F428251

General Info

Members Datasets Scaffolds Average Seq Length
379 235 361 249

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10480217|Ga0070666_104802171
Length 246
Sequence MKPEILQARPEPAAVGAPAWDLAEFEAKLRERGRAYHIHHPYNVMLNGGRATREQVRGWVANRYYYQIAIPIKDAAILSNCPERELRREWVQRILDHDGHGDDPGGIEAWRQLGVAVGLTLDELSDLRHVVPGVRFAVDAYINFARHAPWQEAVCASLTELFAPKIHKERLATWPEHYPWIEPAGLQYFRNRVTQARRDVDQALAVTLDYFTTAEAQQRALGILQFKLDILWSMNDAMALHYGVSA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2738543013 Variovorax sp. BT01 Isolate Unclassified
9 2842677519 Variovorax sp. R-72495 Isolate Unclassified
10 2842747753 Variovorax sp. R-72060 Isolate Unclassified
11 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
12 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
13 2904456579 Variovorax sp. 2002 Isolate Unclassified
14 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
15 2929520902 Variovorax beijingensis 502 Isolate Unclassified
16 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
17 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
18 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
121 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
122 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
123 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
124 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
125 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
165 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
201 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
206 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
207 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
210 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.99
Metatranscriptomes 0.26
Isolates 4.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.34
Nodule 0.26
Rhizoplane 1.85
Rhizosphere 54.88
Stem 0
Stem Tuber 0
Unclassified 12.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003123 3300002773 Bacteria 5787
2 JGI25153J46596_10001363 3300003215 Bacteria 14608
3 JGI25153J46596_10002097 3300003215 Bacteria 11710
4 rootH1_10091958 3300003316 Bacteria 1345
5 Ga0006562J51391_1020741 3300003578 Bacteria 2060
6 Ga0055526_1002875 3300003771 Bacteria 11344
7 Ga0055537_1000031 3300003773 Bacteria 99208
8 Ga0055534_1000091 3300003784 Bacteria 71324
9 Ga0055534_1001347 3300003784 Bacteria 9868
10 Ga0055528_1000237 3300003790 Bacteria 46144
11 Ga0055530_10022384 3300003791 Bacteria 1840
12 Ga0065165_1000793 3300005262 Bacteria 42189
13 Ga0065704_10082290 3300005289 Bacteria 3624
14 Ga0070658_10668226 3300005327 Bacteria 901
15 Ga0070676_10003375 3300005328 Bacteria 8314
16 Ga0070676_10007342 3300005328 Bacteria 5912
17 Ga0070676_10168220 3300005328 Bacteria 1416
18 Ga0070670_100070004 3300005331 Bacteria 3012
19 Ga0070666_10135401 3300005335 Bacteria 1714
20 Ga0070666_10480217 3300005335 Bacteria 900
21 Ga0068868_100022560 3300005338 Bacteria 4753
22 Ga0068868_100044681 3300005338 Bacteria 3464
23 Ga0070675_100005489 3300005354 Bacteria 9709
24 Ga0070671_100094135 3300005355 Bacteria 2511
25 Ga0070671_100260559 3300005355 Bacteria 1474
26 Ga0070674_100286521 3300005356 Bacteria 1308
27 Ga0070673_100016256 3300005364 Bacteria 5256
28 Ga0070673_100368932 3300005364 Bacteria 1278
29 Ga0070667_100020993 3300005367 Bacteria 5425
30 Ga0070667_100396441 3300005367 Bacteria 1256
31 Ga0068867_100011863 3300005459 Bacteria 6155
32 Ga0068867_100022944 3300005459 Bacteria 4465
33 Ga0070706_100007184 3300005467 Bacteria 10469
34 Ga0070698_100260353 3300005471 Bacteria 1667
35 Ga0070699_100040858 3300005518 Bacteria 4015
36 Ga0068853_100036493 3300005539 Bacteria 4181
37 Ga0068853_100055561 3300005539 Bacteria 3413
38 Ga0070672_100061041 3300005543 Bacteria 2971
39 Ga0070665_100240060 3300005548 Bacteria 1813
40 Ga0068857_100058161 3300005577 Bacteria 3432
41 Ga0068854_100326062 3300005578 Bacteria 1250
42 Ga0068859_100350713 3300005617 Bacteria 1571
43 Ga0068870_10101982 3300005840 Bacteria 1623
44 Ga0068860_100056427 3300005843 Bacteria 3734
45 Ga0068862_100059461 3300005844 Bacteria 3282
46 Ga0075365_10118917 3300006038 Bacteria 1821
47 Ga0075363_100062696 3300006048 Bacteria 2005
48 Ga0075364_10110967 3300006051 Bacteria 1830
49 Ga0075432_10004897 3300006058 Bacteria 4560
50 Ga0075432_10071681 3300006058 Bacteria 1246
51 Ga0075362_10000829 3300006177 Bacteria 9271
52 Ga0075362_10021695 3300006177 Bacteria 2699
53 Ga0075362_10049294 3300006177 Bacteria 1881
54 Ga0075362_10051786 3300006177 Bacteria 1838
55 Ga0075367_10015941 3300006178 Bacteria 4096
56 Ga0075367_10030388 3300006178 Bacteria 3097
57 Ga0075367_10034194 3300006178 Bacteria 2934
58 Ga0075369_10035488 3300006186 Bacteria 2120
59 Ga0075366_10000309 3300006195 Bacteria 22109
60 Ga0075366_10027176 3300006195 Bacteria 3356
61 Ga0075366_10050916 3300006195 Bacteria 2460
62 Ga0075366_10072920 3300006195 Bacteria 2046
63 Ga0075366_10091273 3300006195 Bacteria 1824
64 Ga0075370_10001597 3300006353 Bacteria 9989
65 Ga0075370_10004683 3300006353 Bacteria 6675
66 Ga0075370_10010776 3300006353 Bacteria 4792
67 Ga0075370_10023645 3300006353 Bacteria 3386
68 Ga0075370_10025701 3300006353 Bacteria 3258
69 Ga0075370_10037034 3300006353 Bacteria 2742
70 Ga0075370_10052616 3300006353 Bacteria 2311
71 Ga0075370_10076010 3300006353 Bacteria 1926
72 Ga0075370_10090740 3300006353 Bacteria 1762
73 Ga0075370_10220096 3300006353 Bacteria 1122
74 Ga0097620_100350704 3300006931 Bacteria 1571
75 Ga0105240_10003282 3300009093 Bacteria 25301
