2904481885
Length 251
Sequence PASSPHAPAPVNILLAGFEPFDRDSVNPSWEVARALDGWQPDRAAVPGTGSGEATGETGQAGDRAAGRAVVHALQLRCVFGQATAQLDEAIATLRPALVICLGLAGGRADITPERVAINIDDARIADNAGLQPVDRAVVSGAPAAYFSSLPIKAIVHALRAAGLPASVSNTAGTFVCNHVFFALMHRLAQAGPGVQARGGFIHVPYLPEQAARVPGAPSMALETQIAALRSVIRTSLAVSQDLRETAGRLH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
215 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
219 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
220 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
221 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
222 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
226 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
231 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
232 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
233 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
234 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
235 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
236 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
237 2643221683 Variovorax sp. Root473 Isolate Unclassified
238 2721755523 Delftia sp. HK171 Isolate Unclassified
239 2738541277 Variovorax sp. GV051 Isolate Unclassified
240 2738541307 Variovorax sp. GV008 Isolate Unclassified
241 2738543013 Variovorax sp. BT01 Isolate Unclassified
242 2738543019 Variovorax sp. GV040 Isolate Unclassified
243 2818991446 Variovorax sp. 1180 Isolate Unclassified
244 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
245 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
246 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
247 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
248 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
249 2857472729 Cohnella sp. R-74144 Isolate Unclassified
250 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
251 2885198086 Variovorax sp. 679 Isolate Unclassified
252 2885211737 Variovorax sp. 553 Isolate Unclassified
253 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
254 2899924645 Variovorax sp. 369 Isolate Unclassified
255 2909042592 Labrys sp. LIt4 Isolate Nodule
256 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
257 2928037797 Variovorax sp. 1126 Isolate Unclassified
258 2928044640 Variovorax sp. 1128 Isolate Unclassified
259 2928051484 Variovorax sp. 1133 Isolate Unclassified
260 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
261 2928070936 Variovorax gossypii 1167 Isolate Unclassified
262 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
263 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
264 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
265 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
266 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
267 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.95
Metatranscriptomes 0.53
Isolates 9.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.34
Nodule 1.32
Rhizoplane 2.91
Rhizosphere 56.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005403 3300001979 Bacteria 5409
2 JGI25156J39149_1014513 3300002705 Bacteria 1621
3 JGI25154J39366_1000653 3300002738 Bacteria 16170
4 JGI25157J39369_1000045 3300002741 Bacteria 122406
5 JGI25150J39212_1001446 3300002774 Bacteria 6627
6 JGI25406J46586_10030045 3300003203 Bacteria 2049
7 rootH1_10010099 3300003316 Bacteria 4008
8 rootH2_10003406 3300003320 Bacteria 3285
9 rootH2_10123470 3300003320 Bacteria 1137
10 rootH1_10050453 3300003323 Bacteria 3646
11 JGI25160J50197_1032513 3300003354 Bacteria 1324
12 Ga0006562J51391_1094764 3300003578 Bacteria 4740
13 Ga0055539_1000277 3300003752 Bacteria 29675
14 Ga0055533_1000026 3300003756 Bacteria 323407
15 Ga0055525_1001182 3300003759 Bacteria 5947
16 Ga0055535_1000056 3300003761 Bacteria 128204
17 Ga0055535_1000522 3300003761 Bacteria 33444
18 Ga0055542_1000003 3300003762 Bacteria 582721
19 Ga0055529_1000165 3300003763 Bacteria 91442
