F428228

General Info

Members Datasets Scaffolds Average Seq Length
379 161 758 194

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10000005|JGI24737J22298_1000000522
Length 234
Sequence LNREPRFDDYIEKAAPFAQPILKHVRERVHAVVPHVEEAMKWSAPGFTLDGKILLIMAAFKQHAALNFWRGQEIGDGEAKAGAMGQFGKLTSIDNLPPDDELDALIREAAELAKTAPAPRKTKHEXXXAPTLHPEFAAALAKVPKAKAALDGFPPGAQRDYFEWISEAKQDATRQKRISTAIEWLAEGKRRHWKYQNCXSASASSGYPVQSGSAPRLRXRTRNSRRSAWPADWR

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.85
Rhizosphere 98.15
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000005 3300001990 Bacteria 65241
2 JGI24747J21853_1011118 3300001978 Bacteria 908
3 JGI24740J21852_10001215 3300001979 Bacteria 11649
4 JGI24740J21852_10007755 3300001979 Bacteria 4337
5 JGI24740J21852_10039991 3300001979 Bacteria 1425
6 JGI24739J22299_10000084 3300001989 Bacteria 26964
7 JGI24739J22299_10006623 3300001989 Bacteria 4363
8 JGI24737J22298_10001034 3300001990 Bacteria 9851
9 JGI24745J21846_1003096 3300002073 Bacteria 1726
10 JGI24738J21930_10000170 3300002075 Bacteria 16595
11 Ga0070658_10005858 3300005327 Bacteria 9966
12 Ga0070658_10031304 3300005327 Bacteria 4272
13 Ga0070658_10031730 3300005327 Bacteria 4244
14 Ga0070676_10047706 3300005328 Bacteria 2502
15 Ga0070683_100002263 3300005329 Bacteria 15247
16 Ga0070683_100164383 3300005329 Bacteria 2106
17 Ga0070690_100041108 3300005330 Bacteria 2926
18 Ga0070690_100120653 3300005330 Bacteria 1759
19 Ga0070670_100004136 3300005331 Bacteria 12125
20 Ga0070670_100049007 3300005331 Bacteria 3634
21 Ga0070670_100215767 3300005331 Bacteria 1669
22 Ga0068869_100000003 3300005334 Bacteria 136262
23 Ga0070666_10001518 3300005335 Bacteria 14090
24 Ga0070666_10157419 3300005335 Bacteria 1587
25 Ga0070680_100070926 3300005336 Bacteria 2862
26 Ga0070682_100006410 3300005337 Bacteria 6610
27 Ga0068868_100210937 3300005338 Bacteria 1623
28 Ga0070660_100001342 3300005339 Bacteria 16720
29 Ga0070660_100018067 3300005339 Bacteria 5146
30 Ga0070660_100047663 3300005339 Bacteria 3289
31 Ga0070660_100078210 3300005339 Bacteria 2594
32 Ga0070660_100209659 3300005339 Unclassified 1581
33 Ga0070660_100605652 3300005339 Unclassified 916
34 Ga0070689_100007203 3300005340 Bacteria 7754
35 Ga0070661_100000079 3300005344 Bacteria 77180
36 Ga0070692_10013457 3300005345 Bacteria 3815
37 Ga0070668_100065623 3300005347 Bacteria 2816
38 Ga0070669_100000381 3300005353 Bacteria 33945
39 Ga0070669_100113662 3300005353 Bacteria 2057
40 Ga0070669_100167290 3300005353 Bacteria 1712
41 Ga0070675_100063711 3300005354 Bacteria 3048
42 Ga0070675_100089518 3300005354 Bacteria 2577
43 Ga0070671_100013054 3300005355 Bacteria 6695
44 Ga0070671_100013403 3300005355 Bacteria 6609
45 Ga0070671_100016685 3300005355 Bacteria 5938
46 Ga0070671_100156502 3300005355 Bacteria 1925
47 Ga0070674_100143458 3300005356 Bacteria 1795
48 Ga0070673_100000077 3300005364 Bacteria 41919
49 Ga0070673_100132290 3300005364 Bacteria 2095
50 Ga0070673_100548267 3300005364 Unclassified 1050
51 Ga0070659_100000165 3300005366 Bacteria 51041
52 Ga0070659_100000220 3300005366 Bacteria 44199
53 Ga0070659_100114519 3300005366 Bacteria 2179
54 Ga0070659_100157334 3300005366 Unclassified 1856
55 Ga0070667_100001626 3300005367 Bacteria 20121
56 Ga0070667_100012545 3300005367 Bacteria 7008
57 Ga0070663_100008899 3300005455 Bacteria 6198
58 Ga0070663_100150305 3300005455 Bacteria 1785
59 Ga0070663_100302749 3300005455 Bacteria 1280
60 Ga0070678_100000975 3300005456 Bacteria 14782
61 Ga0070678_100052637 3300005456 Bacteria 2957
62 Ga0070662_100000171 3300005457 Bacteria 37981
63 Ga0070662_100000215 3300005457 Bacteria 33867