76 Ga0105243_10190577 3300009148 Bacteria 1791
77 Ga0105241_10196429 3300009174 Bacteria 1682
78 Ga0105241_10646823 3300009174 Bacteria 960
79 Ga0105237_10001435 3300009545 Bacteria 31496
80 Ga0105237_10294557 3300009545 Bacteria 1625
81 Ga0105238_10011109 3300009551 Bacteria 9053
82 Ga0105249_10356013 3300009553 Bacteria 1484
83 Ga0105239_10001553 3300010375 Bacteria 30349
84 Ga0105239_10013811 3300010375 Bacteria 8962
85 Ga0105246_10103953 3300011119 Bacteria 2074
86 Ga0105246_10138306 3300011119 Bacteria 1828
87 Ga0157378_10050065 3300013297 Bacteria 3717
88 Ga0157378_10339288 3300013297 Bacteria 1465
89 Ga0157378_10491782 3300013297 Bacteria 1224
90 Ga0157372_10911561 3300013307 Bacteria 1020
91 Ga0182008_10017705 3300014497 Bacteria 3693
92 Ga0157379_10008377 3300014968 Bacteria 8986
93 Ga0157379_10885902 3300014968 Bacteria 846
94 Ga0182007_10080774 3300015262 Bacteria 1066
95 Ga0163161_10004352 3300017792 Bacteria 9869
96 Ga0207425_1000586 3300025245 Bacteria 21272
97 Ga0209129_1000225 3300025258 Bacteria 63564
98 Ga0209565_1000087 3300025263 Bacteria 152027
99 Ga0209565_1018465 3300025263 Bacteria 1507
100 Ga0209673_1000145 3300025273 Bacteria 152027
101 Ga0209673_1029588 3300025273 Bacteria 1741
102 Ga0209673_1043798 3300025273 Bacteria 1246
103 Ga0209130_1001565 3300025284 Bacteria 14489
104 Ga0209675_1000085 3300025291 Bacteria 152027
105 Ga0209675_1003038 3300025291 Bacteria 8233
106 Ga0209676_1007170 3300025292 Bacteria 5316
107 Ga0209676_1042384 3300025292 Bacteria 1264
108 Ga0209564_1000196 3300025295 Bacteria 141368
109 Ga0209564_1037288 3300025295 Bacteria 1373
110 Ga0209564_1049239 3300025295 Bacteria 1045
111 Ga0209758_1000078 3300025297 Bacteria 266153
112 Ga0209758_1000181 3300025297 Bacteria 140847
113 Ga0209050_1000335 3300025298 Bacteria 93521
114 Ga0209050_1066041 3300025298 Bacteria 830
115 Ga0209256_1045854 3300025299 Bacteria 1084
116 Ga0209051_1000275 3300025303 Bacteria 84419
117 Ga0209051_1016960 3300025303 Bacteria 3270
118 Ga0209257_1017900 3300025304 Bacteria 2761
119 Ga0209257_1018628 3300025304 Bacteria 2657
120 Ga0209257_1045771 3300025304 Bacteria 1268
121 Ga0207642_10412432 3300025899 Bacteria 811
122 Ga0207688_10227220 3300025901 Bacteria 1126
123 Ga0207645_10007185 3300025907 Bacteria 7898
124 Ga0207645_10008583 3300025907 Bacteria 7118
125 Ga0207645_10196996 3300025907 Bacteria 1324
126 Ga0207643_10209250 3300025908 Bacteria 1190
127 Ga0207684_10251808 3300025910 Bacteria 1524
128 Ga0207695_10060155 3300025913 Bacteria 3934
129 Ga0207695_10133732 3300025913 Bacteria 2435
130 Ga0207671_10010151 3300025914 Bacteria 7802
131 Ga0207694_10054983 3300025924 Bacteria 3090
132 Ga0207659_10019958 3300025926 Bacteria 4422
133 Ga0207644_10006703 3300025931 Bacteria 7500
134 Ga0207644_10333978 3300025931 Bacteria 1228
135 Ga0207706_10012399 3300025933 Bacteria 7766
136 Ga0207691_10162354 3300025940 Bacteria 1959
137 Ga0207689_10008951 3300025942 Bacteria 8679
138 Ga0207689_10076438 3300025942 Bacteria 2753
139 Ga0207689_10113405 3300025942 Bacteria 2228
140 Ga0207712_10211906 3300025961 Bacteria 1543
141 Ga0207640_10362054 3300025981 Bacteria 1169
142 Ga0207658_10001830 3300025986 Bacteria 15927
143 Ga0207658_10198505 3300025986 Bacteria 1673
144 Ga0207677_10001950 3300026023 Bacteria 10916
145 Ga0207639_10041517 3300026041 Bacteria 3443
146 Ga0207639_10137609 3300026041 Bacteria 2030
147 Ga0207639_10167208 3300026041 Bacteria 1859
148 Ga0207648_10003564 3300026089 Bacteria 16281
149 Ga0207648_10008821 3300026089 Bacteria 9713
150 Ga0207648_10022801 3300026089 Bacteria 5617
151 Ga0207648_10195896 3300026089 Bacteria 1791
152 Ga0207648_10203465 3300026089 Bacteria 1757
153 Ga0207648_10273574 3300026089 Bacteria 1509
154 Ga0207674_10091308 3300026116 Bacteria 3035
155 Ga0207674_10449386 3300026116 Bacteria 1246
156 Ga0207698_10579823 3300026142 Bacteria 1103
157 Ga0209282_1000366 3300027666 Bacteria 22131
158 Ga0209998_10035953 3300027717 Bacteria 1111
159 Ga0209974_10001737 3300027876 Bacteria 7919
160 Ga0207428_10292471 3300027907 Bacteria 1207
161 Ga0268266_10078850 3300028379 Bacteria 2867
162 Ga0268265_10300098 3300028380 Bacteria 1446
163 Ga0307517_10001964 3300028786 Bacteria 33537
164 Ga0307517_10190186 3300028786 Bacteria 1305
165 Ga0307517_10259604 3300028786 Bacteria 1010
166 Ga0307517_10298430 3300028786 Bacteria 905
167 Ga0307517_10313228 3300028786 Bacteria 873
168 Ga0307515_10000240 3300028794 Bacteria 135655
169 Ga0307515_10000367 3300028794 Bacteria 111166
170 Ga0307515_10000477 3300028794 Bacteria 95378
171 Ga0307515_10003504 3300028794 Bacteria 32990
172 Ga0307515_10043178 3300028794 Bacteria 7019
173 Ga0307515_10112867 3300028794 Bacteria 3157
174 Ga0307512_10020775 3300030522 Bacteria 5933
175 Ga0314311_1017314 3300030733 Bacteria 1111
176 Ga0316179_1074010 3300030734 Bacteria 2113
177 Ga0316178_1106004 3300030735 Bacteria 3027
178 Ga0316180_1079503 3300030736 Bacteria 2889
179 Ga0316181_1045566 3300030744 Bacteria 1775
180 Ga0316181_1051587 3300030744 Bacteria 1813
181 Ga0316182_1427640 3300030745 Bacteria 1737
182 Ga0307513_10009928 3300031456 Bacteria 12009
183 Ga0307513_10019384 3300031456 Bacteria 8099
184 Ga0307513_10090842 3300031456 Bacteria 3113
185 Ga0307513_10128532 3300031456 Bacteria 2484
186 Ga0307513_10427099 3300031456 Bacteria 1054
187 Ga0307513_10535217 3300031456 Bacteria 885
188 Ga0307509_10001574 3300031507 Bacteria 38392
189 Ga0307509_10006576 3300031507 Bacteria 15574
190 Ga0307509_10052586 3300031507 Bacteria 4347