20 Ga0055536_1001522 3300003781 Bacteria 13907
21 Ga0055536_1002089 3300003781 Bacteria 11385
22 Ga0055534_1003358 3300003784 Bacteria 5062
23 Ga0055534_1026891 3300003784 Bacteria 911
24 Ga0055530_10000773 3300003791 Bacteria 26694
25 Ga0055540_1001603 3300003792 Bacteria 13189
26 Ga0055540_1020962 3300003792 Bacteria 1713
27 Ga0065704_10074797 3300005289 Bacteria 6000
28 Ga0065704_10228391 3300005289 Bacteria 1051
29 Ga0070658_10063217 3300005327 Bacteria 3017
30 Ga0070676_10166633 3300005328 Bacteria 1422
31 Ga0070683_100015508 3300005329 Bacteria 6696
32 Ga0070660_100030644 3300005339 Bacteria 4035
33 Ga0070689_100287642 3300005340 Bacteria 1365
34 Ga0070661_100042701 3300005344 Bacteria 3310
35 Ga0070661_100221435 3300005344 Bacteria 1451
36 Ga0070673_100002753 3300005364 Bacteria 10798
37 Ga0070673_100745345 3300005364 Bacteria 902
38 Ga0070659_100135718 3300005366 Bacteria 2001
39 Ga0070659_100275252 3300005366 Bacteria 1399
40 Ga0070710_10135195 3300005437 Bacteria 1507
41 Ga0070708_100046726 3300005445 Bacteria 3820
42 Ga0070678_100163895 3300005456 Bacteria 1804
43 Ga0070662_100016695 3300005457 Bacteria 4933
44 Ga0068867_100228517 3300005459 Bacteria 1503
45 Ga0070698_100003981 3300005471 Bacteria 16258
46 Ga0070684_100042463 3300005535 Bacteria 3925
47 Ga0068853_100034356 3300005539 Bacteria 4304
48 Ga0070665_100002531 3300005548 Bacteria 20087
49 Ga0070665_100039521 3300005548 Bacteria 4743
50 Ga0068855_100043418 3300005563 Bacteria 5325
51 Ga0068855_100135535 3300005563 Bacteria 2809
52 Ga0068855_100276618 3300005563 Bacteria 1866
53 Ga0070664_100078272 3300005564 Bacteria 2844
54 Ga0070664_100150493 3300005564 Bacteria 2054
55 Ga0068857_100003768 3300005577 Bacteria 12751
56 Ga0068857_100033686 3300005577 Bacteria 4531
57 Ga0068857_100172372 3300005577 Bacteria 1967
58 Ga0068857_100629517 3300005577 Bacteria 1015
59 Ga0068854_100106673 3300005578 Bacteria 2108
60 Ga0068854_100144633 3300005578 Bacteria 1828
61 Ga0068856_100000820 3300005614 Bacteria 33500
62 Ga0068856_100104206 3300005614 Bacteria 2830
63 Ga0068852_100160065 3300005616 Bacteria 2101
64 Ga0068851_10006934 3300005834 Bacteria 5194
65 Ga0068863_100470121 3300005841 Bacteria 1236
66 Ga0081455_10014633 3300005937 Bacteria 7675
67 Ga0081455_10021483 3300005937 Bacteria 6054
68 Ga0075365_10039511 3300006038 Bacteria 3073
69 Ga0075365_10223906 3300006038 Bacteria 1320
70 Ga0075364_10024636 3300006051 Bacteria 3823
71 Ga0075362_10106410 3300006177 Bacteria 1316
72 Ga0097621_100545214 3300006237 Bacteria 1055
73 Ga0075370_10078613 3300006353 Bacteria 1894
74 Ga0075370_10158289 3300006353 Bacteria 1328
75 Ga0068871_101047880 3300006358 Bacteria 761
76 Ga0079104_1000016 3300006946 Bacteria 313865
77 Ga0105240_10013955 3300009093 Bacteria 10999
78 Ga0105240_10049305 3300009093 Bacteria 5316
79 Ga0105240_10059662 3300009093 Bacteria 4760
80 Ga0105240_10164701 3300009093 Bacteria 2630
81 Ga0105240_10495513 3300009093 Bacteria 1359
82 Ga0105245_10383940 3300009098 Bacteria 1399
83 Ga0114129_10008026 3300009147 Bacteria 15035
84 Ga0105243_10002952 3300009148 Bacteria 14064
85 Ga0105243_10004882 3300009148 Bacteria 10523
86 Ga0105243_10012585 3300009148 Bacteria 6396
87 Ga0105243_10716764 3300009148 Bacteria 977
88 Ga0105243_11045638 3300009148 Bacteria 822
89 Ga0105248_10866269 3300009177 Bacteria 1020
90 Ga0105237_10105794 3300009545 Bacteria 2805
91 Ga0105237_10293515 3300009545 Bacteria 1628
92 Ga0105237_10535650 3300009545 Bacteria 1178
93 Ga0105238_10063704 3300009551 Bacteria 3687
94 Ga0105238_10182838 3300009551 Bacteria 2073
95 Ga0105249_10201597 3300009553 Bacteria 1947
96 Ga0105239_10006672 3300010375 Bacteria 13334
97 Ga0105239_10036950 3300010375 Bacteria 5358
98 Ga0105239_10427887 3300010375 Bacteria 1500
99 Ga0105246_10143076 3300011119 Bacteria 1801
100 Ga0105246_10432096 3300011119 Bacteria 1102
101 Ga0157373_10351397 3300013100 Bacteria 1052
