metagRoot

F428257

General Info

Members	Datasets	Scaffolds	Average Seq Length
379	256	375	175

Family's Representative Sequence

Representative Sequence	3300005340\|Ga0070689_101222457\|Ga0070689_1012224571
Length	186
Sequence	MSRIGKSPIAVPGGVDITIAGNGDVGGNTVTVKGPKGTLSRTLPAIISVRRESEMIVVERPDDERASRSLHGLTRTLVNNMVVGVTDGFSKELEIIGVGYRAEAVAPNKLRMALGFSHPVIVDAPEGITFEVPVQTRVIIRGIDKEVVGQVAANIRSMRKPEPYKGKGVRYLGEKVLRKAGKTGKK

Samples

	Sample ID	Description	Type	Environment
1	2643221549	Agromyces sp. Root1464	Isolate	Unclassified
2	2643221679	Angustibacter sp. Root456	Isolate	Unclassified
3	2984576629	Nocardioides zeae SORGH_AS913	Isolate	Aerial Root
4	2990256926	Nocardioides zeae SORGH_AS885	Isolate	Aerial Root
5	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
6	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
7	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
8	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
9	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
10	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
11	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
12	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
13	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
14	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
15	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
16	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
17	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
20	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
21	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
22	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
23	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
24	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
25	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
30	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
33	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
40	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
41	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
42	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
43	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
44	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
45	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
46	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
47	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
48	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
49	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
50	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
51	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
52	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
53	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
54	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
55	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
56	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
57	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
59	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
60	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
61	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
62	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
63	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
66	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
68	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
69	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
70	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
71	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
72	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
73	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
74	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
75	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
76	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
77	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
78	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
79	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
80	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
81	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
82	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
83	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
84	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
85	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
86	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
87	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
88	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
89	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
90	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
91	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
131	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
132	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
133	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
134	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