191 Ga0307509_10295109 3300031507 Bacteria 1373
192 Ga0307408_100010058 3300031548 Bacteria 6233
193 Ga0307408_100050761 3300031548 Bacteria 2984
194 Ga0307408_100396841 3300031548 Bacteria 1183
195 Ga0307508_10000053 3300031616 Bacteria 128020
196 Ga0307508_10128746 3300031616 Bacteria 2134
197 Ga0307514_10001249 3300031649 Bacteria 33368
198 Ga0307514_10009921 3300031649 Bacteria 7977
199 Ga0307514_10010210 3300031649 Bacteria 7860
200 Ga0307514_10206081 3300031649 Bacteria 1228
201 Ga0307516_10002523 3300031730 Bacteria 24368
202 Ga0307516_10125273 3300031730 Bacteria 2354
203 Ga0307516_10370688 3300031730 Bacteria 1095
204 Ga0307405_10103362 3300031731 Bacteria 1915
205 Ga0307413_10288731 3300031824 Bacteria 1238
206 Ga0307413_10395370 3300031824 Bacteria 1081
207 Ga0307406_10015497 3300031901 Bacteria 4413
208 Ga0307406_10086823 3300031901 Bacteria 2096
209 Ga0307412_10095993 3300031911 Bacteria 2085
210 Ga0307416_100409034 3300032002 Bacteria 1397
211 Ga0307416_100607611 3300032002 Bacteria 1174
212 Ga0307414_10012116 3300032004 Bacteria 5086
213 Ga0307414_10057433 3300032004 Bacteria 2735
214 Ga0307414_10158333 3300032004 Bacteria 1795
215 Ga0307411_10152594 3300032005 Bacteria 1718
216 Ga0307415_100647699 3300032126 Bacteria 947
217 Ga0307507_10080213 3300033179 Bacteria 2879
218 Ga0307510_10006355 3300033180 Bacteria 14096
219 Ga0307510_10156462 3300033180 Bacteria 1885
220 Ga0373937_0088093 3300036401 Bacteria 2874
221 Ga0373925_0147809 3300037068 Bacteria 1843
222 Ga0395900_0217347 3300037418 Bacteria 1928
223 Ga0395905_0063008 3300037471 Bacteria 3468
224 Ga0395905_0105048 3300037471 Bacteria 2652
225 Ga0395905_0112397 3300037471 Bacteria 2558
226 Ga0395905_0338675 3300037471 Bacteria 1395
227 Ga0395905_0341121 3300037471 Bacteria 1389
228 Ga0439436_0000598 3300041404 Bacteria 9569
229 Ga0439436_0044676 3300041404 Bacteria 1262
230 Ga0439439_0032690 3300041406 Bacteria 1329
231 Ga0439447_060304 3300041407 Bacteria 894
232 Ga0439465_0000187 3300041413 Bacteria 16109
233 Ga0439465_0078975 3300041413 Bacteria 1113
234 Ga0451789_0010885 3300041443 Bacteria 2379
235 Ga0451791_0434083 3300041451 Bacteria 1716
236 Ga0451793_0860511 3300041452 Bacteria 1490
237 Ga0451800_0336968 3300041459 Bacteria 3042
238 Ga0451807_1951703 3300041486 Bacteria 1124
239 Ga0451853_0879173 3300041512 Bacteria 1432
240 Ga0439431_0004275 3300041997 Bacteria 3136
241 Ga0439431_0031428 3300041997 Bacteria 1320
242 Ga0439433_0012300 3300041999 Bacteria 1876
243 Ga0439442_003048 3300042002 Bacteria 3312
244 Ga0439445_0003728 3300042004 Bacteria 3421
245 Ga0439432_001074 3300042006 Bacteria 10381
246 Ga0439449_0000655 3300042007 Bacteria 13064
247 Ga0439449_0023195 3300042007 Bacteria 2321
248 Ga0439452_002340 3300042010 Bacteria 7062
249 Ga0439457_002406 3300042014 Bacteria 5351
250 Ga0450911_000132 3300042115 Bacteria 29769
251 Ga0450896_005891 3300042133 Bacteria 1677
252 Ga0439446_0016400 3300042156 Bacteria 2063
253 Ga0439446_0051492 3300042156 Bacteria 1230
254 Ga0450908_008966 3300042184 Bacteria 1866
255 Ga0439434_0006823 3300042435 Bacteria 3336
256 Ga0439435_0037385 3300042436 Bacteria 1345
257 Ga0451577_0004377 3300042876 Bacteria 14933
258 Ga0451577_0635971 3300042876 Bacteria 968
259 Ga0466972_0079954 3300044658 Bacteria 1557
260 Ga0453684_0008225 3300044712 Bacteria 18810
261 Ga0451576_0030006 3300045051 Bacteria 5815
262 Ga0495592_0000173 3300046454 Bacteria 57219
263 Ga0495590_0002499 3300046457 Bacteria 7609
264 Ga0495638_0053168 3300046460 Bacteria 2521
265 Ga0495638_0129168 3300046460 Bacteria 1486
266 Ga0495650_0001683 3300046471 Bacteria 20409
267 Ga0495583_0064339 3300046506 Bacteria 1628
268 Ga0495606_0226609 3300046507 Bacteria 1050
269 Ga0495610_0012963 3300046512 Bacteria 4982
270 Ga0495616_0047661 3300046513 Bacteria 2157
271 Ga0495620_0083795 3300046515 Bacteria 1287
272 Ga0495632_0007356 3300046519 Bacteria 6930
273 Ga0495632_0011463 3300046519 Bacteria 5169
274 Ga0495632_0172938 3300046519 Bacteria 991
275 Ga0495648_0144055 3300046524 Bacteria 1251
276 Ga0495642_0046701 3300046528 Bacteria 1772
277 Ga0495597_0020932 3300046542 Bacteria 3042
278 Ga0495668_0061780 3300046616 Bacteria 2066
279 Ga0495625_0000012 3300046660 Bacteria 363006
280 Ga0495625_0007912 3300046660 Bacteria 9145
281 Ga0495625_0010221 3300046660 Bacteria 7784
282 Ga0495646_0209441 3300046680 Bacteria 1058
283 Ga0495671_0103614 3300046692 Bacteria 1390
284 Ga0495649_0264950 3300046694 Bacteria 880
285 Ga0495660_0036170 3300046810 Bacteria 2755
286 Ga0495660_0058818 3300046810 Bacteria 2069
287 Ga0495687_000336 3300047443 Bacteria 60212
288 Ga0495687_005245 3300047443 Bacteria 8327
289 Ga0495686_0006694 3300047472 Bacteria 8770
290 Ga0495686_0093329 3300047472 Bacteria 1825
291 Ga0496106_0444690 3300048909 Bacteria 1041
292 Ga0496114_0418537 3300048917 Bacteria 1187
293 Ga0496124_0051398 3300048927 Bacteria 3507
294 Ga0496124_0426607 3300048927 Bacteria 912
295 Ga0496125_0048466 3300048928 Bacteria 3542
296 Ga0495682_0049757 3300049460 Bacteria 1527
297 Ga0501292_004814 3300049515 Bacteria 1862
298 Ga0501303_002096 3300049526 Bacteria 1522
299 Ga0501034_0555814 3300049571 Bacteria 1057
300 Ga0501038_0090238 3300049574 Bacteria 2569
301 Ga0501047_0745243 3300049581 Bacteria 796
302 Ga0501198_000146 3300049649 Bacteria 10045
303 Ga0501206_008613 3300049653 Bacteria 1350
304 Ga0501222_000065 3300049662 Bacteria 32752
305 Ga0501249_000882 3300049679 Bacteria 6601
306 Ga0501262_000169 3300049759 Bacteria 8143