102 Ga0157371_10084415 3300013102 Bacteria 2250
103 Ga0157370_10003589 3300013104 Bacteria 18150
104 Ga0157370_10011155 3300013104 Bacteria 9418
105 Ga0157370_10200945 3300013104 Bacteria 1849
106 Ga0157369_10026307 3300013105 Bacteria 6456
107 Ga0157369_10105203 3300013105 Bacteria 3005
108 Ga0157369_10562854 3300013105 Bacteria 1178
109 Ga0157378_10251415 3300013297 Bacteria 1692
110 Ga0157372_10189287 3300013307 Bacteria 2383
111 Ga0157372_10363692 3300013307 Bacteria 1686
112 Ga0157375_10635829 3300013308 Bacteria 1224
113 Ga0157380_10515985 3300014326 Bacteria 1164
114 Ga0182008_10000566 3300014497 Bacteria 27335
115 Ga0182008_10009747 3300014497 Bacteria 5170
116 Ga0182008_10018023 3300014497 Bacteria 3657
117 Ga0182008_10238445 3300014497 Bacteria 935
118 Ga0157376_10992181 3300014969 Bacteria 862
119 Ga0182006_1001767 3300015261 Bacteria 12532
120 Ga0206356_10390864 3300020070 Bacteria 777
121 Ga0209436_110267 3300025208 Bacteria 1722
122 Ga0209674_100024 3300025226 Bacteria 535481
123 Ga0209147_100657 3300025229 Bacteria 17942
124 Ga0209563_100069 3300025230 Bacteria 253154
125 Ga0209258_100015 3300025242 Bacteria 706310
126 Ga0209258_100071 3300025242 Bacteria 278319
127 Ga0207425_1000229 3300025245 Bacteria 43700
128 Ga0209646_1000012 3300025246 Bacteria 573300
129 Ga0209026_1000004 3300025250 Bacteria 949012
130 Ga0209677_100092 3300025253 Bacteria 102482
131 Ga0209677_100983 3300025253 Bacteria 13758
132 Ga0209677_102787 3300025253 Bacteria 6198
133 Ga0209148_1000028 3300025254 Bacteria 582773
134 Ga0209759_1000003 3300025256 Bacteria 792130
135 Ga0209759_1000936 3300025256 Bacteria 21031
136 Ga0209759_1005202 3300025256 Bacteria 4626
137 Ga0209129_1000049 3300025258 Bacteria 268086
138 Ga0209565_1002407 3300025263 Bacteria 6774
139 Ga0209565_1003093 3300025263 Bacteria 5583
140 Ga0209455_1000030 3300025272 Bacteria 533479
141 Ga0209130_1000966 3300025284 Bacteria 22644
142 Ga0209130_1001110 3300025284 Bacteria 19819
143 Ga0209130_1001905 3300025284 Bacteria 11776
144 Ga0209675_1002160 3300025291 Bacteria 10362
145 Ga0209675_1011140 3300025291 Bacteria 3002
146 Ga0209676_1000074 3300025292 Bacteria 305770
147 Ga0209676_1000209 3300025292 Bacteria 130388
148 Ga0209676_1003151 3300025292 Bacteria 10532
149 Ga0209676_1049158 3300025292 Bacteria 1121
150 Ga0209025_1001092 3300025294 Bacteria 39204
151 Ga0209025_1099258 3300025294 Bacteria 927
152 Ga0209758_1000496 3300025297 Bacteria 64085
153 Ga0209758_1030017 3300025297 Bacteria 2259
154 Ga0209050_1000015 3300025298 Bacteria 759102
155 Ga0209050_1044436 3300025298 Bacteria 1188
156 Ga0209256_1000264 3300025299 Bacteria 92750
157 Ga0209256_1000304 3300025299 Bacteria 85971
158 Ga0207426_1000108 3300025302 Bacteria 242257
159 Ga0207426_1000130 3300025302 Bacteria 210271
160 Ga0209051_1000010 3300025303 Bacteria 641298
161 Ga0209051_1000156 3300025303 Bacteria 128246
162 Ga0209051_1012147 3300025303 Bacteria 4182
163 Ga0209257_1000026 3300025304 Bacteria 723225
164 Ga0209257_1031533 3300025304 Bacteria 1694
165 Ga0209257_1032143 3300025304 Bacteria 1668
166 Ga0207656_10006260 3300025321 Bacteria 4263
167 Ga0207655_1109155 3300025728 Bacteria 938
168 Ga0207645_10191824 3300025907 Bacteria 1343
169 Ga0207705_10076203 3300025909 Bacteria 2438
170 Ga0207705_10305002 3300025909 Bacteria 1222
171 Ga0207654_10275042 3300025911 Bacteria 1137
172 Ga0207695_10043744 3300025913 Bacteria 4770
173 Ga0207695_10137288 3300025913 Bacteria 2397
174 Ga0207671_10083155 3300025914 Bacteria 2403
175 Ga0207657_10021972 3300025919 Bacteria 5991
176 Ga0207657_10253633 3300025919 Bacteria 1402
177 Ga0207649_10171517 3300025920 Bacteria 1512
178 Ga0207681_10221598 3300025923 Bacteria 1464
179 Ga0207687_10067986 3300025927 Bacteria 2536
180 Ga0207687_10148237 3300025927 Bacteria 1787
181 Ga0207690_10066367 3300025932 Bacteria 2471
182 Ga0207690_10085872 3300025932 Bacteria 2210