64 Ga0070662_100017840 3300005457 Bacteria 4789
65 Ga0070662_100020997 3300005457 Bacteria 4454
66 Ga0070662_100093167 3300005457 Bacteria 2266
67 Ga0070681_10296915 3300005458 Unclassified 1525
68 Ga0070681_10335294 3300005458 Bacteria 1422
69 Ga0068867_100000115 3300005459 Bacteria 50713
70 Ga0068867_100072495 3300005459 Bacteria 2578
71 Ga0068867_100651466 3300005459 Bacteria 924
72 Ga0070679_100419572 3300005530 Bacteria 1283
73 Ga0068853_100000316 3300005539 Bacteria 33719
74 Ga0068853_100009057 3300005539 Bacteria 8015
75 Ga0070672_100000336 3300005543 Bacteria 26949
76 Ga0070672_100189799 3300005543 Bacteria 1715
77 Ga0070693_100000563 3300005547 Bacteria 16421
78 Ga0070665_100001642 3300005548 Bacteria 25770
79 Ga0070665_100042586 3300005548 Bacteria 4564
80 Ga0070665_100049452 3300005548 Bacteria 4218
81 Ga0070665_100562710 3300005548 Unclassified 1153
82 Ga0068855_100000447 3300005563 Bacteria 51000
83 Ga0068855_100003513 3300005563 Bacteria 19177
84 Ga0068855_100147510 3300005563 Unclassified 2677
85 Ga0068855_100292843 3300005563 Bacteria 1804
86 Ga0070664_100000311 3300005564 Bacteria 35468
87 Ga0070664_100033363 3300005564 Bacteria 4312
88 Ga0070664_100049662 3300005564 Bacteria 3548
89 Ga0070664_100686052 3300005564 Bacteria 953
90 Ga0068857_100000026 3300005577 Bacteria 83525
91 Ga0068857_100146195 3300005577 Bacteria 2139
92 Ga0068857_100490531 3300005577 Bacteria 1152
93 Ga0068854_100000320 3300005578 Bacteria 31598
94 Ga0068854_100013639 3300005578 Bacteria 5341
95 Ga0068854_100562333 3300005578 Bacteria 969
96 Ga0068856_100000979 3300005614 Bacteria 30480
97 Ga0068856_100364911 3300005614 Bacteria 1463
98 Ga0068856_100385709 3300005614 Bacteria 1421
99 Ga0068852_100003556 3300005616 Bacteria 10908
100 Ga0068852_100004133 3300005616 Bacteria 10220
101 Ga0068852_100060939 3300005616 Bacteria 3277
102 Ga0068852_100214487 3300005616 Bacteria 1828
103 Ga0068852_100223658 3300005616 Bacteria 1791
104 Ga0068864_100000047 3300005618 Bacteria 150798
105 Ga0068864_100047157 3300005618 Bacteria 3700
106 Ga0068864_100305204 3300005618 Bacteria 1491
107 Ga0068861_100086293 3300005719 Bacteria 2467
108 Ga0068851_10022859 3300005834 Bacteria 3051
109 Ga0068851_10137886 3300005834 Bacteria 1324
110 Ga0068863_100000484 3300005841 Bacteria 40697
111 Ga0068863_100107580 3300005841 Bacteria 2654
112 Ga0068863_100424657 3300005841 Bacteria 1302
113 Ga0068863_101112960 3300005841 Bacteria 794
114 Ga0068858_100003246 3300005842 Bacteria 16210
115 Ga0068858_100035111 3300005842 Bacteria 4650
116 Ga0068860_100005960 3300005843 Bacteria 12260
117 Ga0068862_100185518 3300005844 Bacteria 1869
118 Ga0068862_100649312 3300005844 Bacteria 1018
119 Ga0097621_100060001 3300006237 Bacteria 3116
120 Ga0068871_100015720 3300006358 Bacteria 5677
121 Ga0068865_100001643 3300006881 Bacteria 13102
122 Ga0068865_100079798 3300006881 Bacteria 2345
123 Ga0105245_10000062 3300009098 Bacteria 115179
124 Ga0105243_10616774 3300009148 Bacteria 1046
125 Ga0105241_10015388 3300009174 Bacteria 5602
126 Ga0105241_10023854 3300009174 Bacteria 4539
127 Ga0105248_10000117 3300009177 Bacteria 90169
128 Ga0105248_10003791 3300009177 Bacteria 16748
129 Ga0105248_10452904 3300009177 Bacteria 1446
130 Ga0105238_10022775 3300009551 Bacteria 6385
131 Ga0105238_10067883 3300009551 Bacteria 3567
132 Ga0105239_10122624 3300010375 Bacteria 2888
133 Ga0105239_10569724 3300010375 Bacteria 1290
134 Ga0105246_10017038 3300011119 Bacteria 4614
135 Ga0157373_10007219 3300013100 Bacteria 8286
136 Ga0157373_10098768 3300013100 Bacteria 2055
137 Ga0157373_10172649 3300013100 Bacteria 1521
138 Ga0157373_10285372 3300013100 Unclassified 1170
