F428253

General Info

Members Datasets Scaffolds Average Seq Length
379 268 366 142

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100241827|Ga0070682_1002418271
Length 151
Sequence LNDCLNDGMTVLDSPIPRFHLAMPVDDLDAARHFYGEVLGLEQGRSSETWIDWNLRGHQFVTHLAPERQQRIHNPVDGHDVPVPHFGLILTVEQFQAFAERLKAAGTEFVIEPYVRFEGQTGEQWTMFFLDPAGNALEFKAFADDSQVFAA

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
6 2862574272 Streptomyces sp. AcE210 Isolate Nodule
7 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
8 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
9 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
10 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
102 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
172 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
173 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
174 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
175 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
257 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
258 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
259 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
262 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
267 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
268 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 0
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0.26
Rhizoplane 7.65
Rhizosphere 81
Stem 0
Stem Tuber 0
Unclassified 6.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012372 3300001979 Bacteria 3218
2 JGI24739J22299_10015276 3300001989 Bacteria 2789
3 JGI24739J22299_10165925 3300001989 Bacteria 651
4 JGI24737J22298_10006123 3300001990 Bacteria 4121
5 JGI24735J21928_10113113 3300002067 Bacteria 781
6 JGI24735J21928_10177148 3300002067 Bacteria 617
7 JGI24750J21931_1025539 3300002070 Bacteria 847
8 JGI24748J21848_1002823 3300002074 Bacteria 1976
9 JGI24749J21850_1052414 3300002076 Bacteria 610
10 JGI24744J21845_10029769 3300002077 Bacteria 1048
11 JGI24034J26672_10003156 3300002239 Bacteria 2289
12 JGI24742J22300_10012669 3300002244 Bacteria 1407
13 JGI25406J46586_10013105 3300003203 Bacteria 3576
14 Ga0055540_1012653 3300003792 Bacteria 2635
15 Ga0070676_10044018 3300005328 Bacteria 2596
16 Ga0070690_100074061 3300005330 Bacteria 2217
17 Ga0068869_100007426 3300005334 Bacteria 7005
18 Ga0070666_10124469 3300005335 Bacteria 1789
19 Ga0070680_100193124 3300005336 Bacteria 1716
20 Ga0070682_100161074 3300005337 Bacteria 1550
21 Ga0070682_100241827 3300005337 Bacteria 1296
22 Ga0068868_100170155 3300005338 Bacteria 1803
23 Ga0068868_100516512 3300005338 Bacteria 1048
24 Ga0070660_100502262 3300005339 Bacteria 1009
25 Ga0070689_100000990 3300005340 Bacteria 17780
26 Ga0070687_100037239 3300005343 Bacteria 2430
27 Ga0070668_100001103 3300005347 Bacteria 19039
28 Ga0070668_100004518 3300005347 Bacteria 10319
29 Ga0070668_100087658 3300005347 Bacteria 2449
30 Ga0070669_100028965 3300005353 Bacteria 3991
31 Ga0070675_100077723 3300005354 Bacteria 2763
32 Ga0070671_100082203 3300005355 Bacteria 2693
33 Ga0070674_100000673 3300005356 Bacteria 17282
34 Ga0070674_100068783 3300005356 Bacteria 2496
35 Ga0070688_100036687 3300005365 Bacteria 2983
36 Ga0070688_100836741 3300005365 Bacteria 722
37 Ga0070659_100012189 3300005366 Bacteria 6372
38 Ga0070667_100117012 3300005367 Bacteria 2315
39 Ga0070667_100189279 3300005367 Bacteria 1822
40 Ga0070703_10238964 3300005406 Bacteria 731
41 Ga0070709_10058578 3300005434 Bacteria 2443
42 Ga0070714_100380185 3300005435 Bacteria 1331
43 Ga0070710_10000142 3300005437 Bacteria 33366
44 Ga0070710_10000303 3300005437 Bacteria 23421
45 Ga0070701_10005940 3300005438 Bacteria 5098
46 Ga0070701_10473406 3300005438 Bacteria 808
47 Ga0070711_100000758 3300005439 Bacteria 16795
48 Ga0070700_100033691 3300005441 Bacteria 3087
49 Ga0070694_100009581 3300005444 Bacteria 5942
50 Ga0070663_100015543 3300005455 Bacteria 4918
51 Ga0070663_100799579 3300005455 Bacteria 809
52 Ga0070678_100009950 3300005456 Bacteria 5783
53 Ga0070678_100130433 3300005456 Bacteria 1996
54 Ga0070678_100423979 3300005456 Bacteria 1160
55 Ga0070662_100010480 3300005457 Bacteria 6085
56 Ga0070662_100914255 3300005457 Bacteria 749
57 Ga0068867_100041891 3300005459 Bacteria 3346
58 Ga0070685_10104989 3300005466 Bacteria 1731
59 Ga0070698_100549818 3300005471 Bacteria 1094
60 Ga0068853_100009537 3300005539 Bacteria 7822
61 Ga0068853_101666923 3300005539 Bacteria 618
62 Ga0070672_100557072 3300005543 Bacteria 996
63 Ga0070686_100025532 3300005544 Bacteria 3556
64 Ga0070686_100404800 3300005544 Bacteria 1039
65 Ga0070695_100018020 3300005545 Bacteria 4287
66 Ga0070696_100018976 3300005546 Bacteria 4655
67 Ga0070693_100007670 3300005547 Bacteria 5284
68 Ga0070665_100008504 3300005548 Bacteria 10380
69 Ga0070665_100047291 3300005548 Bacteria 4319
70 Ga0070665_100200898 3300005548 Bacteria 1994
71 Ga0070704_100009490 3300005549 Bacteria 5883
72 Ga0068855_100009246 3300005563 Bacteria 11906
73 Ga0068855_100094543 3300005563 Bacteria 3446
74 Ga0068857_100271006 3300005577 Bacteria 1560
75 Ga0068854_100000552 3300005578 Bacteria 22587
76 Ga0068854_100003387 3300005578 Bacteria 9937
77 Ga0068854_100322902 3300005578 Bacteria 1255
78 Ga0068854_100464958 3300005578 Bacteria 1059
79 Ga0068856_100129802 3300005614 Bacteria 2525
80 Ga0068856_100231712 3300005614 Bacteria 1862