183 Ga0207709_10000433 3300025935 Bacteria 39614
184 Ga0207709_10001930 3300025935 Bacteria 13624
185 Ga0207709_10003041 3300025935 Bacteria 10171
186 Ga0207679_10173670 3300025945 Bacteria 1776
187 Ga0207667_10025674 3300025949 Bacteria 6446
188 Ga0207667_10034440 3300025949 Bacteria 5437
189 Ga0207651_10002599 3300025960 Bacteria 8636
190 Ga0207640_10010498 3300025981 Bacteria 5218
191 Ga0207640_10160220 3300025981 Bacteria 1664
192 Ga0207678_10138712 3300026067 Bacteria 2075
193 Ga0207702_10000189 3300026078 Bacteria 74204
194 Ga0207702_10110979 3300026078 Bacteria 2438
195 Ga0207648_10196040 3300026089 Bacteria 1791
196 Ga0207648_11083452 3300026089 Bacteria 751
197 Ga0207674_10006937 3300026116 Bacteria 13267
198 Ga0207674_10043968 3300026116 Bacteria 4604
199 Ga0207674_10050303 3300026116 Bacteria 4258
200 Ga0207675_100474516 3300026118 Bacteria 1242
201 Ga0207683_10089896 3300026121 Bacteria 2734
202 Ga0207698_10160047 3300026142 Bacteria 1968
203 Ga0207698_10184781 3300026142 Bacteria 1851
204 Ga0209281_1000017 3300027111 Bacteria 583251
205 Ga0268266_10103680 3300028379 Bacteria 2510
206 Ga0268265_11007996 3300028380 Bacteria 823
207 Ga0307511_10206251 3300030521 Bacteria 1011
208 Ga0265332_10000006 3300031238 Bacteria 327963
209 Ga0307516_10002796 3300031730 Bacteria 23020
210 Ga0307405_10017518 3300031731 Bacteria 3932
211 Ga0307412_10046374 3300031911 Bacteria 2847
212 Ga0307416_100130916 3300032002 Bacteria 2258
213 Ga0307416_100351119 3300032002 Bacteria 1492
214 Ga0373934_0040084 3300035086 Bacteria 1847
215 Ga0373923_0057157 3300035111 Bacteria 1649
216 Ga0373931_0109468 3300035691 Bacteria 1565
217 Ga0373931_0168176 3300035691 Bacteria 1290
218 Ga0395899_0005550 3300037312 Bacteria 9773
219 Ga0395899_0036014 3300037312 Bacteria 3714
220 Ga0395899_0124725 3300037312 Bacteria 1842
221 Ga0395900_0001993 3300037418 Bacteria 23054
222 Ga0395900_0169503 3300037418 Bacteria 2223
223 Ga0395898_0037709 3300037466 Bacteria 4793
224 Ga0395898_0047599 3300037466 Bacteria 4207
225 Ga0395898_0125356 3300037466 Bacteria 2460
226 Ga0395905_0443731 3300037471 Bacteria 1195
227 Ga0395901_0024450 3300038443 Bacteria 6200
228 Ga0395901_0052984 3300038443 Bacteria 4216
229 Ga0395901_0196634 3300038443 Bacteria 2114
230 Ga0439447_024103 3300041407 Bacteria 1579
231 Ga0451789_0898372 3300041443 Bacteria 984
232 Ga0451793_1301558 3300041452 Bacteria 959
233 Ga0451802_1176912 3300041460 Bacteria 1007
234 Ga0450911_000642 3300042115 Bacteria 10478
235 Ga0466969_0018469 3300044656 Bacteria 3631
236 Ga0453683_0007877 3300044673 Bacteria 7187
237 Ga0466965_0001063 3300044683 Bacteria 10654
238 Ga0466966_0001186 3300044684 Bacteria 16728
239 Ga0466961_0062784 3300044693 Bacteria 2360
240 Ga0466963_0297710 3300044694 Bacteria 1134
241 Ga0466964_0020780 3300044706 Bacteria 2531
242 Ga0453684_0028691 3300044712 Bacteria 7928
243 Ga0466971_0011337 3300044719 Bacteria 3903
244 Ga0466959_0009705 3300045049 Bacteria 6853
245 Ga0451576_0052842 3300045051 Bacteria 4257
246 Ga0451576_0073135 3300045051 Bacteria 3567
247 Ga0451576_0124166 3300045051 Bacteria 2689
248 Ga0451576_0299062 3300045051 Bacteria 1683
249 Ga0466967_0035459 3300045976 Bacteria 4247
250 Ga0466967_0197986 3300045976 Bacteria 1901
251 Ga0466967_0304326 3300045976 Bacteria 1534
252 Ga0495627_040792 3300046453 Bacteria 1428
253 Ga0495651_0215261 3300046462 Bacteria 1334
254 Ga0495650_0009608 3300046471 Bacteria 5484
255 Ga0495639_0050100 3300046475 Bacteria 1896
256 Ga0495583_0000018 3300046506 Bacteria 306541
257 Ga0495606_0000863 3300046507 Bacteria 45411
258 Ga0495608_0237388 3300046511 Bacteria 1140
259 Ga0495616_0001315 3300046513 Bacteria 17340
260 Ga0495620_0075496 3300046515 Bacteria 1371
261 Ga0495631_0000382 3300046518 Bacteria 30522
262 Ga0495637_0153283 3300046520 Bacteria 868
263 Ga0495652_0231996 3300046529 Bacteria 1380