135	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
136	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
137	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
138	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
139	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
140	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
141	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
142	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
143	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
144	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
145	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
146	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
147	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
148	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
149	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
150	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
151	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
152	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
153	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
154	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
155	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
156	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
157	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
158	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
159	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
160	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
161	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
162	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
163	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
164	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
165	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
166	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
167	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
168	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
169	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
170	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
171	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
172	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
173	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
174	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
175	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
176	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
177	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
178	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
179	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
180	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
181	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
182	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
183	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
184	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
185	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
186	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
187	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
188	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
189	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
190	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
191	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
192	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
193	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
194	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
195	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
196	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
197	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
198	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
199	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
200	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
201	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
202	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
203	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
204	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
205	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
206	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
207	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
208	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
209	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
210	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
211	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
212	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
213	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
214	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
215	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
216	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
217	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
218	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
219	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
220	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
221	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
222	3300049537	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
223	3300049540	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
224	3300049541	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
225	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
228	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
230	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
231	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
234	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
235	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
236	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
237	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
238	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
239	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
240	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
241	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
242	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
243	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
244	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
245	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
246	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
247	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
248	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
249	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
250	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
251	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
252	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
253	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
254	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
255	3300059604	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
256	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	93.4
Metatranscriptomes	5.54
Isolates	1.06

Biome Distribution

Category	Percentage (%)
Aerial Root	0.53
Bulb	0
Endosphere	5.54
Nodule	0
Rhizoplane	9.76
Rhizosphere	81
Stem	0
Stem Tuber	0
Unclassified	3.17

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10024009	3300001979	Bacteria	2073
2	JGI24740J21852_10079538	3300001979	Bacteria	861
3	JGI24735J21928_10116743	3300002067	Bacteria	768
4	JGI24735J21928_10143507	3300002067	Bacteria	689
5	Ga0006759J45824_1198260	3300003163	Bacteria	672
6	JGI25406J46586_10147741	3300003203	Bacteria	686
7	Ga0058859_10636834	3300004798	Unclassified	1095
8	Ga0058863_11585592	3300004799	Bacteria	660
9	Ga0065712_10005608	3300005290	Bacteria	5376
10	Ga0070658_10245387	3300005327	Bacteria	1519
11	Ga0070658_10308216	3300005327	Bacteria	1351
12	Ga0070683_100010234	3300005329	Bacteria	8056
13	Ga0070683_100108879	3300005329	Bacteria	2613
14	Ga0070683_100345752	3300005329	Bacteria	1416
15	Ga0068869_100067032	3300005334	Bacteria	2647
16	Ga0068869_100145193	3300005334	Bacteria	1835
17	Ga0070682_100209076	3300005337	Bacteria	1382
18	Ga0068868_100177485	3300005338	Bacteria	1766
19	Ga0070660_100126018	3300005339	Bacteria	2046
20	Ga0070689_100034533	3300005340	Bacteria	3858
21	Ga0070689_101222457	3300005340	Bacteria	675
22	Ga0070687_100020949	3300005343	Bacteria	3065
23	Ga0070669_100728534	3300005353	Bacteria	839
24	Ga0070669_100834166	3300005353	Bacteria	785
25	Ga0070675_100437248	3300005354	Bacteria	1172
26	Ga0070671_100295825	3300005355	Bacteria	1378
27	Ga0070674_100030615	3300005356	Bacteria	3559
28	Ga0070674_100063621	3300005356	Bacteria	2583
29	Ga0070674_100128480	3300005356	Bacteria	1886
30	Ga0070667_100183207	3300005367	Bacteria	1853
31	Ga0070667_101351813	3300005367	Bacteria	668
32	Ga0070710_10771325	3300005437	Bacteria	684
33	Ga0070711_100004281	3300005439	Bacteria	8397
34	Ga0070705_100327821	3300005440	Bacteria	1108
35	Ga0070700_100050208	3300005441	Bacteria	2593
36	Ga0070708_100002882	3300005445	Bacteria	13353
37	Ga0070663_100087747	3300005455	Bacteria	2299
38	Ga0070663_100833875	3300005455	Bacteria	792
39	Ga0070678_100011350	3300005456	Bacteria	5491
40	Ga0070678_100552985	3300005456	Bacteria	1022
41	Ga0070678_100756053	3300005456	Bacteria	879
42	Ga0068867_100000479	3300005459	Bacteria	26567
43	Ga0070685_10033786	3300005466	Bacteria	2877
44	Ga0070685_10344593	3300005466	Bacteria	1017
45	Ga0070706_100080999	3300005467	Bacteria	3006
46	Ga0070706_100091808	3300005467	Bacteria	2817
47	Ga0070707_100683601	3300005468	Bacteria	989
48	Ga0070679_100917190	3300005530	Bacteria	820
49	Ga0070679_101160156	3300005530	Bacteria	717
50	Ga0070684_100057814	3300005535	Bacteria	3387
51	Ga0070684_100629961	3300005535	Bacteria	998
52	Ga0070672_100077757	3300005543	Bacteria	2654
53	Ga0070686_100029765	3300005544	Bacteria	3325
54	Ga0070693_100058342	3300005547	Bacteria	2234