307 Ga0501265_001210 3300049762 Bacteria 2921
308 nmdc:mga03683_2369_c1 3300050489 Bacteria 5838
309 nmdc:mga03n38_133753_c1 3300050490 Bacteria 1232
310 nmdc:mga03n38_47915_c1 3300050490 Bacteria 1894
311 nmdc:mga00v17_137941_c1 3300050491 Bacteria 1562
312 nmdc:mga0yw44_166695_c1 3300050492 Bacteria 1445
313 nmdc:mga0yw44_173915_c1 3300050492 Bacteria 1415
314 nmdc:mga0k408_1067_c1 3300050493 Bacteria 15070
315 nmdc:mga0k408_15560_c1 3300050493 Bacteria 4207
316 nmdc:mga0k408_20905_c1 3300050493 Bacteria 3673
317 nmdc:mga0k408_26215_c1 3300050493 Bacteria 3304
318 nmdc:mga0k408_29925_c1 3300050493 Bacteria 3103
319 nmdc:mga0k408_30219_c1 3300050493 Bacteria 3088
320 nmdc:mga0k408_37453_c1 3300050493 Bacteria 2785
321 nmdc:mga0k408_402288_c1 3300050493 Bacteria 815
322 nmdc:mga0k408_5106_c1 3300050493 Bacteria 5313
323 nmdc:mga0k408_84272_c2 3300050493 Bacteria 997
324 nmdc:mga0k408_89597_c1 3300050493 Bacteria 1807
325 nmdc:mga06z11_110799_c1 3300050494 Bacteria 1519
326 nmdc:mga06z11_149292_c1 3300050494 Bacteria 1327
327 nmdc:mga06z11_30244_c1 3300050494 Bacteria 2619
328 nmdc:mga04h51_37324_c1 3300050495 Bacteria 1568
329 nmdc:mga07m45_11801_c1 3300050496 Bacteria 4600
330 nmdc:mga07m45_1292_c1 3300050496 Bacteria 11401
331 nmdc:mga07m45_135075_c1 3300050496 Bacteria 1428
332 nmdc:mga07m45_16784_c1 3300050496 Bacteria 3922
333 nmdc:mga07m45_180738_c1 3300050496 Bacteria 1227
334 nmdc:mga07m45_2964_c1 3300050496 Bacteria 8070
335 nmdc:mga07m45_74670_c1 3300050496 Bacteria 1931
336 nmdc:mga07m45_79672_c1 3300050496 Bacteria 1870
337 nmdc:mga0sz30_132985_c1 3300050516 Bacteria 1097
338 Ga0500578_0000067 3300053086 Bacteria 115659
339 Ga0500578_0151508 3300053086 Bacteria 1444
340 Ga0500644_0002448 3300053088 Bacteria 4640
341 Ga0500651_0000511 3300053093 Bacteria 20008
342 Ga0500651_0106002 3300053093 Bacteria 1719
343 Ga0500562_013361 3300053108 Bacteria 2096
344 Ga0500569_009773 3300053109 Bacteria 2239
345 Ga0500628_001627 3300053129 Bacteria 3805
346 Ga0500642_0003304 3300053130 Bacteria 4857
347 Ga0500642_0020249 3300053130 Bacteria 2612
348 Ga0500652_000271 3300053131 Bacteria 19395
349 Ga0500655_006334 3300053133 Bacteria 2130
350 Ga0500658_0006982 3300053134 Bacteria 4179
351 Ga0500658_0023023 3300053134 Bacteria 2375
352 Ga0500559_0000170 3300053136 Bacteria 51659
353 Ga0500619_000064 3300053154 Bacteria 32285
354 Ga0500619_097539 3300053154 Bacteria 996
355 Ga0500622_0000424 3300053156 Bacteria 40033
356 Ga0500622_0008074 3300053156 Bacteria 5921
357 Ga0500636_0072520 3300053177 Bacteria 1995
358 Ga0500645_008097 3300053730 Bacteria 3617
359 Ga0500587_000912 3300053739 Bacteria 3940
360 Ga0500587_002456 3300053739 Bacteria 2635
361 Ga0500587_010267 3300053739 Bacteria 1188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0745243 Ga0501047_0745243_25_630 201
2 3300037418 Ga0395900_0217347 Ga0395900_0217347_903_1610 232
3 3300037471 Ga0395905_0105048 Ga0395905_0105048_1932_2639 232
4 iso_pu_bacteria 2585428057 2587727602 232
5 3300006195 Ga0075366_10091273 Ga0075366_100912733 234
6 3300028786 Ga0307517_10313228 Ga0307517_103132282 234
7 3300037471 Ga0395905_0112397 Ga0395905_0112397_1471_2184 234
8 3300041443 Ga0451789_0010885 Ga0451789_0010885_1016_1726 234
9 3300041451 Ga0451791_0434083 Ga0451791_0434083_715_1425 234
10 3300041452 Ga0451793_0860511 Ga0451793_0860511_105_815 234
11 3300041459 Ga0451800_0336968 Ga0451800_0336968_1203_1913 234
12 3300042436 Ga0439435_0037385 Ga0439435_0037385_576_1280 234
13 3300046460 Ga0495638_0129168 Ga0495638_0129168_49_759 234
14 3300046519 Ga0495632_0011463 Ga0495632_0011463_1807_2517 234
15 3300050493 nmdc:mga0k408_402288_c1 nmdc:mga0k408_402288_c1_25_729 234
16 3300050493 nmdc:mga0k408_5106_c1 nmdc:mga0k408_5106_c1_1894_2598 234
17 3300053093 Ga0500651_0000511 Ga0500651_0000511_18_728 234
18 3300053109 Ga0500569_009773 Ga0500569_009773_1304_2014 234
19 3300053129 Ga0500628_001627 Ga0500628_001627_558_1268 234
20 3300053130 Ga0500642_0003304 Ga0500642_0003304_1953_2663 234
21 3300053131 Ga0500652_000271 Ga0500652_000271_8303_9013 234
22 3300053133 Ga0500655_006334 Ga0500655_006334_655_1365 234
23 3300053156 Ga0500622_0000424 Ga0500622_0000424_22418_23128 234
24 3300031824 Ga0307413_10288731 Ga0307413_102887312 235
25 3300031901 Ga0307406_10086823 Ga0307406_100868232 235
26 3300032002 Ga0307416_100409034 Ga0307416_1004090341 235
27 3300042876 Ga0451577_0635971 Ga0451577_0635971_44_751 235
28 3300005844 Ga0068862_100059461 Ga0068862_1000594614 236
29 3300009553 Ga0105249_10356013 Ga0105249_103560132 236
30 3300014968 Ga0157379_10008377 Ga0157379_100083776 236
31 3300025942 Ga0207689_10113405 Ga0207689_101134052 236
32 3300025961 Ga0207712_10211906 Ga0207712_102119063 236
33 3300026089 Ga0207648_10195896 Ga0207648_101958962 236
34 3300028380 Ga0268265_10300098 Ga0268265_103000982 236
35 3300028794 Ga0307515_10043178 Ga0307515_100431788 236
36 3300031507 Ga0307509_10052586 Ga0307509_100525862 236
37 3300032002 Ga0307416_100607611 Ga0307416_1006076112 236
38 3300036401 Ga0373937_0088093 Ga0373937_0088093_1394_2104 236
39 3300041413 Ga0439465_0078975 Ga0439465_0078975_84_794 236
40 3300042156 Ga0439446_0051492 Ga0439446_0051492_183_893 236
41 3300049649 Ga0501198_000146 Ga0501198_000146_4318_5028 236
42 3300049662 Ga0501222_000065 Ga0501222_000065_5018_5728 236
43 3300050493 nmdc:mga0k408_20905_c1 nmdc:mga0k408_20905_c1_1434_2156 236
44 iso_pu_bacteria 2738543013 2739248725 236
45 3300013307 Ga0157372_10911561 Ga0157372_109115611 237