81 Ga0070702_100030641 3300005615 Bacteria 2934
82 Ga0070702_100363694 3300005615 Bacteria 1023
83 Ga0070702_101016400 3300005615 Bacteria 657
84 Ga0068852_100015881 3300005616 Bacteria 5856
85 Ga0068852_100125217 3300005616 Bacteria 2359
86 Ga0068852_102608376 3300005616 Bacteria 525
87 Ga0068859_100038220 3300005617 Bacteria 4816
88 Ga0068864_101616512 3300005618 Bacteria 652
89 Ga0068866_10075039 3300005718 Bacteria 1799
90 Ga0068866_10532660 3300005718 Bacteria 782
91 Ga0068861_100005501 3300005719 Bacteria 8582
92 Ga0068851_10066977 3300005834 Bacteria 1851
93 Ga0068863_100150958 3300005841 Bacteria 2223
94 Ga0068858_100018868 3300005842 Bacteria 6453
95 Ga0068860_100000694 3300005843 Bacteria 38692
96 Ga0068860_100154328 3300005843 Bacteria 2212
97 Ga0068862_100012356 3300005844 Bacteria 7059
98 Ga0068862_100261514 3300005844 Bacteria 1580
99 Ga0081455_10175069 3300005937 Bacteria 1630
100 Ga0081539_10000146 3300005985 Bacteria 164571
101 Ga0070717_11514959 3300006028 Unclassified 608
102 Ga0075364_10178572 3300006051 Bacteria 1436
103 Ga0070715_10002537 3300006163 Bacteria 5629
104 Ga0070716_100489088 3300006173 Bacteria 905
105 Ga0070712_100000640 3300006175 Bacteria 20589
106 Ga0068871_100035218 3300006358 Bacteria 3976
107 Ga0068871_100041018 3300006358 Bacteria 3710
108 Ga0075428_100001529 3300006844 Bacteria 24749
109 Ga0075431_100016579 3300006847 Bacteria 7478
110 Ga0068865_100000497 3300006881 Bacteria 22023
111 Ga0068865_100075210 3300006881 Bacteria 2408
112 Ga0097620_100038219 3300006931 Bacteria 4816
113 Ga0105240_10033577 3300009093 Bacteria 6625
114 Ga0105240_10986834 3300009093 Bacteria 902
115 Ga0105245_10108207 3300009098 Bacteria 2581
116 Ga0105245_10467879 3300009098 Bacteria 1272
117 Ga0105247_10000541 3300009101 Bacteria 30700
118 Ga0114129_10107240 3300009147 Bacteria 3858
119 Ga0105243_10001274 3300009148 Bacteria 22612
120 Ga0105243_11090708 3300009148 Bacteria 806
121 Ga0105241_10002372 3300009174 Bacteria 14154
122 Ga0105241_10030092 3300009174 Bacteria 4055
123 Ga0105242_10000572 3300009176 Bacteria 29126
124 Ga0105242_10001978 3300009176 Bacteria 16115
125 Ga0105248_10014365 3300009177 Bacteria 8714
126 Ga0105248_10113619 3300009177 Bacteria 3054
127 Ga0105237_10014665 3300009545 Bacteria 8185
128 Ga0105237_10027200 3300009545 Bacteria 5840
129 Ga0105238_10006231 3300009551 Bacteria 11849
130 Ga0105238_10976421 3300009551 Bacteria 867
131 Ga0105249_10007752 3300009553 Bacteria 9357
132 Ga0105029_104528 3300009984 Bacteria 958
133 Ga0105035_117970 3300009988 Bacteria 662
134 Ga0105239_10018086 3300010375 Bacteria 7794
135 Ga0157369_10186403 3300013105 Bacteria 2182
136 Ga0157369_10226803 3300013105 Bacteria 1954
137 Ga0157369_10387341 3300013105 Bacteria 1451
138 Ga0157374_11035585 3300013296 Bacteria 840
139 Ga0157378_10004026 3300013297 Bacteria 12978
140 Ga0157378_10143608 3300013297 Bacteria 2218
141 Ga0163162_10003207 3300013306 Bacteria 15651
142 Ga0157372_10015696 3300013307 Bacteria 8122
143 Ga0157372_10795302 3300013307 Bacteria 1099
144 Ga0157375_10003918 3300013308 Bacteria 12910
145 Ga0157375_10274664 3300013308 Bacteria 1847
146 Ga0157515_152242 3300013875 Bacteria 935
147 Ga0157380_10003265 3300014326 Bacteria 11111
148 Ga0157380_11910795 3300014326 Bacteria 654
149 Ga0157377_10627112 3300014745 Bacteria 771
150 Ga0157379_10019220 3300014968 Bacteria 6034
151 Ga0157379_10620130 3300014968 Bacteria 1011
152 Ga0157376_10141967 3300014969 Bacteria 2156
153 Ga0157376_10252946 3300014969 Bacteria 1646
154 Ga0163161_10002789 3300017792 Bacteria 12383
155 Ga0163161_10432256 3300017792 Bacteria 1061
156 Ga0209051_1002075 3300025303 Bacteria 15149
157 Ga0207656_10190742 3300025321 Bacteria 987
158 Ga0207692_10002753 3300025898 Bacteria 6775
159 Ga0207692_10139169 3300025898 Bacteria 1379
160 Ga0207642_10170446 3300025899 Bacteria 1177
161 Ga0207642_10295018 3300025899 Bacteria 938
162 Ga0207710_10012255 3300025900 Bacteria 3607
163 Ga0207688_10007262 3300025901 Bacteria 6030
164 Ga0207680_10066790 3300025903 Bacteria 2213
165 Ga0207647_10055836 3300025904 Bacteria 2425
166 Ga0207647_10060815 3300025904 Bacteria 2308
167 Ga0207647_10141367 3300025904 Bacteria 1410
168 Ga0207645_10020933 3300025907 Bacteria 4272
169 Ga0207654_10148603 3300025911 Bacteria 1502
170 Ga0207695_10006099 3300025913 Bacteria 15728
171 Ga0207695_10580963 3300025913 Bacteria 1002
172 Ga0207671_10000550 3300025914 Bacteria 50545
173 Ga0207671_10025319 3300025914 Bacteria 4457
174 Ga0207693_10000174 3300025915 Bacteria 58853
175 Ga0207663_10118838 3300025916 Bacteria 1806
176 Ga0207660_10290761 3300025917 Bacteria 1299
177 Ga0207662_10018651 3300025918 Bacteria 3941
178 Ga0207662_10328753 3300025918 Bacteria 1022
179 Ga0207657_10369804 3300025919 Bacteria 1130
180 Ga0207681_10073333 3300025923 Bacteria 2394
181 Ga0207694_10000877 3300025924 Bacteria 26760
182 Ga0207694_10001865 3300025924 Bacteria 17518
183 Ga0207694_10570059 3300025924 Bacteria 951
184 Ga0207687_10091251 3300025927 Bacteria 2222
185 Ga0207687_10252103 3300025927 Bacteria 1404
186 Ga0207644_10106081 3300025931 Bacteria 2118
187 Ga0207690_10142962 3300025932 Bacteria 1765
188 Ga0207706_10013520 3300025933 Bacteria 7418
189 Ga0207706_11212052 3300025933 Bacteria 627
190 Ga0207686_10015617 3300025934 Bacteria 4248
191 Ga0207709_10006274 3300025935 Bacteria 6679
192 Ga0207670_10082126 3300025936 Bacteria 2258