264 Ga0495654_0002882 3300046530 Bacteria 10795
265 Ga0495621_0058364 3300046539 Bacteria 1396
266 Ga0495597_0001209 3300046542 Bacteria 19263
267 Ga0495656_0002017 3300046615 Bacteria 6684
268 Ga0495625_0007320 3300046660 Bacteria 9641
269 Ga0495625_0054013 3300046660 Bacteria 2870
270 Ga0495669_0071686 3300046684 Bacteria 1580
271 Ga0495649_0000051 3300046694 Bacteria 109180
272 Ga0495589_0041835 3300046794 Bacteria 2285
273 Ga0495676_0131225 3300047321 Bacteria 1808
274 Ga0495677_0115228 3300047445 Bacteria 1023
275 Ga0495686_0029102 3300047472 Bacteria 3595
276 Ga0495686_0043800 3300047472 Bacteria 2835
277 Ga0495593_0023928 3300047673 Bacteria 3389
278 Ga0496101_0008123 3300048904 Bacteria 6847
279 Ga0496101_0623037 3300048904 Bacteria 853
280 Ga0496103_0083494 3300048906 Bacteria 2011
281 Ga0496114_0280969 3300048917 Bacteria 1468
282 Ga0496115_0004913 3300048918 Bacteria 9706
283 Ga0496116_0092763 3300048919 Bacteria 1830
284 Ga0496117_0084053 3300048920 Bacteria 2078
285 Ga0496118_0006742 3300048921 Bacteria 12503
286 Ga0496121_0009318 3300048924 Bacteria 11323
287 Ga0496122_0052835 3300048925 Bacteria 3070
288 Ga0496122_0184973 3300048925 Bacteria 1237
289 Ga0496122_0209629 3300048925 Bacteria 1130
290 Ga0496123_0060348 3300048926 Bacteria 2446
291 Ga0496123_0079355 3300048926 Bacteria 2006
292 Ga0496123_0140462 3300048926 Bacteria 1321
293 Ga0496124_0041291 3300048927 Bacteria 3982
294 Ga0496124_0101485 3300048927 Bacteria 2331
295 Ga0496124_0286396 3300048927 Bacteria 1198
296 Ga0496125_0008173 3300048928 Bacteria 11015
297 Ga0496125_0023700 3300048928 Bacteria 5659
298 Ga0496125_0033468 3300048928 Bacteria 4548
299 Ga0496125_0099203 3300048928 Bacteria 2152
300 Ga0496125_0171267 3300048928 Bacteria 1459
301 Ga0496125_0373031 3300048928 Bacteria 844
302 Ga0496126_0000033 3300048929 Bacteria 368851
303 Ga0496126_0252325 3300048929 Bacteria 1470
304 Ga0501033_0008383 3300049570 Bacteria 8005
305 Ga0501034_0057592 3300049571 Bacteria 3907
306 Ga0501034_0289201 3300049571 Bacteria 1577
307 Ga0501037_0355139 3300049573 Bacteria 1010
308 Ga0501047_0799579 3300049581 Bacteria 758
309 Ga0501070_0603550 3300049586 Bacteria 875
310 Ga0501266_000204 3300049763 Bacteria 7689
311 Ga0501035_0466745 3300049822 Bacteria 1043
312 Ga0501044_0967111 3300049823 Bacteria 724
313 nmdc:mga03683_15081_c1 3300050489 Bacteria 2876
314 nmdc:mga03683_373439_c1 3300050489 Bacteria 678
315 nmdc:mga03n38_401082_c1 3300050490 Bacteria 755
316 nmdc:mga00v17_145636_c1 3300050491 Bacteria 1520
317 nmdc:mga0k408_31758_c1 3300050493 Bacteria 3017
318 nmdc:mga07m45_184197_c1 3300050496 Bacteria 1214
319 nmdc:mga05p37_96942_c2 3300050507 Bacteria 2020
320 Ga0500635_0000217 3300053080 Bacteria 26831
321 Ga0500643_103068 3300053087 Bacteria 773
322 Ga0500651_0000093 3300053093 Bacteria 55843
323 Ga0500571_000456 3300053110 Bacteria 16458
324 Ga0500572_038476 3300053111 Bacteria 1376
325 Ga0500572_127179 3300053111 Bacteria 827
326 Ga0500594_0003157 3300053118 Bacteria 3605
327 Ga0500595_107665 3300053119 Bacteria 795
328 Ga0500607_073089 3300053121 Bacteria 1766
329 Ga0500618_033095 3300053125 Bacteria 1207
330 Ga0500626_140930 3300053128 Bacteria 1012
331 Ga0500655_034734 3300053133 Bacteria 978
332 Ga0500564_092573 3300053138 Bacteria 1344
333 Ga0500568_0009844 3300053139 Bacteria 4516
334 Ga0500604_0081107 3300053151 Bacteria 1048
335 Ga0500619_000184 3300053154 Bacteria 14772
336 Ga0500624_008237 3300053157 Bacteria 1456
337 Ga0500634_0172497 3300053161 Bacteria 984
338 Ga0500638_006114 3300053162 Bacteria 4889
339 Ga0500636_0008269 3300053177 Bacteria 6036
340 Ga0500636_0219947 3300053177 Bacteria 990
341 Ga0500552_000318 3300053733 Bacteria 4407
342 Ga0500565_012555 3300053734 Bacteria 903
343 2904481885 2904479285 Bacteria 5073931
344 2599621823 2599185214 Bacteria 8209958
345 2599670493 2599185226 Bacteria 8233575
346 2599678983 2599185227 Bacteria 8246414