139 Ga0157373_10305559 3300013100 Bacteria 1129
140 Ga0157373_10487945 3300013100 Bacteria 889
141 Ga0157373_10814648 3300013100 Bacteria 689
142 Ga0157371_10000144 3300013102 Bacteria 103512
143 Ga0157371_10007113 3300013102 Bacteria 9092
144 Ga0157371_10028626 3300013102 Bacteria 4032
145 Ga0157371_10092570 3300013102 Bacteria 2142
146 Ga0157371_10095324 3300013102 Bacteria 2109
147 Ga0157371_10137225 3300013102 Bacteria 1742
148 Ga0157370_10016501 3300013104 Bacteria 7472
149 Ga0157370_10110570 3300013104 Unclassified 2569
150 Ga0157370_10759894 3300013104 Bacteria 883
151 Ga0157369_10075205 3300013105 Bacteria 3622
152 Ga0157369_10130902 3300013105 Bacteria 2659
153 Ga0157369_10803045 3300013105 Unclassified 967
154 Ga0157374_10088143 3300013296 Bacteria 2955
155 Ga0157378_10002137 3300013297 Bacteria 17555
156 Ga0163162_10106846 3300013306 Bacteria 2894
157 Ga0157372_10116014 3300013307 Bacteria 3070
158 Ga0157372_10670432 3300013307 Bacteria 1207
159 Ga0157375_10191946 3300013308 Bacteria 2197
160 Ga0157375_10324296 3300013308 Bacteria 1705
161 Ga0163163_10000380 3300014325 Bacteria 42243
162 Ga0206353_10684851 3300020082 Bacteria 1817
163 Ga0207697_10000328 3300025315 Bacteria 26559
164 Ga0207656_10069076 3300025321 Bacteria 1567
165 Ga0207682_10014912 3300025893 Bacteria 3026
166 Ga0207682_10027252 3300025893 Bacteria 2274
167 Ga0207682_10123193 3300025893 Bacteria 1151
168 Ga0207688_10000019 3300025901 Bacteria 51361
169 Ga0207680_10018140 3300025903 Bacteria 3734
170 Ga0207680_10046653 3300025903 Bacteria 2562
171 Ga0207680_10177217 3300025903 Bacteria 1439
172 Ga0207647_10000822 3300025904 Bacteria 24109
173 Ga0207647_10028522 3300025904 Bacteria 3623
174 Ga0207645_10052730 3300025907 Bacteria 2599
175 Ga0207705_10000222 3300025909 Bacteria 56707
176 Ga0207705_10023703 3300025909 Bacteria 4379
177 Ga0207705_10151255 3300025909 Bacteria 1739
178 Ga0207705_10258489 3300025909 Bacteria 1329
179 Ga0207654_10019595 3300025911 Bacteria 3574
180 Ga0207654_10026755 3300025911 Bacteria 3127
181 Ga0207707_10086271 3300025912 Bacteria 2743
182 Ga0207693_10132074 3300025915 Bacteria 1963
183 Ga0207660_10160822 3300025917 Bacteria 1732
184 Ga0207657_10000378 3300025919 Bacteria 47118
185 Ga0207657_10002521 3300025919 Bacteria 19807
186 Ga0207657_10004541 3300025919 Bacteria 14664
187 Ga0207657_10029706 3300025919 Bacteria 4971
188 Ga0207657_10057870 3300025919 Bacteria 3339
189 Ga0207657_10597725 3300025919 Unclassified 861
190 Ga0207649_10000135 3300025920 Bacteria 63197
191 Ga0207649_10131194 3300025920 Bacteria 1702
192 Ga0207649_10666168 3300025920 Unclassified 805
193 Ga0207652_10094886 3300025921 Bacteria 2627
194 Ga0207652_10159332 3300025921 Bacteria 2023
195 Ga0207652_10827232 3300025921 Bacteria 821
196 Ga0207681_10000489 3300025923 Bacteria 27719
197 Ga0207681_10212421 3300025923 Bacteria 1492
198 Ga0207694_10154558 3300025924 Bacteria 1850
199 Ga0207650_10004793 3300025925 Bacteria 9244
200 Ga0207650_10014807 3300025925 Bacteria 5423
201 Ga0207650_10063243 3300025925 Bacteria 2767
202 Ga0207650_10153103 3300025925 Bacteria 1821
203 Ga0207659_10114612 3300025926 Bacteria 2055
204 Ga0207659_10126240 3300025926 Bacteria 1968
205 Ga0207687_10000424 3300025927 Bacteria 28651
206 Ga0207664_10111340 3300025929 Bacteria 2277
207 Ga0207644_10000495 3300025931 Bacteria 25321
208 Ga0207644_10013887 3300025931 Bacteria 5380
209 Ga0207644_10014702 3300025931 Bacteria 5245
210 Ga0207690_10000509 3300025932 Bacteria 25193
211 Ga0207690_10184777 3300025932 Unclassified 1572
212 Ga0207690_10367743 3300025932 Bacteria 1140