193 Ga0207670_10668744 3300025936 Bacteria 857
194 Ga0207669_10033826 3300025937 Bacteria 2890
195 Ga0207669_10071353 3300025937 Bacteria 2181
196 Ga0207704_10017267 3300025938 Bacteria 3735
197 Ga0207704_10026536 3300025938 Bacteria 3180
198 Ga0207665_10265041 3300025939 Bacteria 1274
199 Ga0207665_10542245 3300025939 Bacteria 903
200 Ga0207691_10159789 3300025940 Bacteria 1978
201 Ga0207711_10030471 3300025941 Bacteria 4550
202 Ga0207711_10125675 3300025941 Bacteria 2294
203 Ga0207711_10446707 3300025941 Bacteria 1203
204 Ga0207689_10020342 3300025942 Bacteria 5588
205 Ga0207667_10047533 3300025949 Bacteria 4542
206 Ga0207667_12040056 3300025949 Bacteria 533
207 Ga0207651_11255048 3300025960 Bacteria 666
208 Ga0207712_10205801 3300025961 Bacteria 1564
209 Ga0207668_10001110 3300025972 Bacteria 16019
210 Ga0207668_10072339 3300025972 Bacteria 2466
211 Ga0207668_10157070 3300025972 Bacteria 1768
212 Ga0207640_10010974 3300025981 Bacteria 5115
213 Ga0207640_10407742 3300025981 Bacteria 1108
214 Ga0207658_10021232 3300025986 Bacteria 4504
215 Ga0207658_10061441 3300025986 Bacteria 2808
216 Ga0207677_10028745 3300026023 Bacteria 3522
217 Ga0207703_10273925 3300026035 Bacteria 1530
218 Ga0207639_10088249 3300026041 Bacteria 2474
219 Ga0207639_11216564 3300026041 Bacteria 707
220 Ga0207678_10015747 3300026067 Bacteria 6645
221 Ga0207678_10766347 3300026067 Bacteria 851
222 Ga0207708_10063527 3300026075 Bacteria 2821
223 Ga0207702_10075837 3300026078 Bacteria 2905
224 Ga0207641_10085856 3300026088 Bacteria 2743
225 Ga0207648_10002050 3300026089 Bacteria 21946
226 Ga0207648_10010060 3300026089 Bacteria 8998
227 Ga0207676_12053074 3300026095 Bacteria 570
228 Ga0207674_10492175 3300026116 Bacteria 1185
229 Ga0207675_100000185 3300026118 Bacteria 56425
230 Ga0207683_10032027 3300026121 Bacteria 4565
231 Ga0207683_10155491 3300026121 Bacteria 2065
232 Ga0207698_10026638 3300026142 Bacteria 4092
233 Ga0207698_10125931 3300026142 Bacteria 2178
234 Ga0268266_10085435 3300028379 Bacteria 2757
235 Ga0268266_10092837 3300028379 Bacteria 2649
236 Ga0268266_10257874 3300028379 Bacteria 1615
237 Ga0268265_10113115 3300028380 Bacteria 2220
238 Ga0268264_10001293 3300028381 Bacteria 23636
239 Ga0307515_10310579 3300028794 Bacteria 1252
240 Ga0307515_10574980 3300028794 Bacteria 737
241 Ga0307512_10059518 3300030522 Bacteria 2963
242 Ga0307512_10225727 3300030522 Bacteria 971
243 Ga0316177_1219150 3300030731 Bacteria 2628
244 Ga0316176_1059859 3300030732 Bacteria 5341
245 Ga0316178_1113448 3300030735 Bacteria 1688
246 Ga0316180_1083973 3300030736 Bacteria 1559
247 Ga0307513_10103137 3300031456 Bacteria 2869
248 Ga0307508_10281656 3300031616 Bacteria 1256
249 Ga0307508_10372523 3300031616 Bacteria 1019
250 Ga0307514_10118299 3300031649 Bacteria 1856
251 Ga0307516_10018442 3300031730 Bacteria 7252
252 Ga0307516_10207877 3300031730 Bacteria 1673
253 Ga0307405_10308930 3300031731 Bacteria 1203
254 Ga0307413_10001375 3300031824 Bacteria 9145
255 Ga0307413_10027742 3300031824 Bacteria 3143
256 Ga0307518_10000213 3300031838 Bacteria 43894
257 Ga0307518_10057442 3300031838 Bacteria 2827
258 Ga0307518_10131959 3300031838 Bacteria 1754
259 Ga0307518_10170892 3300031838 Bacteria 1482
260 Ga0307406_10286941 3300031901 Bacteria 1258
261 Ga0307407_10730704 3300031903 Bacteria 748
262 Ga0307407_10989074 3300031903 Bacteria 649
263 Ga0307411_10002289 3300032005 Bacteria 8388
264 Ga0307510_10047996 3300033180 Bacteria 4562
265 Ga0373928_0031971 3300035084 Bacteria 1171
266 Ga0373940_0009562 3300035088 Bacteria 2257
267 Ga0373952_0155424 3300035092 Bacteria 644
268 Ga0373942_0001801 3300035207 Bacteria 5426
269 Ga0373931_0251243 3300035691 Bacteria 1075
270 Ga0395898_0016590 3300037466 Bacteria 7530
271 Ga0451787_136281 3300041441 Bacteria 759
272 Ga0451797_0504512 3300041453 Bacteria 1069
273 Ga0451800_0070477 3300041459 Bacteria 842
274 Ga0451802_0610132 3300041460 Bacteria 608
275 Ga0451841_0830456 3300041498 Bacteria 799
276 Ga0466972_0001234 3300044658 Bacteria 12313
277 Ga0466965_0007070 3300044683 Bacteria 5137
278 Ga0466965_0060464 3300044683 Bacteria 1892
279 Ga0466965_0233272 3300044683 Bacteria 983
280 Ga0466960_0142889 3300044901 Bacteria 1272
281 Ga0466958_0181726 3300045836 Bacteria 1335
282 Ga0466967_0000285 3300045976 Bacteria 22474
283 Ga0466967_0086634 3300045976 Bacteria 2838
284 Ga0495627_023126 3300046453 Bacteria 2039
285 Ga0495603_0072167 3300046455 Bacteria 2028
286 Ga0495638_0008852 3300046460 Bacteria 7104
287 Ga0495638_0093616 3300046460 Bacteria 1807
288 Ga0495650_0258908 3300046471 Bacteria 590
289 Ga0495607_0303188 3300046501 Bacteria 751
290 Ga0495583_0294243 3300046506 Bacteria 646
291 Ga0495618_0209662 3300046514 Bacteria 1232
292 Ga0495631_0122413 3300046518 Bacteria 1119
293 Ga0495666_0244223 3300046526 Bacteria 819
294 Ga0495597_0135064 3300046542 Bacteria 1021
295 Ga0495622_0340124 3300046557 Bacteria 650
296 Ga0495611_0018063 3300046648 Bacteria 3023
297 Ga0495625_0032615 3300046660 Bacteria 3860
298 Ga0495625_0056345 3300046660 Bacteria 2799
299 Ga0495625_0088226 3300046660 Bacteria 2149
300 Ga0495659_0366901 3300046664 Bacteria 617
301 Ga0495647_0092677 3300046681 Bacteria 1241
302 Ga0495613_0035293 3300046689 Bacteria 3711
303 Ga0495624_0866770 3300046690 Bacteria 532
304 Ga0495670_0332947 3300046691 Bacteria 816
305 Ga0495589_0007507 3300046794 Bacteria 5712