46 3300028794 Ga0307515_10000240 Ga0307515_10000240105 237
47 3300028794 Ga0307515_10000367 Ga0307515_1000036710 237
48 3300031456 Ga0307513_10009928 Ga0307513_100099287 237
49 3300031548 Ga0307408_100396841 Ga0307408_1003968412 237
50 3300046471 Ga0495650_0001683 Ga0495650_0001683_9021_9734 237
51 3300049515 Ga0501292_004814 Ga0501292_004814_247_960 237
52 3300049526 Ga0501303_002096 Ga0501303_002096_589_1302 237
53 3300049653 Ga0501206_008613 Ga0501206_008613_307_1020 237
54 3300049762 Ga0501265_001210 Ga0501265_001210_2074_2787 237
55 3300005843 Ga0068860_100056427 Ga0068860_1000564272 238
56 3300013297 Ga0157378_10050065 Ga0157378_100500652 238
57 3300025907 Ga0207645_10196996 Ga0207645_101969962 238
58 3300026089 Ga0207648_10273574 Ga0207648_102735742 238
59 3300037471 Ga0395905_0063008 Ga0395905_0063008_166_882 238
60 3300048927 Ga0496124_0426607 Ga0496124_0426607_12_731 238
61 3300003784 Ga0055534_1001347 Ga0055534_100134710 239
62 3300006195 Ga0075366_10000309 Ga0075366_1000030916 239
63 3300006353 Ga0075370_10010776 Ga0075370_100107766 239
64 3300025284 Ga0209130_1001565 Ga0209130_100156512 239
65 3300025291 Ga0209675_1003038 Ga0209675_10030387 239
66 3300025292 Ga0209676_1007170 Ga0209676_10071708 239
67 3300025295 Ga0209564_1037288 Ga0209564_10372882 239
68 3300025298 Ga0209050_1066041 Ga0209050_10660412 239
69 3300025303 Ga0209051_1016960 Ga0209051_10169605 239
70 3300025304 Ga0209257_1018628 Ga0209257_10186283 239
71 3300025901 Ga0207688_10227220 Ga0207688_102272202 239
72 3300037471 Ga0395905_0338675 Ga0395905_0338675_104_823 239
73 3300044658 Ga0466972_0079954 Ga0466972_0079954_612_1331 239
74 3300044712 Ga0453684_0008225 Ga0453684_0008225_15953_16672 239
75 3300049571 Ga0501034_0555814 Ga0501034_0555814_134_865 239
76 3300049574 Ga0501038_0090238 Ga0501038_0090238_1364_2089 239
77 3300050493 nmdc:mga0k408_1067_c1 nmdc:mga0k408_1067_c1_5352_6071 239
78 3300050496 nmdc:mga07m45_16784_c1 nmdc:mga07m45_16784_c1_2480_3199 239
79 3300031730 Ga0307516_10125273 Ga0307516_101252733 240
80 3300042876 Ga0451577_0004377 Ga0451577_0004377_1469_2191 240
81 3300046513 Ga0495616_0047661 Ga0495616_0047661_275_1021 242
82 3300003316 rootH1_10091958 rootH1_100919583 243
83 3300009093 Ga0105240_10003282 Ga0105240_1000328216 244
84 3300009174 Ga0105241_10196429 Ga0105241_101964292 244
85 3300009545 Ga0105237_10001435 Ga0105237_1000143521 244
86 3300009551 Ga0105238_10011109 Ga0105238_100111098 244
87 3300010375 Ga0105239_10001553 Ga0105239_1000155321 244
88 3300048917 Ga0496114_0418537 Ga0496114_0418537_88_891 244
89 3300031616 Ga0307508_10128746 Ga0307508_101287462 245
90 iso_pu_bacteria 2954767861 2954771935 245
91 3300005335 Ga0070666_10480217 Ga0070666_104802171 246
92 iso_pu_bacteria 2585428058 2587732958 246
93 iso_pu_bacteria 2585428062 2587758500 246
94 iso_pu_bacteria 2643221628 2644159284 246
95 iso_pu_bacteria 2842677519 2842681006 246
96 iso_pu_bacteria 2842747753 2842750634 246
97 iso_pu_bacteria 2885192300 2885197302 246
98 iso_pu_bacteria 2904449895 2904455448 246
99 iso_pu_bacteria 2904456579 2904460616 246
100 iso_pu_bacteria 2919462493 2919466812 246
101 iso_pu_bacteria 2929520902 2929524825 246
102 iso_pu_bacteria 2945945610 2945948416 246
103 iso_pu_bacteria 2945972063 2945976925 246
104 3300005539 Ga0068853_100036493 Ga0068853_1000364933 248
105 3300025913 Ga0207695_10133732 Ga0207695_101337324 248
106 3300025914 Ga0207671_10010151 Ga0207671_100101516 248
107 3300025924 Ga0207694_10054983 Ga0207694_100549834 248
108 3300026041 Ga0207639_10041517 Ga0207639_100415172 248
109 3300042007 Ga0439449_0023195 Ga0439449_0023195_726_1475 248
110 3300047472 Ga0495686_0006694 Ga0495686_0006694_7244_7993 248
111 iso_pu_bacteria 2588253510 2588294248 248
112 iso_pu_bacteria 2643221592 2643968502 248
113 iso_pu_bacteria 2643221648 2644272774 248
114 3300005327 Ga0070658_10668226 Ga0070658_106682261 249
115 3300005335 Ga0070666_10135401 Ga0070666_101354012 249
116 3300005356 Ga0070674_100286521 Ga0070674_1002865212 249
117 3300005578 Ga0068854_100326062 Ga0068854_1003260622 249
118 3300006178 Ga0075367_10030388 Ga0075367_100303882 249
119 3300013297 Ga0157378_10339288 Ga0157378_103392881 249
120 3300025981 Ga0207640_10362054 Ga0207640_103620542 249
121 3300026041 Ga0207639_10137609 Ga0207639_101376092 249
122 3300026089 Ga0207648_10022801 Ga0207648_100228012 249
123 3300028786 Ga0307517_10298430 Ga0307517_102984302 249
124 3300030744 Ga0316181_1045566 Ga0316181_10455663 249
125 3300031507 Ga0307509_10001574 Ga0307509_100015748 249
126 3300033180 Ga0307510_10006355 Ga0307510_100063554 249
127 3300037068 Ga0373925_0147809 Ga0373925_0147809_61_816 249
128 3300037471 Ga0395905_0341121 Ga0395905_0341121_54_803 249
129 3300045051 Ga0451576_0030006 Ga0451576_0030006_768_1520 249
130 3300046454 Ga0495592_0000173 Ga0495592_0000173_53192_53941 249
131 3300046457 Ga0495590_0002499 Ga0495590_0002499_6419_7168 249
132 3300046680 Ga0495646_0209441 Ga0495646_0209441_247_996 249
133 3300046810 Ga0495660_0036170 Ga0495660_0036170_1043_1792 249
134 3300049460 Ga0495682_0049757 Ga0495682_0049757_744_1493 249
135 3300050494 nmdc:mga06z11_110799_c1 nmdc:mga06z11_110799_c1_533_1282 249
136 3300053093 Ga0500651_0106002 Ga0500651_0106002_847_1596 249
137 3300053154 Ga0500619_097539 Ga0500619_097539_59_808 249
138 3300002773 JGI25152J39213_1003123 JGI25152J39213_10031232 250
139 3300003215 JGI25153J46596_10001363 JGI25153J46596_100013635 250
140 3300003215 JGI25153J46596_10002097 JGI25153J46596_1000209713 250