213 Ga0207690_10467227 3300025932 Bacteria 1016
214 Ga0207690_10581764 3300025932 Bacteria 913
215 Ga0207706_10000020 3300025933 Bacteria 162063
216 Ga0207706_10000513 3300025933 Bacteria 41181
217 Ga0207706_10012530 3300025933 Bacteria 7723
218 Ga0207706_10018244 3300025933 Bacteria 6314
219 Ga0207706_10079434 3300025933 Bacteria 2885
220 Ga0207706_10276125 3300025933 Bacteria 1466
221 Ga0207686_10121474 3300025934 Bacteria 1779
222 Ga0207670_10281977 3300025936 Bacteria 1295
223 Ga0207669_10032659 3300025937 Bacteria 2926
224 Ga0207669_10250804 3300025937 Bacteria 1318
225 Ga0207669_10385522 3300025937 Bacteria 1093
226 Ga0207704_10093784 3300025938 Bacteria 1980
227 Ga0207691_10000047 3300025940 Bacteria 99519
228 Ga0207691_10055188 3300025940 Bacteria 3622
229 Ga0207691_10152262 3300025940 Unclassified 2033
230 Ga0207691_10211247 3300025940 Bacteria 1685
231 Ga0207711_10000558 3300025941 Bacteria 37953
232 Ga0207711_10007486 3300025941 Bacteria 9132
233 Ga0207689_10000002 3300025942 Bacteria 198437
234 Ga0207661_10017032 3300025944 Bacteria 5368
235 Ga0207679_10000460 3300025945 Bacteria 28726
236 Ga0207679_10308856 3300025945 Unclassified 1366
237 Ga0207679_10809783 3300025945 Bacteria 854
238 Ga0207667_10001204 3300025949 Bacteria 32354
239 Ga0207667_10099756 3300025949 Bacteria 2996
240 Ga0207667_10257859 3300025949 Bacteria 1783
241 Ga0207667_10434397 3300025949 Bacteria 1335
242 Ga0207667_10494856 3300025949 Bacteria 1240
243 Ga0207651_10000387 3300025960 Bacteria 18790
244 Ga0207651_10394098 3300025960 Bacteria 1176
245 Ga0207651_10681762 3300025960 Unclassified 904
246 Ga0207668_10043239 3300025972 Bacteria 3056
247 Ga0207668_10084211 3300025972 Bacteria 2316
248 Ga0207640_10006259 3300025981 Bacteria 6526
249 Ga0207640_10009697 3300025981 Bacteria 5400
250 Ga0207640_10437483 3300025981 Bacteria 1074
251 Ga0207658_10033797 3300025986 Bacteria 3649
252 Ga0207658_10228203 3300025986 Bacteria 1570
253 Ga0207658_10291518 3300025986 Bacteria 1402
254 Ga0207677_10002499 3300026023 Bacteria 9646
255 Ga0207677_10241191 3300026023 Bacteria 1462
256 Ga0207677_10691253 3300026023 Bacteria 904
257 Ga0207703_10028409 3300026035 Bacteria 4409
258 Ga0207703_10028423 3300026035 Bacteria 4408
259 Ga0207639_10011598 3300026041 Bacteria 6124
260 Ga0207639_10016940 3300026041 Bacteria 5163
261 Ga0207639_10793112 3300026041 Bacteria 882
262 Ga0207639_10919988 3300026041 Bacteria 818
263 Ga0207678_10000879 3300026067 Bacteria 27621
264 Ga0207678_10007682 3300026067 Bacteria 9524
265 Ga0207678_10193582 3300026067 Bacteria 1738
266 Ga0207678_10724498 3300026067 Bacteria 876
267 Ga0207702_10001066 3300026078 Bacteria 28071
268 Ga0207702_10238294 3300026078 Bacteria 1703
269 Ga0207641_10071176 3300026088 Bacteria 2990
270 Ga0207641_10151085 3300026088 Bacteria 2103
271 Ga0207641_10208672 3300026088 Bacteria 1805
272 Ga0207648_10002019 3300026089 Bacteria 22153
273 Ga0207648_10198872 3300026089 Bacteria 1777
274 Ga0207648_10230472 3300026089 Bacteria 1647
275 Ga0207648_10684878 3300026089 Bacteria 949
276 Ga0207676_10007306 3300026095 Bacteria 7832
277 Ga0207676_10511731 3300026095 Bacteria 1141
278 Ga0207674_10002120 3300026116 Bacteria 25085
279 Ga0207674_10003128 3300026116 Bacteria 20417
280 Ga0207674_10003428 3300026116 Bacteria 19410
281 Ga0207674_10253803 3300026116 Bacteria 1705
282 Ga0207674_10834885 3300026116 Bacteria 889
283 Ga0207683_10006670 3300026121 Bacteria 9877
284 Ga0207683_10230333 3300026121 Bacteria 1690
285 Ga0207698_10000675 3300026142 Bacteria 19796
286 Ga0207698_10009531 3300026142 Bacteria 6197
287 Ga0207698_10396186 3300026142 Bacteria 1318