306 Ga0495581_0100086 3300047315 Bacteria 1684
307 Ga0495676_0036255 3300047321 Bacteria 4120
308 Ga0495676_0117688 3300047321 Bacteria 1938
309 Ga0495687_101251 3300047443 Bacteria 1080
310 Ga0495685_002808 3300047447 Bacteria 5489
311 Ga0495685_032643 3300047447 Bacteria 1789
312 Ga0495593_0136926 3300047673 Bacteria 1241
313 Ga0495626_0246807 3300048091 Bacteria 717
314 Ga0496100_0002206 3300048903 Bacteria 9828
315 Ga0496100_0003057 3300048903 Bacteria 8644
316 Ga0496101_0000176 3300048904 Bacteria 51135
317 Ga0496101_0026152 3300048904 Bacteria 4056
318 Ga0496102_0001430 3300048905 Bacteria 21187
319 Ga0496103_0000570 3300048906 Bacteria 29250
320 Ga0496103_0498023 3300048906 Bacteria 780
321 Ga0496104_0015578 3300048907 Bacteria 6890
322 Ga0496104_0033594 3300048907 Bacteria 4781
323 Ga0496105_0013734 3300048908 Bacteria 6431
324 Ga0496105_0040407 3300048908 Bacteria 3846
325 Ga0496106_0000351 3300048909 Bacteria 32650
326 Ga0496106_0001063 3300048909 Bacteria 20256
327 Ga0496107_0009908 3300048910 Bacteria 6612
328 Ga0496107_0013016 3300048910 Bacteria 5812
329 Ga0496108_0203571 3300048911 Bacteria 1718
330 Ga0496109_0266834 3300048912 Bacteria 1613
331 Ga0496110_0986918 3300048913 Bacteria 749
332 Ga0496111_0066608 3300048914 Bacteria 2616
333 Ga0496113_0396545 3300048916 Bacteria 1108
334 Ga0496114_0005152 3300048917 Bacteria 10196
335 Ga0496114_0021466 3300048917 Bacteria 5254
336 Ga0496114_0077566 3300048917 Bacteria 2801
337 Ga0496115_0024950 3300048918 Bacteria 4651
338 Ga0496115_0039425 3300048918 Bacteria 3751
339 Ga0501032_0983026 3300049569 Bacteria 530
340 Ga0501036_0265430 3300049572 Bacteria 1438
341 Ga0501038_0058219 3300049574 Bacteria 3314
342 Ga0501043_0242951 3300049579 Bacteria 1388
343 Ga0501072_0020702 3300049588 Bacteria 5098
344 Ga0501035_0281982 3300049822 Bacteria 1404
345 Ga0501044_0196363 3300049823 Bacteria 1978
346 Ga0501044_0489914 3300049823 Bacteria 1131
347 nmdc:mga05p37_72343_c1 3300050507 Bacteria 4242
348 nmdc:mga0qj67_109733_c1 3300050509 Bacteria 2227
349 nmdc:mga06r32_7364_c2 3300050510 Bacteria 7262
350 nmdc:mga0sz30_260780_c1 3300050516 Bacteria 772
351 Ga0495655_0149573 3300053083 Bacteria 733
352 Ga0500644_0202718 3300053088 Bacteria 821
353 Ga0500644_0468475 3300053088 Bacteria 553
354 Ga0500660_011837 3300053100 Bacteria 4706
355 Ga0500556_0206318 3300053104 Bacteria 776
356 Ga0500562_014512 3300053108 Bacteria 2017
357 Ga0500569_266418 3300053109 Bacteria 580
358 Ga0500568_0278936 3300053139 Bacteria 607
359 Ga0500589_227419 3300053147 Bacteria 699
360 Ga0500600_0084994 3300053149 Bacteria 1702
361 Ga0500600_0135920 3300053149 Bacteria 1245
362 Ga0500604_0055669 3300053151 Bacteria 1231
363 Ga0500616_0004538 3300053153 Bacteria 9841
364 Ga0500616_0085212 3300053153 Bacteria 1579
365 Ga0501084_0000252 3300054114 Bacteria 40523
366 Ga0501084_1589953 3300054114 Bacteria 547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_1589953 Ga0501084_1589953_92_496 125
2 3300049588 Ga0501072_0020702 Ga0501072_0020702_3366_3770 126
3 3300054114 Ga0501084_0000252 Ga0501084_0000252_1944_2348 126
4 3300005457 Ga0070662_100914255 Ga0070662_1009142552 129
5 3300006028 Ga0070717_11514959 Ga0070717_115149592 129
6 3300035084 Ga0373928_0031971 Ga0373928_0031971_553_942 129
7 3300035088 Ga0373940_0009562 Ga0373940_0009562_809_1204 129
8 3300035207 Ga0373942_0001801 Ga0373942_0001801_93_488 129
9 3300035691 Ga0373931_0251243 Ga0373931_0251243_643_1032 129
10 3300041453 Ga0451797_0504512 Ga0451797_0504512_100_489 129
11 3300041460 Ga0451802_0610132 Ga0451802_0610132_32_421 129
12 3300046453 Ga0495627_023126 Ga0495627_023126_22_411 129
13 3300046526 Ga0495666_0244223 Ga0495666_0244223_16_405 129
14 3300046664 Ga0495659_0366901 Ga0495659_0366901_217_606 129
15 3300046681 Ga0495647_0092677 Ga0495647_0092677_217_606 129
16 3300053083 Ga0495655_0149573 Ga0495655_0149573_29_418 129
17 3300053104 Ga0500556_0206318 Ga0500556_0206318_14_403 129
18 3300053139 Ga0500568_0278936 Ga0500568_0278936_39_428 129
19 3300005844 Ga0068862_100261514 Ga0068862_1002615142 130
20 3300046514 Ga0495618_0209662 Ga0495618_0209662_775_1188 132
21 3300047321 Ga0495676_0117688 Ga0495676_0117688_1012_1425 132
22 3300047673 Ga0495593_0136926 Ga0495593_0136926_666_1079 132
23 3300053149 Ga0500600_0084994 Ga0500600_0084994_1267_1677 136
24 iso_pu_bacteria 8003314358 8003317512 136
25 3300005437 Ga0070710_10000142 Ga0070710_100001428 137
26 3300025898 Ga0207692_10002753 Ga0207692_100027533 137
27 3300044658 Ga0466972_0001234 Ga0466972_0001234_6292_6708 137
28 3300044683 Ga0466965_0060464 Ga0466965_0060464_851_1267 137
29 3300044683 Ga0466965_0233272 Ga0466965_0233272_202_618 137
30 3300044901 Ga0466960_0142889 Ga0466960_0142889_723_1139 137
31 3300003203 JGI25406J46586_10013105 JGI25406J46586_100131052 138
32 3300005985 Ga0081539_10000146 Ga0081539_10000146139 138
33 3300009984 Ga0105029_104528 Ga0105029_1045282 138
34 3300009988 Ga0105035_117970 Ga0105035_1179702 138
35 3300013875 Ga0157515_152242 Ga0157515_1522422 138
36 3300031838 Ga0307518_10131959 Ga0307518_101319592 138
37 3300053088 Ga0500644_0202718 Ga0500644_0202718_351_767 138
38 3300005544 Ga0070686_100404800 Ga0070686_1004048002 139
39 3300030522 Ga0307512_10225727 Ga0307512_102257272 139
40 iso_pu_bacteria 2582580736 2583150905 139
41 iso_pu_bacteria 2582581314 2585312732 139