347 2599691334 2599185229 Bacteria 8216126
348 2644466499 2643221683 Bacteria 5749203
349 2722881723 2721755523 Bacteria 6430384
350 2738721885 2738541277 Bacteria 7458140
351 2738882061 2738541307 Bacteria 8606193
352 2739251967 2738543013 Bacteria 5618633
353 2739282249 2738543019 Bacteria 7459457
354 2819597990 2818991446 Bacteria 7757362
355 2831268982 2831265667 Bacteria 7184833
356 2838058408 2838054893 Bacteria 7451788
357 2839143431 2839138175 Bacteria 6549354
358 2842718926 2842718218 Bacteria 4560148
359 2857467165 2857465823 Bacteria 6772595
360 2857476355 2857472729 Bacteria 6568124
361 2857591948 2857591370 Bacteria 6569758
362 2885203851 2885198086 Bacteria 7212419
363 2885217814 2885211737 Bacteria 7212420
364 2894023852 2894023352 Bacteria 5167372
365 2899929409 2899924645 Bacteria 7487985
366 2909042966 2909042592 Bacteria 6499737
367 2915607552 2915606848 Bacteria 6032732
368 2928040147 2928037797 Bacteria 7273642
369 2928047104 2928044640 Bacteria 7271509
370 2928057692 2928051484 Bacteria 7773759
371 2928067925 2928064002 Bacteria 7419480
372 2928072491 2928070936 Bacteria 8062541
373 2928085688 2928084124 Bacteria 7159212
374 2928115430 2928115317 Bacteria 6477646
375 2945990113 2945984333 Bacteria 7358892
376 2974320218 2974320154 Bacteria 4571377
377 3001270981 3001267043 Bacteria 4823521
378 3001276590 3001272096 Bacteria 4729684
379 JGI24740J21852_10005403
380 JGI25156J39149_1014513
381 JGI25154J39366_1000653
382 JGI25157J39369_1000045
383 JGI25150J39212_1001446
384 JGI25406J46586_10030045
385 rootH1_10010099
386 rootH2_10003406
387 rootH2_10123470
388 rootH1_10050453
389 JGI25160J50197_1032513
390 Ga0006562J51391_1094764
391 Ga0055539_1000277
392 Ga0055533_1000026
393 Ga0055525_1001182
394 Ga0055535_1000056
395 Ga0055535_1000522
396 Ga0055542_1000003
397 Ga0055529_1000165
398 Ga0055536_1001522
399 Ga0055536_1002089
400 Ga0055534_1003358
401 Ga0055534_1026891
402 Ga0055530_10000773
403 Ga0055540_1001603
404 Ga0055540_1020962
405 Ga0065704_10074797
406 Ga0065704_10228391
407 Ga0070658_10063217
408 Ga0070676_10166633
409 Ga0070683_100015508
410 Ga0070660_100030644
411 Ga0070689_100287642
412 Ga0070661_100042701
413 Ga0070661_100221435
414 Ga0070673_100002753
415 Ga0070673_100745345
416 Ga0070659_100135718
417 Ga0070659_100275252
418 Ga0070710_10135195
419 Ga0070708_100046726
420 Ga0070678_100163895
421 Ga0070662_100016695
422 Ga0068867_100228517
423 Ga0070698_100003981
424 Ga0070684_100042463
425 Ga0068853_100034356
426 Ga0070665_100002531
427 Ga0070665_100039521
428 Ga0068855_100043418
429 Ga0068855_100135535
430 Ga0068855_100276618
431 Ga0070664_100078272
432 Ga0070664_100150493
433 Ga0068857_100003768
434 Ga0068857_100033686
435 Ga0068857_100172372
436 Ga0068857_100629517
437 Ga0068854_100106673
438 Ga0068854_100144633
439 Ga0068856_100000820
440 Ga0068856_100104206
441 Ga0068852_100160065
442 Ga0068851_10006934
443 Ga0068863_100470121
444 Ga0081455_10014633
445 Ga0081455_10021483
446 Ga0075365_10039511
447 Ga0075365_10223906
448 Ga0075364_10024636
449 Ga0075362_10106410
450 Ga0097621_100545214
451 Ga0075370_10078613
452 Ga0075370_10158289
453 Ga0068871_101047880
454 Ga0079104_1000016
455 Ga0105240_10013955
456 Ga0105240_10049305
457 Ga0105240_10059662
458 Ga0105240_10164701
459 Ga0105240_10495513
460 Ga0105245_10383940
461 Ga0114129_10008026
462 Ga0105243_10002952
463 Ga0105243_10004882
464 Ga0105243_10012585
465 Ga0105243_10716764
466 Ga0105243_11045638
467 Ga0105248_10866269
468 Ga0105237_10105794
469 Ga0105237_10293515
470 Ga0105237_10535650
471 Ga0105238_10063704
472 Ga0105238_10182838
473 Ga0105249_10201597
474 Ga0105239_10006672
475 Ga0105239_10036950
476 Ga0105239_10427887
477 Ga0105246_10143076
478 Ga0105246_10432096
479 Ga0157373_10351397
480 Ga0157371_10084415
481 Ga0157370_10003589
482 Ga0157370_10011155
483 Ga0157370_10200945
484 Ga0157369_10026307
485 Ga0157369_10105203