55	Ga0070664_100617685	3300005564	Bacteria	1006
56	Ga0068856_100447122	3300005614	Bacteria	1313
57	Ga0070702_100236363	3300005615	Bacteria	1231
58	Ga0068852_100850392	3300005616	Bacteria	928
59	Ga0068852_100973390	3300005616	Bacteria	867
60	Ga0068859_100515705	3300005617	Bacteria	1290
61	Ga0068866_10006391	3300005718	Bacteria	4908
62	Ga0068851_10329755	3300005834	Bacteria	884
63	Ga0068870_10636860	3300005840	Bacteria	729
64	Ga0068858_100013304	3300005842	Bacteria	7759
65	Ga0068862_101846140	3300005844	Bacteria	614
66	Ga0081540_1006702	3300005983	Bacteria	8329
67	Ga0081540_1016199	3300005983	Bacteria	4678
68	Ga0081539_10065612	3300005985	Bacteria	1971
69	Ga0081539_10105266	3300005985	Bacteria	1430
70	Ga0075365_10421418	3300006038	Bacteria	942
71	Ga0075364_10081318	3300006051	Bacteria	2142
72	Ga0075364_10192762	3300006051	Bacteria	1380
73	Ga0070716_100152367	3300006173	Bacteria	1489
74	Ga0075367_10077098	3300006178	Bacteria	2012
75	Ga0097621_100171613	3300006237	Bacteria	1870
76	Ga0075370_10019622	3300006353	Bacteria	3684
77	Ga0068871_100894166	3300006358	Bacteria	823
78	Ga0075428_101480001	3300006844	Bacteria	712
79	Ga0075431_100496595	3300006847	Bacteria	1212
80	Ga0075434_100347764	3300006871	Bacteria	1503
81	Ga0075434_100418728	3300006871	Bacteria	1361
82	Ga0075434_100661537	3300006871	Bacteria	1063
83	Ga0097620_100515658	3300006931	Bacteria	1290
84	Ga0111539_10315513	3300009094	Bacteria	1819
85	Ga0111539_10640289	3300009094	Bacteria	1238
86	Ga0105245_10040681	3300009098	Bacteria	4142
87	Ga0105245_10149800	3300009098	Bacteria	2205
88	Ga0105245_10272234	3300009098	Bacteria	1652
89	Ga0114129_10462384	3300009147	Bacteria	1663
90	Ga0105243_10067064	3300009148	Bacteria	2888
91	Ga0105243_10233242	3300009148	Bacteria	1634
92	Ga0105243_10756700	3300009148	Bacteria	953
93	Ga0105243_10867984	3300009148	Bacteria	895
94	Ga0105243_11150392	3300009148	Bacteria	787
95	Ga0105242_10357822	3300009176	Bacteria	1350
96	Ga0105242_10482204	3300009176	Bacteria	1175
97	Ga0105242_10503544	3300009176	Bacteria	1152
98	Ga0105248_10211049	3300009177	Bacteria	2188
99	Ga0105237_10015477	3300009545	Bacteria	7937
100	Ga0105238_12034804	3300009551	Bacteria	608
101	Ga0105239_10037381	3300010375	Bacteria	5323
102	Ga0105246_10078392	3300011119	Bacteria	2346
103	Ga0105246_10791264	3300011119	Bacteria	840
104	Ga0105246_11010237	3300011119	Bacteria	754
105	Ga0157371_10023296	3300013102	Bacteria	4527
106	Ga0157370_10004984	3300013104	Bacteria	15027
107	Ga0157369_10597198	3300013105	Bacteria	1139
108	Ga0157374_10250573	3300013296	Bacteria	1742
109	Ga0157378_10014133	3300013297	Bacteria	6986
110	Ga0163162_10072349	3300013306	Bacteria	3503
111	Ga0163162_10221794	3300013306	Bacteria	2020
112	Ga0157372_10565027	3300013307	Bacteria	1326
113	Ga0157372_11095427	3300013307	Bacteria	921
114	Ga0157375_10039781	3300013308	Bacteria	4527
115	Ga0163163_10040604	3300014325	Bacteria	4544
116	Ga0163163_10260089	3300014325	Bacteria	1786
117	Ga0163163_10454042	3300014325	Bacteria	1342
118	Ga0163163_10455664	3300014325	Bacteria	1339
119	Ga0163163_10998725	3300014325	Bacteria	900
120	Ga0182008_10525296	3300014497	Bacteria	654
121	Ga0157377_10138235	3300014745	Bacteria	1495
122	Ga0157379_10075804	3300014968	Bacteria	3012
123	Ga0157379_10253453	3300014968	Bacteria	1598
124	Ga0182005_1062522	3300015265	Bacteria	1017
125	Ga0163161_10201201	3300017792	Bacteria	1535
126	Ga0163161_10530335	3300017792	Bacteria	962
127	Ga0197907_11062436	3300020069	Bacteria	1141
128	Ga0206353_11479686	3300020082	Bacteria	1687
129	Ga0213874_10293566	3300021377	Bacteria	610
130	Ga0207666_1002632	3300025271	Bacteria	2171
131	Ga0207642_10026787	3300025899	Bacteria	2351
132	Ga0207688_10098748	3300025901	Bacteria	1684
133	Ga0207688_10537283	3300025901	Bacteria	734
134	Ga0207647_10369854	3300025904	Bacteria	810
135	Ga0207671_10031792	3300025914	Bacteria	3931
136	Ga0207663_10011462	3300025916	Bacteria	4758
137	Ga0207662_10007284	3300025918	Bacteria	6015
138	Ga0207662_10803198	3300025918	Bacteria	663
139	Ga0207657_10394967	3300025919	Bacteria	1088
140	Ga0207652_10223748	3300025921	Bacteria	1696
141	Ga0207646_10174024	3300025922	Bacteria	1944
142	Ga0207687_10033423	3300025927	Bacteria	3489
143	Ga0207687_10113053	3300025927	Bacteria	2019
144	Ga0207687_10335239	3300025927	Bacteria	1228
145	Ga0207687_11487788	3300025927	Bacteria	582
146	Ga0207644_11001802	3300025931	Bacteria	701
147	Ga0207690_10739124	3300025932	Bacteria	811
148	Ga0207690_11300345	3300025932	Bacteria	608
149	Ga0207706_10083036	3300025933	Bacteria	2816
150	Ga0207686_10430436	3300025934	Bacteria	1011
151	Ga0207709_10031452	3300025935	Bacteria	3100
152	Ga0207709_10040697	3300025935	Bacteria	2784
153	Ga0207669_10052680	3300025937	Bacteria	2446
154	Ga0207669_10418339	3300025937	Bacteria	1054
155	Ga0207704_10655461	3300025938	Bacteria	865
156	Ga0207665_10406326	3300025939	Bacteria	1038