141 3300003578 Ga0006562J51391_1020741 Ga0006562J51391_10207413 250
142 3300003771 Ga0055526_1002875 Ga0055526_100287510 250
143 3300003773 Ga0055537_1000031 Ga0055537_100003152 250
144 3300003784 Ga0055534_1000091 Ga0055534_100009130 250
145 3300003790 Ga0055528_1000237 Ga0055528_100023729 250
146 3300003791 Ga0055530_10022384 Ga0055530_100223841 250
147 3300005262 Ga0065165_1000793 Ga0065165_10007933 250
148 3300005289 Ga0065704_10082290 Ga0065704_100822902 250
149 3300005328 Ga0070676_10003375 Ga0070676_100033758 250
150 3300005328 Ga0070676_10007342 Ga0070676_100073424 250
151 3300005328 Ga0070676_10168220 Ga0070676_101682202 250
152 3300005331 Ga0070670_100070004 Ga0070670_1000700043 250
153 3300005338 Ga0068868_100022560 Ga0068868_1000225603 250
154 3300005338 Ga0068868_100044681 Ga0068868_1000446814 250
155 3300005354 Ga0070675_100005489 Ga0070675_1000054893 250
156 3300005355 Ga0070671_100094135 Ga0070671_1000941352 250
157 3300005355 Ga0070671_100260559 Ga0070671_1002605593 250
158 3300005364 Ga0070673_100016256 Ga0070673_1000162566 250
159 3300005364 Ga0070673_100368932 Ga0070673_1003689322 250
160 3300005367 Ga0070667_100020993 Ga0070667_1000209937 250
161 3300005367 Ga0070667_100396441 Ga0070667_1003964411 250
162 3300005459 Ga0068867_100011863 Ga0068867_1000118634 250
163 3300005459 Ga0068867_100022944 Ga0068867_1000229443 250
164 3300005467 Ga0070706_100007184 Ga0070706_10000718411 250
165 3300005471 Ga0070698_100260353 Ga0070698_1002603532 250
166 3300005518 Ga0070699_100040858 Ga0070699_1000408583 250
167 3300005539 Ga0068853_100055561 Ga0068853_1000555613 250
168 3300005543 Ga0070672_100061041 Ga0070672_1000610412 250
169 3300005548 Ga0070665_100240060 Ga0070665_1002400603 250
170 3300005577 Ga0068857_100058161 Ga0068857_1000581613 250
171 3300005617 Ga0068859_100350713 Ga0068859_1003507133 250
172 3300005840 Ga0068870_10101982 Ga0068870_101019822 250
173 3300006038 Ga0075365_10118917 Ga0075365_101189173 250
174 3300006048 Ga0075363_100062696 Ga0075363_1000626963 250
175 3300006051 Ga0075364_10110967 Ga0075364_101109672 250
176 3300006058 Ga0075432_10004897 Ga0075432_100048974 250
177 3300006058 Ga0075432_10071681 Ga0075432_100716813 250
178 3300006177 Ga0075362_10000829 Ga0075362_100008299 250
179 3300006177 Ga0075362_10021695 Ga0075362_100216953 250
180 3300006177 Ga0075362_10049294 Ga0075362_100492942 250
181 3300006177 Ga0075362_10051786 Ga0075362_100517862 250
182 3300006178 Ga0075367_10015941 Ga0075367_100159413 250
183 3300006178 Ga0075367_10034194 Ga0075367_100341944 250
184 3300006186 Ga0075369_10035488 Ga0075369_100354883 250
185 3300006195 Ga0075366_10027176 Ga0075366_100271764 250
186 3300006195 Ga0075366_10050916 Ga0075366_100509163 250
187 3300006195 Ga0075366_10072920 Ga0075366_100729202 250
188 3300006353 Ga0075370_10001597 Ga0075370_100015978 250
189 3300006353 Ga0075370_10004683 Ga0075370_100046834 250
190 3300006353 Ga0075370_10023645 Ga0075370_100236452 250
191 3300006353 Ga0075370_10025701 Ga0075370_100257015 250
192 3300006353 Ga0075370_10037034 Ga0075370_100370342 250
193 3300006353 Ga0075370_10052616 Ga0075370_100526163 250
194 3300006353 Ga0075370_10076010 Ga0075370_100760103 250
195 3300006353 Ga0075370_10090740 Ga0075370_100907401 250
196 3300006353 Ga0075370_10220096 Ga0075370_102200962 250
197 3300006931 Ga0097620_100350704 Ga0097620_1003507043 250
198 3300009148 Ga0105243_10190577 Ga0105243_101905773 250
199 3300009174 Ga0105241_10646823 Ga0105241_106468231 250
200 3300009545 Ga0105237_10294557 Ga0105237_102945573 250
201 3300010375 Ga0105239_10013811 Ga0105239_100138114 250
202 3300011119 Ga0105246_10103953 Ga0105246_101039533 250
203 3300011119 Ga0105246_10138306 Ga0105246_101383062 250
204 3300013297 Ga0157378_10491782 Ga0157378_104917821 250
205 3300014497 Ga0182008_10017705 Ga0182008_100177052 250
206 3300014968 Ga0157379_10885902 Ga0157379_108859021 250
207 3300015262 Ga0182007_10080774 Ga0182007_100807742 250
208 3300017792 Ga0163161_10004352 Ga0163161_100043529 250
209 3300025245 Ga0207425_1000586 Ga0207425_100058610 250
210 3300025258 Ga0209129_1000225 Ga0209129_100022525 250
211 3300025263 Ga0209565_1000087 Ga0209565_1000087100 250
212 3300025263 Ga0209565_1018465 Ga0209565_10184652 250
213 3300025273 Ga0209673_1000145 Ga0209673_1000145100 250
214 3300025273 Ga0209673_1029588 Ga0209673_10295882 250
215 3300025273 Ga0209673_1043798 Ga0209673_10437982 250
216 3300025291 Ga0209675_1000085 Ga0209675_1000085100 250
217 3300025292 Ga0209676_1042384 Ga0209676_10423842 250
218 3300025295 Ga0209564_1000196 Ga0209564_1000196105 250
219 3300025295 Ga0209564_1049239 Ga0209564_10492391 250
220 3300025297 Ga0209758_1000078 Ga0209758_1000078238 250
221 3300025297 Ga0209758_1000181 Ga0209758_100018125 250
222 3300025298 Ga0209050_1000335 Ga0209050_100033577 250
223 3300025299 Ga0209256_1045854 Ga0209256_10458542 250
224 3300025303 Ga0209051_1000275 Ga0209051_100027551 250
225 3300025304 Ga0209257_1017900 Ga0209257_10179002 250
226 3300025304 Ga0209257_1045771 Ga0209257_10457711 250
227 3300025899 Ga0207642_10412432 Ga0207642_104124321 250
228 3300025907 Ga0207645_10007185 Ga0207645_100071853 250
229 3300025907 Ga0207645_10008583 Ga0207645_100085833 250
230 3300025908 Ga0207643_10209250 Ga0207643_102092501 250
231 3300025910 Ga0207684_10251808 Ga0207684_102518082 250
232 3300025913 Ga0207695_10060155 Ga0207695_100601553 250
233 3300025926 Ga0207659_10019958 Ga0207659_100199582 250
234 3300025931 Ga0207644_10006703 Ga0207644_100067036 250
235 3300025931 Ga0207644_10333978 Ga0207644_103339781 250