288 Ga0268266_10000256 3300028379 Bacteria 89436
289 Ga0268266_10003320 3300028379 Bacteria 16145
290 Ga0268266_10021362 3300028379 Bacteria 5514
291 Ga0268266_10152938 3300028379 Bacteria 2081
292 Ga0268266_10600505 3300028379 Unclassified 1057
293 Ga0268265_10023775 3300028380 Bacteria 4325
294 Ga0268265_10165579 3300028380 Bacteria 1884
295 Ga0268264_10025243 3300028381 Bacteria 4854
296 Ga0307408_100148376 3300031548 Bacteria 1849
297 Ga0307408_100257847 3300031548 Bacteria 1441
298 Ga0307405_10009268 3300031731 Bacteria 5038
299 Ga0307405_10088429 3300031731 Bacteria 2044
300 Ga0307405_10219458 3300031731 Bacteria 1394
301 Ga0307405_10384894 3300031731 Bacteria 1093
302 Ga0307413_10004530 3300031824 Bacteria 6059
303 Ga0307413_10054404 3300031824 Bacteria 2428
304 Ga0307413_10057228 3300031824 Bacteria 2383
305 Ga0307413_10360112 3300031824 Bacteria 1126
306 Ga0307413_10683702 3300031824 Bacteria 850
307 Ga0307410_10000938 3300031852 Bacteria 12506
308 Ga0307410_10002679 3300031852 Bacteria 8686
309 Ga0307410_10002846 3300031852 Bacteria 8506
310 Ga0307410_10147973 3300031852 Bacteria 1745
311 Ga0307407_10097068 3300031903 Bacteria 1820
312 Ga0307407_10243185 3300031903 Bacteria 1229
313 Ga0307412_10010674 3300031911 Bacteria 5294
314 Ga0307412_10235242 3300031911 Bacteria 1413
315 Ga0307412_10877813 3300031911 Bacteria 784
316 Ga0307409_100007093 3300031995 Bacteria 6670
317 Ga0307416_100005058 3300032002 Bacteria 8040
318 Ga0307416_100014342 3300032002 Bacteria 5427
319 Ga0307416_100033005 3300032002 Bacteria 3919
320 Ga0307416_100284964 3300032002 Bacteria 1631
321 Ga0307416_100707588 3300032002 Bacteria 1097
322 Ga0307414_10003436 3300032004 Bacteria 8451
323 Ga0307414_10043418 3300032004 Bacteria 3062
324 Ga0307414_10044479 3300032004 Bacteria 3033
325 Ga0307414_10328111 3300032004 Bacteria 1305
326 Ga0307414_10720886 3300032004 Bacteria 904
327 Ga0307411_10004374 3300032005 Bacteria 6756
328 Ga0307411_10005073 3300032005 Bacteria 6412
329 Ga0307411_10012563 3300032005 Bacteria 4629
330 Ga0307411_10074098 3300032005 Bacteria 2318
331 Ga0307411_10245588 3300032005 Bacteria 1404
332 Ga0307411_10340164 3300032005 Bacteria 1219
333 Ga0307415_100002188 3300032126 Bacteria 9684
334 Ga0307415_100021786 3300032126 Bacteria 3946
335 Ga0307415_100690116 3300032126 Bacteria 920
336 Ga0373932_0038465 3300035112 Bacteria 1368
337 Ga0373939_0065775 3300035114 Bacteria 1167
338 Ga0373960_0026007 3300035121 Bacteria 1596
339 Ga0373961_0021422 3300035241 Bacteria 1719
340 Ga0373931_0074441 3300035691 Bacteria 1860
341 Ga0395899_0020913 3300037312 Bacteria 4963
342 Ga0395899_0145216 3300037312 Bacteria 1685
343 Ga0395900_0079384 3300037418 Bacteria 3372
344 Ga0395900_0681730 3300037418 Bacteria 962
345 Ga0395898_0289989 3300037466 Bacteria 1561
346 Ga0395898_1073532 3300037466 Bacteria 739
347 Ga0395905_0007559 3300037471 Bacteria 10797
348 Ga0395905_0011136 3300037471 Bacteria 8698
349 Ga0395905_0027784 3300037471 Bacteria 5334
350 Ga0395905_0029219 3300037471 Bacteria 5196
351 Ga0395905_0029856 3300037471 Bacteria 5138
352 Ga0395905_0080514 3300037471 Bacteria 3052
353 Ga0395905_0259250 3300037471 Bacteria 1623
354 Ga0395905_0284029 3300037471 Bacteria 1541
355 Ga0395901_0068752 3300038443 Bacteria 3689
356 Ga0395901_0140279 3300038443 Bacteria 2540
357 Ga0395901_0147162 3300038443 Bacteria 2476
358 Ga0395901_0331438 3300038443 Bacteria 1573
359 Ga0395901_0814850 3300038443 Bacteria 921
360 Ga0466963_0039408 3300044694 Bacteria 3093
361 Ga0466963_0455108 3300044694 Bacteria 903
362 Ga0466957_0085185 3300044842 Bacteria 1974
363 Ga0451576_0562714 3300045051 Bacteria 1198