42 iso_pu_bacteria 2585427649 2586060861 139
43 iso_pu_bacteria 2616644814 2616693591 139
44 iso_pu_bacteria 2808606522 2809590131 139
45 iso_pu_bacteria 2862574272 2862580857 139
46 iso_pu_bacteria 2867302475 2867307365 139
47 iso_pu_bacteria 2867312974 2867315008 139
48 iso_pu_bacteria 2867319477 2867319995 139
49 iso_pu_bacteria 2939582691 2939589238 139
50 iso_pu_bacteria 8047710418 8047713048 139
51 iso_pu_bacteria 8056060235 8056063541 139
52 3300005365 Ga0070688_100836741 Ga0070688_1008367412 140
53 3300005438 Ga0070701_10473406 Ga0070701_104734061 140
54 3300005466 Ga0070685_10104989 Ga0070685_101049893 140
55 3300005578 Ga0068854_100322902 Ga0068854_1003229023 140
56 3300005615 Ga0070702_100363694 Ga0070702_1003636942 140
57 3300005618 Ga0068864_101616512 Ga0068864_1016165122 140
58 3300005843 Ga0068860_100154328 Ga0068860_1001543282 140
59 3300006173 Ga0070716_100489088 Ga0070716_1004890882 140
60 3300006358 Ga0068871_100035218 Ga0068871_1000352181 140
61 3300006881 Ga0068865_100075210 Ga0068865_1000752102 140
62 3300009176 Ga0105242_10001978 Ga0105242_100019785 140
63 3300013297 Ga0157378_10143608 Ga0157378_101436082 140
64 3300025918 Ga0207662_10018651 Ga0207662_100186512 140
65 3300025936 Ga0207670_10668744 Ga0207670_106687442 140
66 3300025937 Ga0207669_10033826 Ga0207669_100338262 140
67 3300025938 Ga0207704_10026536 Ga0207704_100265366 140
68 3300025939 Ga0207665_10542245 Ga0207665_105422452 140
69 3300025941 Ga0207711_10446707 Ga0207711_104467072 140
70 3300025960 Ga0207651_11255048 Ga0207651_112550482 140
71 3300026089 Ga0207648_10002050 Ga0207648_1000205016 140
72 3300026095 Ga0207676_12053074 Ga0207676_120530741 140
73 3300031616 Ga0307508_10372523 Ga0307508_103725231 140
74 3300048906 Ga0496103_0498023 Ga0496103_0498023_88_513 140
75 3300048907 Ga0496104_0015578 Ga0496104_0015578_3383_3808 140
76 3300048908 Ga0496105_0013734 Ga0496105_0013734_72_497 140
77 3300048913 Ga0496110_0986918 Ga0496110_0986918_39_464 140
78 3300048914 Ga0496111_0066608 Ga0496111_0066608_1073_1498 140
79 3300048917 Ga0496114_0077566 Ga0496114_0077566_169_594 140
80 3300005347 Ga0070668_100004518 Ga0070668_1000045184 141
81 3300005435 Ga0070714_100380185 Ga0070714_1003801852 141
82 3300005937 Ga0081455_10175069 Ga0081455_101750692 141
83 3300030731 Ga0316177_1219150 Ga0316177_12191502 141
84 3300030735 Ga0316178_1113448 Ga0316178_11134482 141
85 3300030736 Ga0316180_1083973 Ga0316180_10839732 141
86 3300031824 Ga0307413_10027742 Ga0307413_100277423 141
87 3300005539 Ga0068853_101666923 Ga0068853_1016669231 142
88 3300005548 Ga0070665_100047291 Ga0070665_1000472913 142
89 3300005563 Ga0068855_100009246 Ga0068855_1000092465 142
90 3300005578 Ga0068854_100003387 Ga0068854_1000033878 142
91 3300005614 Ga0068856_100129802 Ga0068856_1001298022 142
92 3300005616 Ga0068852_100015881 Ga0068852_1000158813 142
93 3300005834 Ga0068851_10066977 Ga0068851_100669772 142
94 3300009093 Ga0105240_10033577 Ga0105240_100335773 142
95 3300009174 Ga0105241_10002372 Ga0105241_100023729 142
96 3300009545 Ga0105237_10027200 Ga0105237_100272001 142
97 3300009551 Ga0105238_10006231 Ga0105238_100062319 142
98 3300013105 Ga0157369_10186403 Ga0157369_101864032 142
99 3300013307 Ga0157372_10795302 Ga0157372_107953022 142
100 3300014745 Ga0157377_10627112 Ga0157377_106271122 142
101 3300025321 Ga0207656_10190742 Ga0207656_101907421 142
102 3300025904 Ga0207647_10055836 Ga0207647_100558363 142
103 3300025913 Ga0207695_10006099 Ga0207695_100060999 142
104 3300025914 Ga0207671_10000550 Ga0207671_100005509 142
105 3300025924 Ga0207694_10000877 Ga0207694_100008775 142
106 3300025924 Ga0207694_10001865 Ga0207694_100018655 142
107 3300025949 Ga0207667_12040056 Ga0207667_120400561 142
108 3300025981 Ga0207640_10407742 Ga0207640_104077422 142
109 3300026041 Ga0207639_11216564 Ga0207639_112165641 142
110 3300026078 Ga0207702_10075837 Ga0207702_100758371 142
111 3300026142 Ga0207698_10026638 Ga0207698_100266383 142
112 3300028379 Ga0268266_10085435 Ga0268266_100854352 142
113 3300046557 Ga0495622_0340124 Ga0495622_0340124_152_580 142
114 3300047315 Ga0495581_0100086 Ga0495581_0100086_543_971 142
115 3300001979 JGI24740J21852_10012372 JGI24740J21852_100123723 143
116 3300001989 JGI24739J22299_10015276 JGI24739J22299_100152762 143
117 3300001989 JGI24739J22299_10165925 JGI24739J22299_101659251 143
118 3300001990 JGI24737J22298_10006123 JGI24737J22298_100061234 143
119 3300002067 JGI24735J21928_10113113 JGI24735J21928_101131132 143
120 3300002067 JGI24735J21928_10177148 JGI24735J21928_101771481 143
121 3300002070 JGI24750J21931_1025539 JGI24750J21931_10255392 143
122 3300002074 JGI24748J21848_1002823 JGI24748J21848_10028232 143
123 3300002076 JGI24749J21850_1052414 JGI24749J21850_10524142 143
124 3300002077 JGI24744J21845_10029769 JGI24744J21845_100297692 143
125 3300002239 JGI24034J26672_10003156 JGI24034J26672_100031562 143
126 3300002244 JGI24742J22300_10012669 JGI24742J22300_100126691 143
127 3300003792 Ga0055540_1012653 Ga0055540_10126534 143
128 3300005328 Ga0070676_10044018 Ga0070676_100440182 143
129 3300005330 Ga0070690_100074061 Ga0070690_1000740613 143
130 3300005334 Ga0068869_100007426 Ga0068869_1000074265 143
131 3300005335 Ga0070666_10124469 Ga0070666_101244691 143
132 3300005336 Ga0070680_100193124 Ga0070680_1001931243 143
133 3300005337 Ga0070682_100161074 Ga0070682_1001610742 143