236 3300025933 Ga0207706_10012399 Ga0207706_100123997 250
237 3300025940 Ga0207691_10162354 Ga0207691_101623543 250
238 3300025942 Ga0207689_10008951 Ga0207689_100089519 250
239 3300025942 Ga0207689_10076438 Ga0207689_100764383 250
240 3300025986 Ga0207658_10001830 Ga0207658_1000183017 250
241 3300025986 Ga0207658_10198505 Ga0207658_101985052 250
242 3300026023 Ga0207677_10001950 Ga0207677_100019507 250
243 3300026041 Ga0207639_10167208 Ga0207639_101672083 250
244 3300026089 Ga0207648_10003564 Ga0207648_1000356412 250
245 3300026089 Ga0207648_10008821 Ga0207648_100088213 250
246 3300026089 Ga0207648_10203465 Ga0207648_102034652 250
247 3300026116 Ga0207674_10091308 Ga0207674_100913081 250
248 3300026116 Ga0207674_10449386 Ga0207674_104493862 250
249 3300026142 Ga0207698_10579823 Ga0207698_105798232 250
250 3300027666 Ga0209282_1000366 Ga0209282_100036618 250
251 3300027717 Ga0209998_10035953 Ga0209998_100359532 250
252 3300027876 Ga0209974_10001737 Ga0209974_100017379 250
253 3300027907 Ga0207428_10292471 Ga0207428_102924712 250
254 3300028379 Ga0268266_10078850 Ga0268266_100788503 250
255 3300028786 Ga0307517_10001964 Ga0307517_100019646 250
256 3300028786 Ga0307517_10190186 Ga0307517_101901862 250
257 3300028786 Ga0307517_10259604 Ga0307517_102596042 250
258 3300028794 Ga0307515_10000477 Ga0307515_1000047759 250
259 3300028794 Ga0307515_10003504 Ga0307515_1000350435 250
260 3300028794 Ga0307515_10112867 Ga0307515_101128672 250
261 3300030522 Ga0307512_10020775 Ga0307512_100207757 250
262 3300030733 Ga0314311_1017314 Ga0314311_10173142 250
263 3300030734 Ga0316179_1074010 Ga0316179_10740101 250
264 3300030735 Ga0316178_1106004 Ga0316178_11060042 250
265 3300030736 Ga0316180_1079503 Ga0316180_10795033 250
266 3300030744 Ga0316181_1051587 Ga0316181_10515873 250
267 3300030745 Ga0316182_1427640 Ga0316182_14276402 250
268 3300031456 Ga0307513_10019384 Ga0307513_100193848 250
269 3300031456 Ga0307513_10090842 Ga0307513_100908424 250
270 3300031456 Ga0307513_10128532 Ga0307513_101285322 250
271 3300031456 Ga0307513_10427099 Ga0307513_104270992 250
272 3300031456 Ga0307513_10535217 Ga0307513_105352172 250
273 3300031507 Ga0307509_10006576 Ga0307509_1000657613 250
274 3300031507 Ga0307509_10295109 Ga0307509_102951093 250
275 3300031548 Ga0307408_100010058 Ga0307408_1000100586 250
276 3300031548 Ga0307408_100050761 Ga0307408_1000507614 250
277 3300031616 Ga0307508_10000053 Ga0307508_100000536 250
278 3300031649 Ga0307514_10001249 Ga0307514_1000124911 250
279 3300031649 Ga0307514_10009921 Ga0307514_100099216 250
280 3300031649 Ga0307514_10010210 Ga0307514_100102102 250
281 3300031649 Ga0307514_10206081 Ga0307514_102060812 250
282 3300031730 Ga0307516_10002523 Ga0307516_1000252312 250
283 3300031730 Ga0307516_10370688 Ga0307516_103706882 250
284 3300031731 Ga0307405_10103362 Ga0307405_101033622 250
285 3300031824 Ga0307413_10395370 Ga0307413_103953702 250
286 3300031901 Ga0307406_10015497 Ga0307406_100154972 250
287 3300031911 Ga0307412_10095993 Ga0307412_100959932 250
288 3300032004 Ga0307414_10012116 Ga0307414_100121163 250
289 3300032004 Ga0307414_10057433 Ga0307414_100574332 250
290 3300032004 Ga0307414_10158333 Ga0307414_101583332 250
291 3300032005 Ga0307411_10152594 Ga0307411_101525942 250
292 3300032126 Ga0307415_100647699 Ga0307415_1006476991 250
293 3300033179 Ga0307507_10080213 Ga0307507_100802132 250
294 3300033180 Ga0307510_10156462 Ga0307510_101564623 250
295 3300041404 Ga0439436_0000598 Ga0439436_0000598_857_1621 250
296 3300041404 Ga0439436_0044676 Ga0439436_0044676_205_969 250
297 3300041406 Ga0439439_0032690 Ga0439439_0032690_345_1109 250
298 3300041407 Ga0439447_060304 Ga0439447_060304_37_801 250
299 3300041413 Ga0439465_0000187 Ga0439465_0000187_6717_7481 250
300 3300041486 Ga0451807_1951703 Ga0451807_1951703_115_873 250
301 3300041512 Ga0451853_0879173 Ga0451853_0879173_554_1312 250
302 3300041997 Ga0439431_0004275 Ga0439431_0004275_849_1613 250
303 3300041997 Ga0439431_0031428 Ga0439431_0031428_419_1183 250
304 3300041999 Ga0439433_0012300 Ga0439433_0012300_918_1682 250
305 3300042002 Ga0439442_003048 Ga0439442_003048_821_1585 250
306 3300042004 Ga0439445_0003728 Ga0439445_0003728_1893_2657 250
307 3300042006 Ga0439432_001074 Ga0439432_001074_8655_9419 250
308 3300042007 Ga0439449_0000655 Ga0439449_0000655_7728_8492 250
309 3300042010 Ga0439452_002340 Ga0439452_002340_5917_6681 250
310 3300042014 Ga0439457_002406 Ga0439457_002406_653_1417 250
311 3300042115 Ga0450911_000132 Ga0450911_000132_15515_16270 250
312 3300042133 Ga0450896_005891 Ga0450896_005891_49_813 250
313 3300042156 Ga0439446_0016400 Ga0439446_0016400_646_1410 250
314 3300042184 Ga0450908_008966 Ga0450908_008966_617_1381 250
315 3300042435 Ga0439434_0006823 Ga0439434_0006823_1064_1828 250
316 3300046460 Ga0495638_0053168 Ga0495638_0053168_904_1656 250
317 3300046506 Ga0495583_0064339 Ga0495583_0064339_277_1065 250
318 3300046507 Ga0495606_0226609 Ga0495606_0226609_267_1028 250
319 3300046512 Ga0495610_0012963 Ga0495610_0012963_1722_2477 250
320 3300046515 Ga0495620_0083795 Ga0495620_0083795_383_1138 250
321 3300046519 Ga0495632_0007356 Ga0495632_0007356_1291_2046 250
322 3300046519 Ga0495632_0172938 Ga0495632_0172938_35_793 250
323 3300046524 Ga0495648_0144055 Ga0495648_0144055_17_769 250
324 3300046528 Ga0495642_0046701 Ga0495642_0046701_642_1406 250
325 3300046542 Ga0495597_0020932 Ga0495597_0020932_676_1464 250
326 3300046616 Ga0495668_0061780 Ga0495668_0061780_1087_1875 250