157	Ga0207691_10439485	3300025940	Bacteria	1111
158	Ga0207691_10496399	3300025940	Bacteria	1037
159	Ga0207691_10938457	3300025940	Bacteria	723
160	Ga0207689_10182685	3300025942	Bacteria	1729
161	Ga0207661_10053311	3300025944	Bacteria	3236
162	Ga0207661_10180360	3300025944	Bacteria	1844
163	Ga0207679_10665479	3300025945	Bacteria	943
164	Ga0207667_10874253	3300025949	Bacteria	892
165	Ga0207651_10822924	3300025960	Bacteria	824
166	Ga0207658_10416269	3300025986	Bacteria	1184
167	Ga0207658_10550830	3300025986	Bacteria	1032
168	Ga0207677_10151973	3300026023	Bacteria	1787
169	Ga0207703_10044345	3300026035	Bacteria	3574
170	Ga0207678_10201741	3300026067	Bacteria	1701
171	Ga0207708_10056364	3300026075	Bacteria	2998
172	Ga0207702_10497733	3300026078	Bacteria	1188
173	Ga0207648_10002304	3300026089	Bacteria	20620
174	Ga0207648_10074810	3300026089	Bacteria	2952
175	Ga0207648_11545905	3300026089	Bacteria	624
176	Ga0207676_10285173	3300026095	Bacteria	1501
177	Ga0207676_10415805	3300026095	Bacteria	1260
178	Ga0207674_10289059	3300026116	Bacteria	1588
179	Ga0207675_100013791	3300026118	Bacteria	7538
180	Ga0207675_100204003	3300026118	Bacteria	1899
181	Ga0207675_100893550	3300026118	Bacteria	904
182	Ga0207683_10064538	3300026121	Bacteria	3227
183	Ga0207683_10289232	3300026121	Bacteria	1498
184	Ga0207683_10790304	3300026121	Bacteria	881
185	Ga0207698_10111228	3300026142	Bacteria	2296
186	Ga0207698_10216663	3300026142	Bacteria	1727
187	Ga0268265_11841785	3300028380	Bacteria	612
188	Ga0268264_10431733	3300028381	Bacteria	1272
189	Ga0265326_10068869	3300028558	Bacteria	1000
190	Ga0265340_10011241	3300031247	Bacteria	4766
191	Ga0265327_10388572	3300031251	Bacteria	607
192	Ga0265316_10239703	3300031344	Bacteria	1334
193	Ga0316576_10003776	3300031727	Bacteria	8950
194	Ga0316576_10012139	3300031727	Bacteria	5681
195	Ga0316578_10010235	3300031728	Bacteria	4859
196	Ga0316578_10128813	3300031728	Bacteria	1522
197	Ga0307405_10422230	3300031731	Bacteria	1050
198	Ga0316577_10275110	3300031733	Unclassified	953
199	Ga0307413_10317680	3300031824	Bacteria	1188
200	Ga0307406_10681131	3300031901	Bacteria	856
201	Ga0307409_100170067	3300031995	Bacteria	1917
202	Ga0307414_10070354	3300032004	Bacteria	2519
203	Ga0307414_10205192	3300032004	Bacteria	1607
204	Ga0307415_100014503	3300032126	Bacteria	4636
205	Ga0316585_10027179	3300032137	Bacteria	1784
206	Ga0316593_10002456	3300032168	Bacteria	4406
207	Ga0316593_10194501	3300032168	Bacteria	748
208	Ga0316596_1001911	3300033541	Bacteria	4361
209	Ga0316574_0002694	3300035398	Bacteria	8979
210	Ga0316582_0022131	3300036647	Bacteria	3770
211	Ga0316582_0840805	3300036647	Bacteria	629
212	Ga0316584_0007224	3300036712	Bacteria	7577
213	Ga0316584_0454399	3300036712	Bacteria	906
214	Ga0395899_0111877	3300037312	Bacteria	1962
215	Ga0395900_0038557	3300037418	Bacteria	4925
216	Ga0395900_0271999	3300037418	Bacteria	1688
217	Ga0395898_0012796	3300037466	Bacteria	8662
218	Ga0395898_0063054	3300037466	Bacteria	3597
219	Ga0395898_0121614	3300037466	Bacteria	2501
220	Ga0395898_0129171	3300037466	Bacteria	2421
221	Ga0395898_0213401	3300037466	Bacteria	1841
222	Ga0395905_0007439	3300037471	Bacteria	10890
223	Ga0395905_0090297	3300037471	Bacteria	2872
224	Ga0395905_0354200	3300037471	Bacteria	1360
225	Ga0436364_1488411	3300037853	Bacteria	1175
226	Ga0395901_0016098	3300038443	Bacteria	7618
227	Ga0395901_0038420	3300038443	Bacteria	4951
228	Ga0395901_0052956	3300038443	Bacteria	4217
229	Ga0395901_0700471	3300038443	Bacteria	1010
230	Ga0436365_1564473	3300039437	Bacteria	1017
231	Ga0436363_0745948	3300039450	Bacteria	1332
232	Ga0439466_0051505	3300041411	Bacteria	1348
233	Ga0439465_0024467	3300041413	Bacteria	1903
234	Ga0451843_0594403	3300041509	Bacteria	1283
235	Ga0466961_0508724	3300044693	Bacteria	727
236	Ga0466963_0256625	3300044694	Bacteria	1227
237	Ga0466963_0387544	3300044694	Bacteria	985
238	Ga0466963_0391845	3300044694	Bacteria	979
239	Ga0466970_0334778	3300044765	Bacteria	857
240	Ga0466970_0619707	3300044765	Bacteria	628
241	Ga0466959_0540954	3300045049	Bacteria	786
242	Ga0451576_0003567	3300045051	Bacteria	21187
243	Ga0466967_1630423	3300045976	Bacteria	642
244	Ga0495592_0427829	3300046454	Bacteria	834
245	Ga0495603_0155919	3300046455	Bacteria	1325
246	Ga0495651_0254643	3300046462	Bacteria	1197
247	Ga0495651_0403567	3300046462	Bacteria	892
248	Ga0495653_0405357	3300046463	Bacteria	866
249	Ga0495653_0809356	3300046463	Bacteria	563
250	Ga0495605_0020527	3300046474	Bacteria	3510
251	Ga0495584_0036325	3300046491	Bacteria	2489
252	Ga0495607_0048832	3300046501	Bacteria	2472
253	Ga0495583_0200351	3300046506	Bacteria	811
254	Ga0495608_0121138	3300046511	Bacteria	1678
255	Ga0495616_0128366	3300046513	Bacteria	1164
256	Ga0495630_0559775	3300046517	Bacteria	877
257	Ga0495632_0099089	3300046519	Bacteria	1375
258	Ga0495637_0093765	3300046520	Bacteria	1181