134 3300005337 Ga0070682_100241827 Ga0070682_1002418271 143
135 3300005338 Ga0068868_100170155 Ga0068868_1001701553 143
136 3300005338 Ga0068868_100516512 Ga0068868_1005165122 143
137 3300005339 Ga0070660_100502262 Ga0070660_1005022622 143
138 3300005340 Ga0070689_100000990 Ga0070689_10000099015 143
139 3300005343 Ga0070687_100037239 Ga0070687_1000372394 143
140 3300005347 Ga0070668_100001103 Ga0070668_1000011036 143
141 3300005347 Ga0070668_100087658 Ga0070668_1000876584 143
142 3300005353 Ga0070669_100028965 Ga0070669_1000289655 143
143 3300005354 Ga0070675_100077723 Ga0070675_1000777234 143
144 3300005355 Ga0070671_100082203 Ga0070671_1000822032 143
145 3300005356 Ga0070674_100000673 Ga0070674_10000067311 143
146 3300005356 Ga0070674_100068783 Ga0070674_1000687832 143
147 3300005365 Ga0070688_100036687 Ga0070688_1000366873 143
148 3300005366 Ga0070659_100012189 Ga0070659_1000121895 143
149 3300005367 Ga0070667_100117012 Ga0070667_1001170123 143
150 3300005367 Ga0070667_100189279 Ga0070667_1001892793 143
151 3300005406 Ga0070703_10238964 Ga0070703_102389642 143
152 3300005434 Ga0070709_10058578 Ga0070709_100585784 143
153 3300005437 Ga0070710_10000303 Ga0070710_100003032 143
154 3300005438 Ga0070701_10005940 Ga0070701_100059404 143
155 3300005439 Ga0070711_100000758 Ga0070711_10000075814 143
156 3300005441 Ga0070700_100033691 Ga0070700_1000336915 143
157 3300005444 Ga0070694_100009581 Ga0070694_1000095814 143
158 3300005455 Ga0070663_100015543 Ga0070663_1000155432 143
159 3300005455 Ga0070663_100799579 Ga0070663_1007995792 143
160 3300005456 Ga0070678_100009950 Ga0070678_1000099504 143
161 3300005456 Ga0070678_100130433 Ga0070678_1001304333 143
162 3300005456 Ga0070678_100423979 Ga0070678_1004239792 143
163 3300005457 Ga0070662_100010480 Ga0070662_1000104805 143
164 3300005459 Ga0068867_100041891 Ga0068867_1000418912 143
165 3300005471 Ga0070698_100549818 Ga0070698_1005498182 143
166 3300005539 Ga0068853_100009537 Ga0068853_1000095376 143
167 3300005543 Ga0070672_100557072 Ga0070672_1005570722 143
168 3300005544 Ga0070686_100025532 Ga0070686_1000255323 143
169 3300005545 Ga0070695_100018020 Ga0070695_1000180202 143
170 3300005546 Ga0070696_100018976 Ga0070696_1000189763 143
171 3300005547 Ga0070693_100007670 Ga0070693_1000076703 143
172 3300005548 Ga0070665_100008504 Ga0070665_1000085048 143
173 3300005548 Ga0070665_100200898 Ga0070665_1002008983 143
174 3300005549 Ga0070704_100009490 Ga0070704_1000094904 143
175 3300005563 Ga0068855_100094543 Ga0068855_1000945434 143
176 3300005577 Ga0068857_100271006 Ga0068857_1002710062 143
177 3300005578 Ga0068854_100000552 Ga0068854_1000005525 143
178 3300005578 Ga0068854_100464958 Ga0068854_1004649582 143
179 3300005614 Ga0068856_100231712 Ga0068856_1002317122 143
180 3300005615 Ga0070702_100030641 Ga0070702_1000306413 143
181 3300005615 Ga0070702_101016400 Ga0070702_1010164001 143
182 3300005616 Ga0068852_100125217 Ga0068852_1001252172 143
183 3300005616 Ga0068852_102608376 Ga0068852_1026083761 143
184 3300005617 Ga0068859_100038220 Ga0068859_1000382202 143
185 3300005718 Ga0068866_10075039 Ga0068866_100750393 143
186 3300005718 Ga0068866_10532660 Ga0068866_105326602 143
187 3300005719 Ga0068861_100005501 Ga0068861_1000055019 143
188 3300005841 Ga0068863_100150958 Ga0068863_1001509582 143
189 3300005842 Ga0068858_100018868 Ga0068858_1000188684 143
190 3300005843 Ga0068860_100000694 Ga0068860_10000069434 143
191 3300005844 Ga0068862_100012356 Ga0068862_1000123564 143
192 3300006051 Ga0075364_10178572 Ga0075364_101785721 143
193 3300006163 Ga0070715_10002537 Ga0070715_100025373 143
194 3300006175 Ga0070712_100000640 Ga0070712_10000064016 143
195 3300006358 Ga0068871_100041018 Ga0068871_1000410182 143
196 3300006844 Ga0075428_100001529 Ga0075428_10000152924 143
197 3300006847 Ga0075431_100016579 Ga0075431_1000165793 143
198 3300006881 Ga0068865_100000497 Ga0068865_10000049717 143
199 3300006931 Ga0097620_100038219 Ga0097620_1000382192 143
200 3300009093 Ga0105240_10986834 Ga0105240_109868342 143
201 3300009098 Ga0105245_10108207 Ga0105245_101082072 143
202 3300009098 Ga0105245_10467879 Ga0105245_104678792 143
203 3300009101 Ga0105247_10000541 Ga0105247_100005416 143
204 3300009147 Ga0114129_10107240 Ga0114129_101072405 143
205 3300009148 Ga0105243_10001274 Ga0105243_100012744 143
206 3300009148 Ga0105243_11090708 Ga0105243_110907082 143
207 3300009174 Ga0105241_10030092 Ga0105241_100300924 143
208 3300009176 Ga0105242_10000572 Ga0105242_1000057220 143
209 3300009177 Ga0105248_10014365 Ga0105248_100143657 143
210 3300009177 Ga0105248_10113619 Ga0105248_101136193 143
211 3300009545 Ga0105237_10014665 Ga0105237_100146657 143
212 3300009551 Ga0105238_10976421 Ga0105238_109764212 143
213 3300009553 Ga0105249_10007752 Ga0105249_100077528 143
214 3300010375 Ga0105239_10018086 Ga0105239_100180863 143
215 3300013105 Ga0157369_10226803 Ga0157369_102268033 143
216 3300013105 Ga0157369_10387341 Ga0157369_103873412 143
217 3300013296 Ga0157374_11035585 Ga0157374_110355851 143
218 3300013297 Ga0157378_10004026 Ga0157378_100040268 143
219 3300013306 Ga0163162_10003207 Ga0163162_100032078 143
220 3300013307 Ga0157372_10015696 Ga0157372_100156966 143
221 3300013308 Ga0157375_10003918 Ga0157375_100039188 143
222 3300013308 Ga0157375_10274664 Ga0157375_102746641 143
223 3300014326 Ga0157380_10003265 Ga0157380_100032655 143