364 Ga0466958_0026099 3300045836 Bacteria 3451
365 Ga0466958_0031466 3300045836 Bacteria 3154
366 Ga0466967_0348307 3300045976 Bacteria 1433
367 Ga0466967_0413607 3300045976 Bacteria 1313
368 Ga0495621_0014652 3300046539 Bacteria 2486
369 Ga0495668_0043278 3300046616 Bacteria 2505
370 Ga0496104_0286805 3300048907 Bacteria 1559
371 Ga0496107_0264473 3300048910 Bacteria 1280
372 Ga0496108_0000229 3300048911 Bacteria 50203
373 Ga0496108_0265819 3300048911 Bacteria 1493
374 Ga0496109_0025022 3300048912 Bacteria 5315
375 Ga0496110_0257031 3300048913 Bacteria 1590
376 Ga0496112_0002632 3300048915 Bacteria 14504
377 Ga0501067_0104872 3300049583 Bacteria 1571
378 Ga0501070_0308218 3300049586 Bacteria 1289
379 Ga0501071_0238856 3300049587 Bacteria 1370
380 JGI24737J22298_10000005
381 JGI24747J21853_1011118
382 JGI24740J21852_10001215
383 JGI24740J21852_10007755
384 JGI24740J21852_10039991
385 JGI24739J22299_10000084
386 JGI24739J22299_10006623
387 JGI24737J22298_10001034
388 JGI24745J21846_1003096
389 JGI24738J21930_10000170
390 Ga0070658_10005858
391 Ga0070658_10031304
392 Ga0070658_10031730
393 Ga0070676_10047706
394 Ga0070683_100002263
395 Ga0070683_100164383
396 Ga0070690_100041108
397 Ga0070690_100120653
398 Ga0070670_100004136
399 Ga0070670_100049007
400 Ga0070670_100215767
401 Ga0068869_100000003
402 Ga0070666_10001518
403 Ga0070666_10157419
404 Ga0070680_100070926
405 Ga0070682_100006410
406 Ga0068868_100210937
407 Ga0070660_100001342
408 Ga0070660_100018067
409 Ga0070660_100047663
410 Ga0070660_100078210
411 Ga0070660_100209659
412 Ga0070660_100605652
413 Ga0070689_100007203
414 Ga0070661_100000079
415 Ga0070692_10013457
416 Ga0070668_100065623
417 Ga0070669_100000381
418 Ga0070669_100113662
419 Ga0070669_100167290
420 Ga0070675_100063711
421 Ga0070675_100089518
422 Ga0070671_100013054
423 Ga0070671_100013403
424 Ga0070671_100016685
425 Ga0070671_100156502
426 Ga0070674_100143458
427 Ga0070673_100000077
428 Ga0070673_100132290
429 Ga0070673_100548267
430 Ga0070659_100000165
431 Ga0070659_100000220
432 Ga0070659_100114519
433 Ga0070659_100157334
434 Ga0070667_100001626
435 Ga0070667_100012545
436 Ga0070663_100008899
437 Ga0070663_100150305
438 Ga0070663_100302749
439 Ga0070678_100000975
440 Ga0070678_100052637
441 Ga0070662_100000171
442 Ga0070662_100000215
443 Ga0070662_100017840
444 Ga0070662_100020997
445 Ga0070662_100093167
446 Ga0070681_10296915
447 Ga0070681_10335294
448 Ga0068867_100000115
449 Ga0068867_100072495
450 Ga0068867_100651466
451 Ga0070679_100419572
452 Ga0068853_100000316
453 Ga0068853_100009057
454 Ga0070672_100000336
455 Ga0070672_100189799
456 Ga0070693_100000563
457 Ga0070665_100001642
458 Ga0070665_100042586
459 Ga0070665_100049452
460 Ga0070665_100562710
461 Ga0068855_100000447
462 Ga0068855_100003513
463 Ga0068855_100147510
464 Ga0068855_100292843
465 Ga0070664_100000311
466 Ga0070664_100033363
467 Ga0070664_100049662
468 Ga0070664_100686052
469 Ga0068857_100000026
470 Ga0068857_100146195
471 Ga0068857_100490531
472 Ga0068854_100000320
473 Ga0068854_100013639
474 Ga0068854_100562333
475 Ga0068856_100000979
476 Ga0068856_100364911
477 Ga0068856_100385709
478 Ga0068852_100003556
479 Ga0068852_100004133
480 Ga0068852_100060939
481 Ga0068852_100214487
482 Ga0068852_100223658
483 Ga0068864_100000047
484 Ga0068864_100047157
485 Ga0068864_100305204
486 Ga0068861_100086293
487 Ga0068851_10022859
488 Ga0068851_10137886
489 Ga0068863_100000484
490 Ga0068863_100107580
491 Ga0068863_100424657
492 Ga0068863_101112960
493 Ga0068858_100003246
494 Ga0068858_100035111
495 Ga0068860_100005960
496 Ga0068862_100185518
497 Ga0068862_100649312
498 Ga0097621_100060001