259	Ga0495644_0076055	3300046523	Bacteria	1265
260	Ga0495644_0314755	3300046523	Bacteria	614
261	Ga0495663_0005050	3300046525	Bacteria	3686
262	Ga0495633_0171755	3300046558	Bacteria	999
263	Ga0495656_0088721	3300046615	Bacteria	1410
264	Ga0495656_0248792	3300046615	Bacteria	897
265	Ga0495656_0499241	3300046615	Bacteria	645
266	Ga0495668_0044563	3300046616	Bacteria	2465
267	Ga0495611_0051735	3300046648	Bacteria	1852
268	Ga0495661_0193344	3300046665	Bacteria	1070
269	Ga0495588_0119949	3300046674	Bacteria	1386
270	Ga0495588_0373675	3300046674	Bacteria	749
271	Ga0495658_0160062	3300046683	Bacteria	1388
272	Ga0495669_0027496	3300046684	Bacteria	2488
273	Ga0495624_0120928	3300046690	Bacteria	1608
274	Ga0495670_0048528	3300046691	Bacteria	2124
275	Ga0495671_0140150	3300046692	Bacteria	1178
276	Ga0495589_0027359	3300046794	Bacteria	2883
277	Ga0495660_0107815	3300046810	Bacteria	1425
278	Ga0495676_0062696	3300047321	Bacteria	2901
279	Ga0495683_0105517	3300047323	Bacteria	1350
280	Ga0495677_0007549	3300047445	Bacteria	4057
281	Ga0495615_0053123	3300048090	Bacteria	1049
282	Ga0495626_0030611	3300048091	Bacteria	2595
283	Ga0496100_0333129	3300048903	Bacteria	1143
284	Ga0496101_1080042	3300048904	Bacteria	630
285	Ga0496102_0000840	3300048905	Bacteria	29492
286	Ga0496102_0093608	3300048905	Bacteria	2784
287	Ga0496102_0409845	3300048905	Bacteria	1273
288	Ga0496103_0048352	3300048906	Bacteria	2629
289	Ga0496103_0067521	3300048906	Bacteria	2233
290	Ga0496103_0097396	3300048906	Bacteria	1860
291	Ga0496104_0003461	3300048907	Bacteria	13603
292	Ga0496104_0044998	3300048907	Bacteria	4149
293	Ga0496105_0019578	3300048908	Bacteria	5460
294	Ga0496105_0291104	3300048908	Bacteria	1315
295	Ga0496106_0005388	3300048909	Bacteria	9463
296	Ga0496107_0045026	3300048910	Bacteria	3173
297	Ga0496107_0101838	3300048910	Bacteria	2106
298	Ga0496108_0030672	3300048911	Bacteria	4455
299	Ga0496108_0244205	3300048911	Bacteria	1562
300	Ga0496108_0309845	3300048911	Bacteria	1376
301	Ga0496108_0633110	3300048911	Bacteria	930
302	Ga0496109_0087981	3300048912	Bacteria	2870
303	Ga0496109_0169897	3300048912	Bacteria	2045
304	Ga0496109_0180823	3300048912	Bacteria	1981
305	Ga0496110_0005006	3300048913	Bacteria	10353
306	Ga0496110_0029793	3300048913	Bacteria	4701
307	Ga0496110_0256852	3300048913	Bacteria	1591
308	Ga0496110_0549806	3300048913	Bacteria	1049
309	Ga0496111_0083898	3300048914	Bacteria	2328
310	Ga0496111_0365330	3300048914	Bacteria	1068
311	Ga0496111_0399740	3300048914	Bacteria	1015
312	Ga0496112_0007859	3300048915	Bacteria	9496
313	Ga0496113_0026764	3300048916	Bacteria	4127
314	Ga0496114_0023838	3300048917	Bacteria	4993
315	Ga0496114_0032918	3300048917	Bacteria	4269
316	Ga0496114_0260277	3300048917	Bacteria	1527
317	Ga0496114_0369827	3300048917	Bacteria	1269
318	Ga0496114_0583536	3300048917	Bacteria	986
319	Ga0496115_0261583	3300048918	Bacteria	1423
320	Ga0496118_0114304	3300048921	Bacteria	1780
321	Ga0496126_0370220	3300048929	Bacteria	1168
322	Ga0496126_0386406	3300048929	Bacteria	1138
323	Ga0496126_0629326	3300048929	Bacteria	842
324	Ga0501311_066048	3300049527	Bacteria	593
325	Ga0501315_016651	3300049531	Bacteria	953
326	Ga0501316_000965	3300049532	Bacteria	2273
327	Ga0501317_010875	3300049533	Bacteria	1096
328	Ga0501318_008264	3300049534	Bacteria	1108
329	Ga0501321_008712	3300049537	Bacteria	1082
330	Ga0501321_011355	3300049537	Bacteria	992
331	Ga0501321_032488	3300049537	Bacteria	704
332	Ga0501324_013376	3300049540	Bacteria	777
333	Ga0501325_007235	3300049541	Bacteria	934
334	Ga0501034_0212680	3300049571	Bacteria	1888
335	Ga0501034_0753710	3300049571	Bacteria	869
336	Ga0501036_0380919	3300049572	Bacteria	1177
337	Ga0501039_0046960	3300049575	Bacteria	3337
338	Ga0501039_0139746	3300049575	Bacteria	1902
339	Ga0501040_0345338	3300049576	Bacteria	1066
340	Ga0501046_0421109	3300049580	Bacteria	963
341	Ga0501048_0195110	3300049582	Bacteria	1435
342	Ga0501069_0560329	3300049585	Bacteria	684
343	Ga0501074_0289167	3300049590	Bacteria	1165
344	Ga0501076_0138396	3300049592	Bacteria	1977
345	Ga0501076_0148865	3300049592	Bacteria	1904
346	Ga0501079_0255776	3300049741	Bacteria	1369
347	nmdc:mga03n38_5528_c1	3300050490	Bacteria	4309
348	nmdc:mga00v17_125741_c1	3300050491	Bacteria	1636
349	nmdc:mga00v17_17960_c1	3300050491	Bacteria	4014
350	nmdc:mga00v17_586959_c1	3300050491	Bacteria	719
351	nmdc:mga00v17_76861_c1	3300050491	Bacteria	2078
352	nmdc:mga0yw44_388181_c1	3300050492	Bacteria	943
353	nmdc:mga0k408_166045_c1	3300050493	Bacteria	1315
354	nmdc:mga06z11_275470_c1	3300050494	Bacteria	996
355	nmdc:mga06z11_6969_c1	3300050494	Bacteria	4632
356	nmdc:mga07m45_16712_c1	3300050496	Bacteria	3930
357	nmdc:mga09592_621397_c1	3300050508	Bacteria	924
358	nmdc:mga0qj67_1038021_c1	3300050509	Bacteria	642
359	nmdc:mga06r32_269445_c1	3300050510	Bacteria	1690
360	nmdc:mga0n895_211328_c1	3300050512	Bacteria	1970