327 3300046660 Ga0495625_0000012 Ga0495625_0000012_307400_308188 250
328 3300046660 Ga0495625_0007912 Ga0495625_0007912_3359_4114 250
329 3300046660 Ga0495625_0010221 Ga0495625_0010221_870_1634 250
330 3300046692 Ga0495671_0103614 Ga0495671_0103614_518_1270 250
331 3300046694 Ga0495649_0264950 Ga0495649_0264950_101_856 250
332 3300046810 Ga0495660_0058818 Ga0495660_0058818_627_1415 250
333 3300047443 Ga0495687_000336 Ga0495687_000336_18652_19407 250
334 3300047443 Ga0495687_005245 Ga0495687_005245_4200_4988 250
335 3300047472 Ga0495686_0093329 Ga0495686_0093329_216_980 250
336 3300048909 Ga0496106_0444690 Ga0496106_0444690_229_984 250
337 3300048927 Ga0496124_0051398 Ga0496124_0051398_977_1732 250
338 3300048928 Ga0496125_0048466 Ga0496125_0048466_2548_3303 250
339 3300049679 Ga0501249_000882 Ga0501249_000882_1683_2447 250
340 3300049759 Ga0501262_000169 Ga0501262_000169_3649_4413 250
341 3300050489 nmdc:mga03683_2369_c1 nmdc:mga03683_2369_c1_4488_5252 250
342 3300050490 nmdc:mga03n38_133753_c1 nmdc:mga03n38_133753_c1_377_1141 250
343 3300050490 nmdc:mga03n38_47915_c1 nmdc:mga03n38_47915_c1_167_931 250
344 3300050491 nmdc:mga00v17_137941_c1 nmdc:mga00v17_137941_c1_88_852 250
345 3300050492 nmdc:mga0yw44_166695_c1 nmdc:mga0yw44_166695_c1_554_1318 250
346 3300050492 nmdc:mga0yw44_173915_c1 nmdc:mga0yw44_173915_c1_631_1395 250
347 3300050493 nmdc:mga0k408_15560_c1 nmdc:mga0k408_15560_c1_2665_3429 250
348 3300050493 nmdc:mga0k408_26215_c1 nmdc:mga0k408_26215_c1_2206_2961 250
349 3300050493 nmdc:mga0k408_29925_c1 nmdc:mga0k408_29925_c1_1818_2582 250
350 3300050493 nmdc:mga0k408_30219_c1 nmdc:mga0k408_30219_c1_731_1483 250
351 3300050493 nmdc:mga0k408_37453_c1 nmdc:mga0k408_37453_c1_1813_2571 250
352 3300050493 nmdc:mga0k408_84272_c2 nmdc:mga0k408_84272_c2_148_903 250
353 3300050493 nmdc:mga0k408_89597_c1 nmdc:mga0k408_89597_c1_789_1541 250
354 3300050494 nmdc:mga06z11_149292_c1 nmdc:mga06z11_149292_c1_193_951 250
355 3300050494 nmdc:mga06z11_30244_c1 nmdc:mga06z11_30244_c1_1266_2030 250
356 3300050495 nmdc:mga04h51_37324_c1 nmdc:mga04h51_37324_c1_186_950 250
357 3300050496 nmdc:mga07m45_11801_c1 nmdc:mga07m45_11801_c1_3765_4520 250
358 3300050496 nmdc:mga07m45_1292_c1 nmdc:mga07m45_1292_c1_2600_3361 250
359 3300050496 nmdc:mga07m45_135075_c1 nmdc:mga07m45_135075_c1_70_825 250
360 3300050496 nmdc:mga07m45_180738_c1 nmdc:mga07m45_180738_c1_256_1008 250
361 3300050496 nmdc:mga07m45_2964_c1 nmdc:mga07m45_2964_c1_2930_3694 250
362 3300050496 nmdc:mga07m45_74670_c1 nmdc:mga07m45_74670_c1_257_1009 250
363 3300050496 nmdc:mga07m45_79672_c1 nmdc:mga07m45_79672_c1_779_1543 250
364 3300050516 nmdc:mga0sz30_132985_c1 nmdc:mga0sz30_132985_c1_250_1014 250
365 3300053086 Ga0500578_0000067 Ga0500578_0000067_72084_72836 250
366 3300053086 Ga0500578_0151508 Ga0500578_0151508_268_1032 250
367 3300053088 Ga0500644_0002448 Ga0500644_0002448_2584_3336 250
368 3300053108 Ga0500562_013361 Ga0500562_013361_622_1380 250
369 3300053130 Ga0500642_0020249 Ga0500642_0020249_1773_2531 250
370 3300053134 Ga0500658_0006982 Ga0500658_0006982_608_1390 250
371 3300053134 Ga0500658_0023023 Ga0500658_0023023_609_1364 250
372 3300053136 Ga0500559_0000170 Ga0500559_0000170_14375_15127 250
373 3300053154 Ga0500619_000064 Ga0500619_000064_10460_11221 250
374 3300053156 Ga0500622_0008074 Ga0500622_0008074_4645_5397 250
375 3300053177 Ga0500636_0072520 Ga0500636_0072520_589_1341 250
376 3300053730 Ga0500645_008097 Ga0500645_008097_1174_1938 250
377 3300053739 Ga0500587_000912 Ga0500587_000912_851_1606 250
378 3300053739 Ga0500587_002456 Ga0500587_002456_1358_2110 250
379 3300053739 Ga0500587_010267 Ga0500587_010267_132_896 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

26

237

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ny7-assembly1.cif.gz_B bond length analysis of the pqqc y175f mutant structure shows evidence for bound pqq in the reduced form 0.9541 16 246
1otw-assembly1.cif.gz_A crystal structure of pqqc in complex with pqq and a putative h2o2 0.9471 16 246
3hml-assembly1.cif.gz_B crystal structure of pqqc active site mutant h154s in complex with pqq 0.9455 16 246
3hnh-assembly1.cif.gz_A-2 crystal structure of pqqc active site mutant y175s,r179s in complex with a reaction intermediate 0.9418 16 246
5vrc-assembly2.cif.gz_D crystal structure for methylobacterium extorquens pqqc (truncation of natural cd fusion) 0.9194 20 246
ID Description Score Start End Superfamily
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9434 16 246 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8558 22 242 1.20.910.10
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8437 16 246 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8409 22 242 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8102 23 245 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A5C0ZSP4-F1-model_v4 Pyrroloquinoline-quinone synthase C 0.9723 44 181 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615
AF-A0A8A8VJM0-F1-model_v4 deleted 0.9647 15 246
AF-A0A7X7SPP3-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9608 28 250 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615
AF-A0A536ZHM0-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9604 16 246 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A349TGP2-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein C 0.9599 17 246 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615

Feature Viewer

pLDDT pTM Quality
89.22 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map