499 Ga0068871_100015720
500 Ga0068865_100001643
501 Ga0068865_100079798
502 Ga0105245_10000062
503 Ga0105243_10616774
504 Ga0105241_10015388
505 Ga0105241_10023854
506 Ga0105248_10000117
507 Ga0105248_10003791
508 Ga0105248_10452904
509 Ga0105238_10022775
510 Ga0105238_10067883
511 Ga0105239_10122624
512 Ga0105239_10569724
513 Ga0105246_10017038
514 Ga0157373_10007219
515 Ga0157373_10098768
516 Ga0157373_10172649
517 Ga0157373_10285372
518 Ga0157373_10305559
519 Ga0157373_10487945
520 Ga0157373_10814648
521 Ga0157371_10000144
522 Ga0157371_10007113
523 Ga0157371_10028626
524 Ga0157371_10092570
525 Ga0157371_10095324
526 Ga0157371_10137225
527 Ga0157370_10016501
528 Ga0157370_10110570
529 Ga0157370_10759894
530 Ga0157369_10075205
531 Ga0157369_10130902
532 Ga0157369_10803045
533 Ga0157374_10088143
534 Ga0157378_10002137
535 Ga0163162_10106846
536 Ga0157372_10116014
537 Ga0157372_10670432
538 Ga0157375_10191946
539 Ga0157375_10324296
540 Ga0163163_10000380
541 Ga0206353_10684851
542 Ga0207697_10000328
543 Ga0207656_10069076
544 Ga0207682_10014912
545 Ga0207682_10027252
546 Ga0207682_10123193
547 Ga0207688_10000019
548 Ga0207680_10018140
549 Ga0207680_10046653
550 Ga0207680_10177217
551 Ga0207647_10000822
552 Ga0207647_10028522
553 Ga0207645_10052730
554 Ga0207705_10000222
555 Ga0207705_10023703
556 Ga0207705_10151255
557 Ga0207705_10258489
558 Ga0207654_10019595
559 Ga0207654_10026755
560 Ga0207707_10086271
561 Ga0207693_10132074
562 Ga0207660_10160822
563 Ga0207657_10000378
564 Ga0207657_10002521
565 Ga0207657_10004541
566 Ga0207657_10029706
567 Ga0207657_10057870
568 Ga0207657_10597725
569 Ga0207649_10000135
570 Ga0207649_10131194
571 Ga0207649_10666168
572 Ga0207652_10094886
573 Ga0207652_10159332
574 Ga0207652_10827232
575 Ga0207681_10000489
576 Ga0207681_10212421
577 Ga0207694_10154558
578 Ga0207650_10004793
579 Ga0207650_10014807
580 Ga0207650_10063243
581 Ga0207650_10153103
582 Ga0207659_10114612
583 Ga0207659_10126240
584 Ga0207687_10000424
585 Ga0207664_10111340
586 Ga0207644_10000495
587 Ga0207644_10013887
588 Ga0207644_10014702
589 Ga0207690_10000509
590 Ga0207690_10184777
591 Ga0207690_10367743
592 Ga0207690_10467227
593 Ga0207690_10581764
594 Ga0207706_10000020
595 Ga0207706_10000513
596 Ga0207706_10012530
597 Ga0207706_10018244
598 Ga0207706_10079434
599 Ga0207706_10276125
600 Ga0207686_10121474
601 Ga0207670_10281977
602 Ga0207669_10032659
603 Ga0207669_10250804
604 Ga0207669_10385522
605 Ga0207704_10093784
606 Ga0207691_10000047
607 Ga0207691_10055188
608 Ga0207691_10152262
609 Ga0207691_10211247
610 Ga0207711_10000558
611 Ga0207711_10007486
612 Ga0207689_10000002
613 Ga0207661_10017032
614 Ga0207679_10000460
615 Ga0207679_10308856
616 Ga0207679_10809783
617 Ga0207667_10001204
618 Ga0207667_10099756
619 Ga0207667_10257859
620 Ga0207667_10434397
621 Ga0207667_10494856
622 Ga0207651_10000387
623 Ga0207651_10394098
624 Ga0207651_10681762
625 Ga0207668_10043239
626 Ga0207668_10084211
627 Ga0207640_10006259
628 Ga0207640_10009697
629 Ga0207640_10437483
630 Ga0207658_10033797
631 Ga0207658_10228203
632 Ga0207658_10291518
633 Ga0207677_10002499
634 Ga0207677_10241191
635 Ga0207677_10691253
636 Ga0207703_10028409
637 Ga0207703_10028423
638 Ga0207639_10011598
639 Ga0207639_10016940
640 Ga0207639_10793112
641 Ga0207639_10919988
642 Ga0207678_10000879
643 Ga0207678_10007682
644 Ga0207678_10193582
645 Ga0207678_10724498
646 Ga0207702_10001066
647 Ga0207702_10238294
648 Ga0207641_10071176
649 Ga0207641_10151085
650 Ga0207641_10208672
651 Ga0207648_10002019
652 Ga0207648_10198872
653 Ga0207648_10230472
654 Ga0207648_10684878
655 Ga0207676_10007306
656 Ga0207676_10511731