361	Ga0495655_0001548	3300053083	Bacteria	3540
362	Ga0495655_0033712	3300053083	Bacteria	1262
363	Ga0495655_0051389	3300053083	Bacteria	1092
364	Ga0495619_0276611	3300053085	Bacteria	1163
365	Ga0495619_0383256	3300053085	Bacteria	972
366	Ga0500566_0000391	3300053094	Bacteria	24277
367	Ga0500554_002703	3300053102	Bacteria	3531
368	Ga0500562_001347	3300053108	Bacteria	6058
369	Ga0500559_0072050	3300053136	Bacteria	1557
370	Ga0500573_0189480	3300053140	Bacteria	1099
371	Ga0500616_0000171	3300053153	Bacteria	108118
372	Ga0587080_021386	3300059503	Bacteria	1063
373	Ga0587082_057412	3300059504	Bacteria	759
374	Ga0587098_056488	3300059604	Bacteria	607
375	Ga0530510_0027258	3300061734	Bacteria	4094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046558	Ga0495633_0171755	Ga0495633_0171755_23_571	147
2	3300009176	Ga0105242_10482204	Ga0105242_104822043	148
3	3300049741	Ga0501079_0255776	Ga0501079_0255776_801_1334	148
4	3300032004	Ga0307414_10070354	Ga0307414_100703541	150
5	3300041411	Ga0439466_0051505	Ga0439466_0051505_409_945	150
6	3300041413	Ga0439465_0024467	Ga0439465_0024467_1011_1547	150
7	3300053136	Ga0500559_0072050	Ga0500559_0072050_478_1014	150
8	3300053140	Ga0500573_0189480	Ga0500573_0189480_81_617	150
9	3300005983	Ga0081540_1006702	Ga0081540_100670214	151
10	3300046455	Ga0495603_0155919	Ga0495603_0155919_387_920	151
11	3300046674	Ga0495588_0119949	Ga0495588_0119949_210_743	151
12	3300013102	Ga0157371_10023296	Ga0157371_100232964	152
13	3300013104	Ga0157370_10004984	Ga0157370_1000498410	152
14	3300031251	Ga0265327_10388572	Ga0265327_103885721	152
15	3300014325	Ga0163163_10454042	Ga0163163_104540424	153
16	3300046463	Ga0495653_0809356	Ga0495653_0809356_36_500	153
17	3300005356	Ga0070674_100063621	Ga0070674_1000636213	154
18	3300025934	Ga0207686_10430436	Ga0207686_104304361	154
19	3300025937	Ga0207669_10418339	Ga0207669_104183392	154
20	3300046674	Ga0495588_0373675	Ga0495588_0373675_239_703	154
21	3300026089	Ga0207648_10074810	Ga0207648_100748105	155
22	3300037466	Ga0395898_0121614	Ga0395898_0121614_697_1230	155
23	3300038443	Ga0395901_0016098	Ga0395901_0016098_6222_6755	155
24	3300046474	Ga0495605_0020527	Ga0495605_0020527_384_917	155
25	3300046491	Ga0495584_0036325	Ga0495584_0036325_1572_2105	155
26	3300046501	Ga0495607_0048832	Ga0495607_0048832_1739_2272	155
27	3300046506	Ga0495583_0200351	Ga0495583_0200351_218_751	155
28	3300046513	Ga0495616_0128366	Ga0495616_0128366_578_1111	155
29	3300046519	Ga0495632_0099089	Ga0495632_0099089_417_950	155
30	3300046520	Ga0495637_0093765	Ga0495637_0093765_455_988	155
31	3300046525	Ga0495663_0005050	Ga0495663_0005050_2573_3106	155
32	3300046615	Ga0495656_0499241	Ga0495656_0499241_86_619	155
33	3300046616	Ga0495668_0044563	Ga0495668_0044563_615_1148	155
34	3300046648	Ga0495611_0051735	Ga0495611_0051735_884_1417	155
35	3300046665	Ga0495661_0193344	Ga0495661_0193344_366_899	155
36	3300046684	Ga0495669_0027496	Ga0495669_0027496_736_1269	155
37	3300046692	Ga0495671_0140150	Ga0495671_0140150_631_1164	155
38	3300046794	Ga0495589_0027359	Ga0495589_0027359_85_618	155
39	3300046810	Ga0495660_0107815	Ga0495660_0107815_321_854	155
40	3300047445	Ga0495677_0007549	Ga0495677_0007549_1359_1892	155
41	3300048090	Ga0495615_0053123	Ga0495615_0053123_468_1001	155
42	3300048091	Ga0495626_0030611	Ga0495626_0030611_1253_1786	155
43	3300048929	Ga0496126_0386406	Ga0496126_0386406_227_697	155
44	3300053083	Ga0495655_0001548	Ga0495655_0001548_2810_3346	155
45	3300053083	Ga0495655_0051389	Ga0495655_0051389_94_627	155
46	3300005290	Ga0065712_10005608	Ga0065712_100056083	156
47	3300013307	Ga0157372_11095427	Ga0157372_110954272	156
48	3300037312	Ga0395899_0111877	Ga0395899_0111877_144_677	156
49	3300037418	Ga0395900_0038557	Ga0395900_0038557_1834_2370	156
50	3300037418	Ga0395900_0271999	Ga0395900_0271999_327_860	156
51	3300037466	Ga0395898_0012796	Ga0395898_0012796_7692_8225	156
52	3300037466	Ga0395898_0063054	Ga0395898_0063054_2466_3002	156
53	3300037466	Ga0395898_0213401	Ga0395898_0213401_990_1523	156
54	3300037471	Ga0395905_0007439	Ga0395905_0007439_9411_9944	156
55	3300037471	Ga0395905_0354200	Ga0395905_0354200_635_1168	156
56	3300038443	Ga0395901_0038420	Ga0395901_0038420_1672_2205	156
57	3300038443	Ga0395901_0052956	Ga0395901_0052956_2853_3389	156
58	3300038443	Ga0395901_0700471	Ga0395901_0700471_334_867	156
59	3300046615	Ga0495656_0088721	Ga0495656_0088721_455_988	156
60	3300002067	JGI24735J21928_10116743	JGI24735J21928_101167431	157
61	3300049531	Ga0501315_016651	Ga0501315_016651_82_618	157
62	3300026118	Ga0207675_100893550	Ga0207675_1008935502	158
63	3300046511	Ga0495608_0121138	Ga0495608_0121138_506_1042	158
64	3300053108	Ga0500562_001347	Ga0500562_001347_1697_2233	158
65	3300005467	Ga0070706_100080999	Ga0070706_1000809993	160
66	3300005468	Ga0070707_100683601	Ga0070707_1006836011	160
67	3300025922	Ga0207646_10174024	Ga0207646_101740243	160