486 Ga0157369_10562854
487 Ga0157378_10251415
488 Ga0157372_10189287
489 Ga0157372_10363692
490 Ga0157375_10635829
491 Ga0157380_10515985
492 Ga0182008_10000566
493 Ga0182008_10009747
494 Ga0182008_10018023
495 Ga0182008_10238445
496 Ga0157376_10992181
497 Ga0182006_1001767
498 Ga0206356_10390864
499 Ga0209436_110267
500 Ga0209674_100024
501 Ga0209147_100657
502 Ga0209563_100069
503 Ga0209258_100015
504 Ga0209258_100071
505 Ga0207425_1000229
506 Ga0209646_1000012
507 Ga0209026_1000004
508 Ga0209677_100092
509 Ga0209677_100983
510 Ga0209677_102787
511 Ga0209148_1000028
512 Ga0209759_1000003
513 Ga0209759_1000936
514 Ga0209759_1005202
515 Ga0209129_1000049
516 Ga0209565_1002407
517 Ga0209565_1003093
518 Ga0209455_1000030
519 Ga0209130_1000966
520 Ga0209130_1001110
521 Ga0209130_1001905
522 Ga0209675_1002160
523 Ga0209675_1011140
524 Ga0209676_1000074
525 Ga0209676_1000209
526 Ga0209676_1003151
527 Ga0209676_1049158
528 Ga0209025_1001092
529 Ga0209025_1099258
530 Ga0209758_1000496
531 Ga0209758_1030017
532 Ga0209050_1000015
533 Ga0209050_1044436
534 Ga0209256_1000264
535 Ga0209256_1000304
536 Ga0207426_1000108
537 Ga0207426_1000130
538 Ga0209051_1000010
539 Ga0209051_1000156
540 Ga0209051_1012147
541 Ga0209257_1000026
542 Ga0209257_1031533
543 Ga0209257_1032143
544 Ga0207656_10006260
545 Ga0207655_1109155
546 Ga0207645_10191824
547 Ga0207705_10076203
548 Ga0207705_10305002
549 Ga0207654_10275042
550 Ga0207695_10043744
551 Ga0207695_10137288
552 Ga0207671_10083155
553 Ga0207657_10021972
554 Ga0207657_10253633
555 Ga0207649_10171517
556 Ga0207681_10221598
557 Ga0207687_10067986
558 Ga0207687_10148237
559 Ga0207690_10066367
560 Ga0207690_10085872
561 Ga0207709_10000433
562 Ga0207709_10001930
563 Ga0207709_10003041
564 Ga0207679_10173670
565 Ga0207667_10025674
566 Ga0207667_10034440
567 Ga0207651_10002599
568 Ga0207640_10010498
569 Ga0207640_10160220
570 Ga0207678_10138712
571 Ga0207702_10000189
572 Ga0207702_10110979
573 Ga0207648_10196040
574 Ga0207648_11083452
575 Ga0207674_10006937
576 Ga0207674_10043968
577 Ga0207674_10050303
578 Ga0207675_100474516
579 Ga0207683_10089896
580 Ga0207698_10160047
581 Ga0207698_10184781
582 Ga0209281_1000017
583 Ga0268266_10103680
584 Ga0268265_11007996
585 Ga0307511_10206251
586 Ga0265332_10000006
587 Ga0307516_10002796
588 Ga0307405_10017518
589 Ga0307412_10046374
590 Ga0307416_100130916
591 Ga0307416_100351119
592 Ga0373934_0040084
593 Ga0373923_0057157
594 Ga0373931_0109468
595 Ga0373931_0168176
596 Ga0395899_0005550
597 Ga0395899_0036014
598 Ga0395899_0124725
599 Ga0395900_0001993
600 Ga0395900_0169503
601 Ga0395898_0037709
602 Ga0395898_0047599
603 Ga0395898_0125356
604 Ga0395905_0443731
605 Ga0395901_0024450
606 Ga0395901_0052984
607 Ga0395901_0196634
608 Ga0439447_024103
609 Ga0451789_0898372
610 Ga0451793_1301558
611 Ga0451802_1176912
612 Ga0450911_000642
613 Ga0466969_0018469
614 Ga0453683_0007877
615 Ga0466965_0001063
616 Ga0466966_0001186
617 Ga0466961_0062784
618 Ga0466963_0297710
619 Ga0466964_0020780
620 Ga0453684_0028691
621 Ga0466971_0011337
622 Ga0466959_0009705
623 Ga0451576_0052842
624 Ga0451576_0073135
625 Ga0451576_0124166
626 Ga0451576_0299062
627 Ga0466967_0035459
628 Ga0466967_0197986
629 Ga0466967_0304326
630 Ga0495627_040792
631 Ga0495651_0215261
632 Ga0495650_0009608
633 Ga0495639_0050100
634 Ga0495583_0000018
635 Ga0495606_0000863
636 Ga0495608_0237388
637 Ga0495616_0001315
638 Ga0495620_0075496
639 Ga0495631_0000382
640 Ga0495637_0153283
641 Ga0495652_0231996
642 Ga0495654_0002882
643 Ga0495621_0058364
644 Ga0495597_0001209
645 Ga0495656_0002017
646 Ga0495625_0007320
647 Ga0495625_0054013
648 Ga0495669_0071686
649 Ga0495649_0000051
650 Ga0495589_0041835
651 Ga0495676_0131225
652 Ga0495677_0115228
653 Ga0495686_0029102
654 Ga0495686_0043800
655 Ga0495593_0023928
656 Ga0496101_0008123
657 Ga0496101_0623037
658 Ga0496103_0083494
659 Ga0496114_0280969