657 Ga0207674_10002120
658 Ga0207674_10003128
659 Ga0207674_10003428
660 Ga0207674_10253803
661 Ga0207674_10834885
662 Ga0207683_10006670
663 Ga0207683_10230333
664 Ga0207698_10000675
665 Ga0207698_10009531
666 Ga0207698_10396186
667 Ga0268266_10000256
668 Ga0268266_10003320
669 Ga0268266_10021362
670 Ga0268266_10152938
671 Ga0268266_10600505
672 Ga0268265_10023775
673 Ga0268265_10165579
674 Ga0268264_10025243
675 Ga0307408_100148376
676 Ga0307408_100257847
677 Ga0307405_10009268
678 Ga0307405_10088429
679 Ga0307405_10219458
680 Ga0307405_10384894
681 Ga0307413_10004530
682 Ga0307413_10054404
683 Ga0307413_10057228
684 Ga0307413_10360112
685 Ga0307413_10683702
686 Ga0307410_10000938
687 Ga0307410_10002679
688 Ga0307410_10002846
689 Ga0307410_10147973
690 Ga0307407_10097068
691 Ga0307407_10243185
692 Ga0307412_10010674
693 Ga0307412_10235242
694 Ga0307412_10877813
695 Ga0307409_100007093
696 Ga0307416_100005058
697 Ga0307416_100014342
698 Ga0307416_100033005
699 Ga0307416_100284964
700 Ga0307416_100707588
701 Ga0307414_10003436
702 Ga0307414_10043418
703 Ga0307414_10044479
704 Ga0307414_10328111
705 Ga0307414_10720886
706 Ga0307411_10004374
707 Ga0307411_10005073
708 Ga0307411_10012563
709 Ga0307411_10074098
710 Ga0307411_10245588
711 Ga0307411_10340164
712 Ga0307415_100002188
713 Ga0307415_100021786
714 Ga0307415_100690116
715 Ga0373932_0038465
716 Ga0373939_0065775
717 Ga0373960_0026007
718 Ga0373961_0021422
719 Ga0373931_0074441
720 Ga0395899_0020913
721 Ga0395899_0145216
722 Ga0395900_0079384
723 Ga0395900_0681730
724 Ga0395898_0289989
725 Ga0395898_1073532
726 Ga0395905_0007559
727 Ga0395905_0011136
728 Ga0395905_0027784
729 Ga0395905_0029219
730 Ga0395905_0029856
731 Ga0395905_0080514
732 Ga0395905_0259250
733 Ga0395905_0284029
734 Ga0395901_0068752
735 Ga0395901_0140279
736 Ga0395901_0147162
737 Ga0395901_0331438
738 Ga0395901_0814850
739 Ga0466963_0039408
740 Ga0466963_0455108
741 Ga0466957_0085185
742 Ga0451576_0562714
743 Ga0466958_0026099
744 Ga0466958_0031466
745 Ga0466967_0348307
746 Ga0466967_0413607
747 Ga0495621_0014652
748 Ga0495668_0043278
749 Ga0496104_0286805
750 Ga0496107_0264473
751 Ga0496108_0000229
752 Ga0496108_0265819
753 Ga0496109_0025022
754 Ga0496110_0257031
755 Ga0496112_0002632
756 Ga0501067_0104872
757 Ga0501070_0308218
758 Ga0501071_0238856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

129

188

0.97

PF08818

DUF1801

Domain of unknown function (DU1801)

18

110

0.91

PF18899

DUF5655

Domain of unknown function (DUF5655)

7

113

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7401 7 115
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7269 6 115
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6804 6 115
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6596 7 115
6oyc-assembly4.cif.gz_A glycosylation associate protein (gap123) complex from streptococcus agalactiae 0.5855 36 68
ID Description Score Start End Superfamily
2i8dB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7806 8 68 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7679 3 110 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7259 3 110 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7162 7 116 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6954 7 116 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A4Q4CJD5-F1-model_v4 DUF1801 domain-containing protein 0.9601 8 67
AF-A0A538AZV3-F1-model_v4 YdhG-like domain-containing protein 0.94 7 68
AF-A0A6I3DMJ4-F1-model_v4 deleted 0.9367 4 73
AF-A0A7C2RHI1-F1-model_v4 Bacteriocin-protection protein 0.9277 120 188
AF-A0A3D4IUR1-F1-model_v4 deleted 0.9275 8 70

Map