224 3300014326 Ga0157380_11910795 Ga0157380_119107952 143
225 3300014968 Ga0157379_10019220 Ga0157379_100192204 143
226 3300014968 Ga0157379_10620130 Ga0157379_106201302 143
227 3300014969 Ga0157376_10141967 Ga0157376_101419673 143
228 3300014969 Ga0157376_10252946 Ga0157376_102529463 143
229 3300017792 Ga0163161_10002789 Ga0163161_100027899 143
230 3300017792 Ga0163161_10432256 Ga0163161_104322562 143
231 3300025303 Ga0209051_1002075 Ga0209051_100207513 143
232 3300025898 Ga0207692_10139169 Ga0207692_101391692 143
233 3300025899 Ga0207642_10170446 Ga0207642_101704461 143
234 3300025899 Ga0207642_10295018 Ga0207642_102950182 143
235 3300025900 Ga0207710_10012255 Ga0207710_100122553 143
236 3300025901 Ga0207688_10007262 Ga0207688_100072627 143
237 3300025903 Ga0207680_10066790 Ga0207680_100667904 143
238 3300025904 Ga0207647_10060815 Ga0207647_100608152 143
239 3300025904 Ga0207647_10141367 Ga0207647_101413673 143
240 3300025907 Ga0207645_10020933 Ga0207645_100209334 143
241 3300025911 Ga0207654_10148603 Ga0207654_101486032 143
242 3300025913 Ga0207695_10580963 Ga0207695_105809632 143
243 3300025914 Ga0207671_10025319 Ga0207671_100253194 143
244 3300025915 Ga0207693_10000174 Ga0207693_1000017453 143
245 3300025916 Ga0207663_10118838 Ga0207663_101188381 143
246 3300025917 Ga0207660_10290761 Ga0207660_102907612 143
247 3300025918 Ga0207662_10328753 Ga0207662_103287532 143
248 3300025919 Ga0207657_10369804 Ga0207657_103698042 143
249 3300025923 Ga0207681_10073333 Ga0207681_100733332 143
250 3300025924 Ga0207694_10570059 Ga0207694_105700592 143
251 3300025927 Ga0207687_10091251 Ga0207687_100912513 143
252 3300025927 Ga0207687_10252103 Ga0207687_102521032 143
253 3300025931 Ga0207644_10106081 Ga0207644_101060812 143
254 3300025932 Ga0207690_10142962 Ga0207690_101429623 143
255 3300025933 Ga0207706_10013520 Ga0207706_100135204 143
256 3300025933 Ga0207706_11212052 Ga0207706_112120521 143
257 3300025934 Ga0207686_10015617 Ga0207686_100156174 143
258 3300025935 Ga0207709_10006274 Ga0207709_100062743 143
259 3300025936 Ga0207670_10082126 Ga0207670_100821264 143
260 3300025937 Ga0207669_10071353 Ga0207669_100713534 143
261 3300025938 Ga0207704_10017267 Ga0207704_100172672 143
262 3300025939 Ga0207665_10265041 Ga0207665_102650412 143
263 3300025940 Ga0207691_10159789 Ga0207691_101597892 143
264 3300025941 Ga0207711_10030471 Ga0207711_100304714 143
265 3300025941 Ga0207711_10125675 Ga0207711_101256752 143
266 3300025942 Ga0207689_10020342 Ga0207689_100203423 143
267 3300025949 Ga0207667_10047533 Ga0207667_100475331 143
268 3300025961 Ga0207712_10205801 Ga0207712_102058012 143
269 3300025972 Ga0207668_10001110 Ga0207668_1000111012 143
270 3300025972 Ga0207668_10072339 Ga0207668_100723393 143
271 3300025972 Ga0207668_10157070 Ga0207668_101570702 143
272 3300025981 Ga0207640_10010974 Ga0207640_100109743 143
273 3300025986 Ga0207658_10021232 Ga0207658_100212323 143
274 3300025986 Ga0207658_10061441 Ga0207658_100614412 143
275 3300026023 Ga0207677_10028745 Ga0207677_100287453 143
276 3300026035 Ga0207703_10273925 Ga0207703_102739251 143
277 3300026041 Ga0207639_10088249 Ga0207639_100882491 143
278 3300026067 Ga0207678_10015747 Ga0207678_100157475 143
279 3300026067 Ga0207678_10766347 Ga0207678_107663471 143
280 3300026075 Ga0207708_10063527 Ga0207708_100635273 143
281 3300026088 Ga0207641_10085856 Ga0207641_100858563 143
282 3300026089 Ga0207648_10010060 Ga0207648_100100604 143
283 3300026116 Ga0207674_10492175 Ga0207674_104921752 143
284 3300026118 Ga0207675_100000185 Ga0207675_10000018551 143
285 3300026121 Ga0207683_10032027 Ga0207683_100320271 143
286 3300026121 Ga0207683_10155491 Ga0207683_101554911 143
287 3300026142 Ga0207698_10125931 Ga0207698_101259312 143
288 3300028379 Ga0268266_10092837 Ga0268266_100928372 143
289 3300028379 Ga0268266_10257874 Ga0268266_102578741 143
290 3300028380 Ga0268265_10113115 Ga0268265_101131152 143
291 3300028381 Ga0268264_10001293 Ga0268264_1000129320 143
292 3300028794 Ga0307515_10310579 Ga0307515_103105792 143
293 3300028794 Ga0307515_10574980 Ga0307515_105749801 143
294 3300030522 Ga0307512_10059518 Ga0307512_100595182 143
295 3300030732 Ga0316176_1059859 Ga0316176_10598592 143
296 3300031456 Ga0307513_10103137 Ga0307513_101031372 143
297 3300031616 Ga0307508_10281656 Ga0307508_102816562 143
298 3300031649 Ga0307514_10118299 Ga0307514_101182992 143
299 3300031730 Ga0307516_10018442 Ga0307516_100184423 143
300 3300031730 Ga0307516_10207877 Ga0307516_102078771 143
301 3300031731 Ga0307405_10308930 Ga0307405_103089302 143
302 3300031824 Ga0307413_10001375 Ga0307413_100013754 143
303 3300031838 Ga0307518_10000213 Ga0307518_1000021335 143
304 3300031838 Ga0307518_10057442 Ga0307518_100574424 143
305 3300031838 Ga0307518_10170892 Ga0307518_101708922 143
306 3300031901 Ga0307406_10286941 Ga0307406_102869412 143
307 3300031903 Ga0307407_10730704 Ga0307407_107307041 143
308 3300031903 Ga0307407_10989074 Ga0307407_109890741 143
309 3300032005 Ga0307411_10002289 Ga0307411_1000228910 143
310 3300033180 Ga0307510_10047996 Ga0307510_100479966 143
311 3300035092 Ga0373952_0155424 Ga0373952_0155424_120_551 143
312 3300037466 Ga0395898_0016590 Ga0395898_0016590_1108_1539 143
313 3300041441 Ga0451787_136281 Ga0451787_136281_69_512 143
314 3300041459 Ga0451800_0070477 Ga0451800_0070477_291_722 143
315 3300041498 Ga0451841_0830456 Ga0451841_0830456_100_543 143