660 Ga0496115_0004913
661 Ga0496116_0092763
662 Ga0496117_0084053
663 Ga0496118_0006742
664 Ga0496121_0009318
665 Ga0496122_0052835
666 Ga0496122_0184973
667 Ga0496122_0209629
668 Ga0496123_0060348
669 Ga0496123_0079355
670 Ga0496123_0140462
671 Ga0496124_0041291
672 Ga0496124_0101485
673 Ga0496124_0286396
674 Ga0496125_0008173
675 Ga0496125_0023700
676 Ga0496125_0033468
677 Ga0496125_0099203
678 Ga0496125_0171267
679 Ga0496125_0373031
680 Ga0496126_0000033
681 Ga0496126_0252325
682 Ga0501033_0008383
683 Ga0501034_0057592
684 Ga0501034_0289201
685 Ga0501037_0355139
686 Ga0501047_0799579
687 Ga0501070_0603550
688 Ga0501266_000204
689 Ga0501035_0466745
690 Ga0501044_0967111
691 nmdc:mga03683_15081_c1
692 nmdc:mga03683_373439_c1
693 nmdc:mga03n38_401082_c1
694 nmdc:mga00v17_145636_c1
695 nmdc:mga0k408_31758_c1
696 nmdc:mga07m45_184197_c1
697 nmdc:mga05p37_96942_c2
698 Ga0500635_0000217
699 Ga0500643_103068
700 Ga0500651_0000093
701 Ga0500571_000456
702 Ga0500572_038476
703 Ga0500572_127179
704 Ga0500594_0003157
705 Ga0500595_107665
706 Ga0500607_073089
707 Ga0500618_033095
708 Ga0500626_140930
709 Ga0500655_034734
710 Ga0500564_092573
711 Ga0500568_0009844
712 Ga0500604_0081107
713 Ga0500619_000184
714 Ga0500624_008237
715 Ga0500634_0172497
716 Ga0500638_006114
717 Ga0500636_0008269
718 Ga0500636_0219947
719 Ga0500552_000318
720 Ga0500565_012555
721 2904481885
722 2599621823
723 2599670493
724 2599678983
725 2599691334
726 2644466499
727 2722881723
728 2738721885
729 2738882061
730 2739251967
731 2739282249
732 2819597990
733 2831268982
734 2838058408
735 2839143431
736 2842718926
737 2857467165
738 2857476355
739 2857591948
740 2885203851
741 2885217814
742 2894023852
743 2899929409
744 2909042966
745 2915607552
746 2928040147
747 2928047104
748 2928057692
749 2928067925
750 2928072491
751 2928085688
752 2928115430
753 2945990113
754 2974320218
755 3001270981
756 3001276590

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01470

Peptidase_C15

Pyroglutamyl peptidase

53

239

0.94

PF01470

Peptidase_C15

Pyroglutamyl peptidase

11

50

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gxh-assembly1.cif.gz_C crystal structure of a pyrrolidone-carboxylate peptidase 1 (target id nysgrc-012831) from xenorhabdus bovienii ss-2004 0.9856 12 216
1aug-assembly1.cif.gz_D crystal structure of the pyroglutamyl peptidase i from bacillus amyloliquefaciens 0.9714 9 225
3lac-assembly1.cif.gz_A crystal structure of bacillus anthracis pyrrolidone-carboxylate peptidase, pcp 0.9668 11 220
3ro0-assembly1.cif.gz_D crystal structure of bacillus amyloliquefaciens pyroglutamyl peptidase i and terpyridine platinum(ii) 0.9665 11 223
1aug-assembly1.cif.gz_D crystal structure of the pyroglutamyl peptidase i from bacillus amyloliquefaciens 0.9624 9 225
ID Description Score Start End Superfamily
3lacB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9709 12 220 3.40.630.20
3lacB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9613 12 220 3.40.630.20
af_P9WIJ5_2_218_3.40.630.20 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9513 12 227 3.40.630.20
af_P9WIJ5_2_218_3.40.630.20 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9342 12 227 3.40.630.20
1iu8B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9257 12 216 3.40.630.20
ID Description Score Start End GO Terms
AF-A0A6L5EHE6-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9883 78 180 GO:0005829
GO:0006508
GO:0016920
AF-A0A826SCW1-F1-model_v4 deleted 0.982 81 152
AF-A0A3A1XEE5-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9812 78 216 GO:0005829
GO:0006508
GO:0016920
AF-J4WC63-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9809 12 217 GO:0005829
GO:0006508
GO:0016920
AF-C0QXM0-F1-model_v4 Pyrrolidone-carboxylate peptidase (EC 3.4.19.3) (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) 0.9807 12 217 GO:0005829
GO:0006508
GO:0016920

Map