316 3300044683 Ga0466965_0007070 Ga0466965_0007070_3937_4368 143
317 3300045836 Ga0466958_0181726 Ga0466958_0181726_529_963 143
318 3300045976 Ga0466967_0000285 Ga0466967_0000285_2563_2994 143
319 3300045976 Ga0466967_0086634 Ga0466967_0086634_124_558 143
320 3300046455 Ga0495603_0072167 Ga0495603_0072167_1569_2000 143
321 3300046460 Ga0495638_0008852 Ga0495638_0008852_2611_3042 143
322 3300046460 Ga0495638_0093616 Ga0495638_0093616_1196_1627 143
323 3300046471 Ga0495650_0258908 Ga0495650_0258908_28_459 143
324 3300046501 Ga0495607_0303188 Ga0495607_0303188_276_707 143
325 3300046506 Ga0495583_0294243 Ga0495583_0294243_73_504 143
326 3300046518 Ga0495631_0122413 Ga0495631_0122413_339_770 143
327 3300046542 Ga0495597_0135064 Ga0495597_0135064_468_899 143
328 3300046648 Ga0495611_0018063 Ga0495611_0018063_2155_2586 143
329 3300046660 Ga0495625_0032615 Ga0495625_0032615_1374_1805 143
330 3300046660 Ga0495625_0056345 Ga0495625_0056345_194_625 143
331 3300046660 Ga0495625_0088226 Ga0495625_0088226_1681_2112 143
332 3300046689 Ga0495613_0035293 Ga0495613_0035293_481_912 143
333 3300046690 Ga0495624_0866770 Ga0495624_0866770_83_517 143
334 3300046691 Ga0495670_0332947 Ga0495670_0332947_331_771 143
335 3300046794 Ga0495589_0007507 Ga0495589_0007507_4268_4699 143
336 3300047321 Ga0495676_0036255 Ga0495676_0036255_3162_3593 143
337 3300047443 Ga0495687_101251 Ga0495687_101251_532_963 143
338 3300047447 Ga0495685_002808 Ga0495685_002808_3563_3994 143
339 3300047447 Ga0495685_032643 Ga0495685_032643_60_491 143
340 3300048091 Ga0495626_0246807 Ga0495626_0246807_187_618 143
341 3300048903 Ga0496100_0002206 Ga0496100_0002206_8113_8544 143
342 3300048903 Ga0496100_0003057 Ga0496100_0003057_2513_2944 143
343 3300048904 Ga0496101_0000176 Ga0496101_0000176_28684_29115 143
344 3300048904 Ga0496101_0026152 Ga0496101_0026152_205_636 143
345 3300048905 Ga0496102_0001430 Ga0496102_0001430_1201_1632 143
346 3300048906 Ga0496103_0000570 Ga0496103_0000570_848_1279 143
347 3300048907 Ga0496104_0033594 Ga0496104_0033594_1631_2062 143
348 3300048908 Ga0496105_0040407 Ga0496105_0040407_904_1335 143
349 3300048909 Ga0496106_0000351 Ga0496106_0000351_2715_3146 143
350 3300048909 Ga0496106_0001063 Ga0496106_0001063_2509_2940 143
351 3300048910 Ga0496107_0009908 Ga0496107_0009908_4002_4433 143
352 3300048910 Ga0496107_0013016 Ga0496107_0013016_1578_2009 143
353 3300048911 Ga0496108_0203571 Ga0496108_0203571_917_1348 143
354 3300048912 Ga0496109_0266834 Ga0496109_0266834_872_1303 143
355 3300048916 Ga0496113_0396545 Ga0496113_0396545_257_688 143
356 3300048917 Ga0496114_0005152 Ga0496114_0005152_2499_2930 143
357 3300048917 Ga0496114_0021466 Ga0496114_0021466_1919_2350 143
358 3300048918 Ga0496115_0024950 Ga0496115_0024950_1982_2413 143
359 3300048918 Ga0496115_0039425 Ga0496115_0039425_847_1278 143
360 3300049569 Ga0501032_0983026 Ga0501032_0983026_41_472 143
361 3300049572 Ga0501036_0265430 Ga0501036_0265430_60_491 143
362 3300049574 Ga0501038_0058219 Ga0501038_0058219_2315_2746 143
363 3300049579 Ga0501043_0242951 Ga0501043_0242951_61_492 143
364 3300049822 Ga0501035_0281982 Ga0501035_0281982_907_1338 143
365 3300049823 Ga0501044_0196363 Ga0501044_0196363_1000_1440 143
366 3300049823 Ga0501044_0489914 Ga0501044_0489914_526_957 143
367 3300050507 nmdc:mga05p37_72343_c1 nmdc:mga05p37_72343_c1_2767_3198 143
368 3300050509 nmdc:mga0qj67_109733_c1 nmdc:mga0qj67_109733_c1_1026_1457 143
369 3300050510 nmdc:mga06r32_7364_c2 nmdc:mga06r32_7364_c2_940_1371 143
370 3300050516 nmdc:mga0sz30_260780_c1 nmdc:mga0sz30_260780_c1_140_571 143
371 3300053088 Ga0500644_0468475 Ga0500644_0468475_88_519 143
372 3300053100 Ga0500660_011837 Ga0500660_011837_2265_2696 143
373 3300053108 Ga0500562_014512 Ga0500562_014512_963_1394 143
374 3300053109 Ga0500569_266418 Ga0500569_266418_80_511 143
375 3300053147 Ga0500589_227419 Ga0500589_227419_66_497 143
376 3300053149 Ga0500600_0135920 Ga0500600_0135920_394_825 143
377 3300053151 Ga0500604_0055669 Ga0500604_0055669_770_1201 143
378 3300053153 Ga0500616_0004538 Ga0500616_0004538_6562_6993 143
379 3300053153 Ga0500616_0085212 Ga0500616_0085212_381_812 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

19

44

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

139

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8578 5 141
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8562 6 131
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8459 5 141
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8216 6 143
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8212 6 142
ID Description Score Start End Superfamily
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8711 6 137 3.10.180.10
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.846 6 137 3.10.180.10
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8384 10 59 3.30.720.120
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8167 11 57 3.30.720.120
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8117 10 134 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3S2FG49-F1-model_v4 deleted 0.9558 8 58
AF-A0A0R2PN11-F1-model_v4 Glyoxalase 0.9542 8 136
AF-A0A2G7BP53-F1-model_v4 deleted 0.9459 1 143
AF-A0A0R2PN11-F1-model_v4 Glyoxalase 0.9401 8 136
AF-A0A2E4M6N9-F1-model_v4 Glyoxalase 0.94 8 143

Feature Viewer

pLDDT pTM Quality
88.5 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map