68	3300048914	Ga0496111_0399740	Ga0496111_0399740_10_522	160
69	3300046523	Ga0495644_0314755	Ga0495644_0314755_84_578	163
70	3300049534	Ga0501318_008264	Ga0501318_008264_328_822	163
71	3300036647	Ga0316582_0840805	Ga0316582_0840805_27_524	164
72	3300049527	Ga0501311_066048	Ga0501311_066048_77_571	164
73	3300035398	Ga0316574_0002694	Ga0316574_0002694_6603_7100	165
74	3300036647	Ga0316582_0022131	Ga0316582_0022131_2952_3449	165
75	3300036712	Ga0316584_0007224	Ga0316584_0007224_918_1415	165
76	3300037853	Ga0436364_1488411	Ga0436364_1488411_560_1099	166
77	3300031727	Ga0316576_10012139	Ga0316576_1001213910	167
78	3300031728	Ga0316578_10128813	Ga0316578_101288133	167
79	3300032168	Ga0316593_10002456	Ga0316593_100024563	167
80	3300033541	Ga0316596_1001911	Ga0316596_10019116	167
81	3300036712	Ga0316584_0454399	Ga0316584_0454399_286_825	167
82	3300048929	Ga0496126_0370220	Ga0496126_0370220_219_758	167
83	3300049585	Ga0501069_0560329	Ga0501069_0560329_89_592	167
84	3300005466	Ga0070685_10344593	Ga0070685_103445932	168
85	3300014497	Ga0182008_10525296	Ga0182008_105252962	168
86	3300025901	Ga0207688_10537283	Ga0207688_105372831	168
87	3300045049	Ga0466959_0540954	Ga0466959_0540954_24_533	168
88	3300005834	Ga0068851_10329755	Ga0068851_103297552	169
89	3300044694	Ga0466963_0387544	Ga0466963_0387544_351_863	169
90	3300045976	Ga0466967_1630423	Ga0466967_1630423_21_533	169
91	3300049590	Ga0501074_0289167	Ga0501074_0289167_215_730	170
92	3300005456	Ga0070678_100552985	Ga0070678_1005529852	171
93	3300005616	Ga0068852_100973390	Ga0068852_1009733902	171
94	3300025932	Ga0207690_11300345	Ga0207690_113003451	171
95	3300026121	Ga0207683_10790304	Ga0207683_107903042	171
96	3300048911	Ga0496108_0633110	Ga0496108_0633110_167_724	171
97	3300048914	Ga0496111_0365330	Ga0496111_0365330_468_983	171
98	3300049537	Ga0501321_008712	Ga0501321_008712_71_586	171
99	3300053102	Ga0500554_002703	Ga0500554_002703_2971_3486	171
100	3300005327	Ga0070658_10245387	Ga0070658_102453873	172
101	3300006051	Ga0075364_10081318	Ga0075364_100813182	172
102	3300006178	Ga0075367_10077098	Ga0075367_100770982	172
103	3300006353	Ga0075370_10019622	Ga0075370_100196227	172
104	3300047323	Ga0495683_0105517	Ga0495683_0105517_462_1061	172
105	3300050490	nmdc:mga03n38_5528_c1	nmdc:mga03n38_5528_c1_2231_2773	172
106	3300050491	nmdc:mga00v17_125741_c1	nmdc:mga00v17_125741_c1_146_688	172
107	3300050491	nmdc:mga00v17_17960_c1	nmdc:mga00v17_17960_c1_1362_1904	172
108	3300050494	nmdc:mga06z11_275470_c1	nmdc:mga06z11_275470_c1_237_779	172
109	3300050494	nmdc:mga06z11_6969_c1	nmdc:mga06z11_6969_c1_1258_1800	172
110	3300050496	nmdc:mga07m45_16712_c1	nmdc:mga07m45_16712_c1_1755_2297	172
111	3300025949	Ga0207667_10874253	Ga0207667_108742531	173
112	3300046462	Ga0495651_0403567	Ga0495651_0403567_241_780	173
113	3300009545	Ga0105237_10015477	Ga0105237_100154775	174
114	3300010375	Ga0105239_10037381	Ga0105239_100373813	174
115	iso_pu_bacteria	2643221549	2643768608	174
116	iso_pu_bacteria	2984576629	2984579592	174
117	iso_pu_bacteria	2990256926	2990257199	174
118	iso_pu_bacteria	2643221679	2644445555	175
119	3300004798	Ga0058859_10636834	Ga0058859_106368342	176
120	3300049575	Ga0501039_0046960	Ga0501039_0046960_876_1409	176
121	3300049592	Ga0501076_0138396	Ga0501076_0138396_555_1088	176
122	3300061734	Ga0530510_0027258	Ga0530510_0027258_2250_2783	176
123	3300005329	Ga0070683_100010234	Ga0070683_10001023411	177
124	3300005329	Ga0070683_100108879	Ga0070683_1001088791	177
125	3300005334	Ga0068869_100145193	Ga0068869_1001451934	177
126	3300005467	Ga0070706_100091808	Ga0070706_1000918084	177
127	3300006871	Ga0075434_100418728	Ga0075434_1004187282	177
128	3300009094	Ga0111539_10315513	Ga0111539_103155134	177
129	3300011119	Ga0105246_11010237	Ga0105246_110102372	177
130	3300025918	Ga0207662_10803198	Ga0207662_108031982	177
131	3300045051	Ga0451576_0003567	Ga0451576_0003567_14985_15518	177
132	3300005367	Ga0070667_100183207	Ga0070667_1001832072	178
133	3300005439	Ga0070711_100004281	Ga0070711_10000428114	178
134	3300005445	Ga0070708_100002882	Ga0070708_10000288219	178
135	3300005547	Ga0070693_100058342	Ga0070693_1000583423	178
136	3300006051	Ga0075364_10192762	Ga0075364_101927622	178
137	3300009094	Ga0111539_10640289	Ga0111539_106402893	178
138	3300009148	Ga0105243_10756700	Ga0105243_107567002	178
139	3300009176	Ga0105242_10357822	Ga0105242_103578222	178
140	3300025916	Ga0207663_10011462	Ga0207663_100114629	178
141	3300025919	Ga0207657_10394967	Ga0207657_103949672	178
142	3300025927	Ga0207687_10335239	Ga0207687_103352392	178
143	3300025986	Ga0207658_10416269	Ga0207658_104162692	178
144	3300028558	Ga0265326_10068869	Ga0265326_100688692	178
145	3300031344	Ga0265316_10239703	Ga0265316_102397032	178
146	3300037471	Ga0395905_0090297	Ga0395905_0090297_76_615	178
147	3300044694	Ga0466963_0391845	Ga0466963_0391845_87_626	178
148	3300046454	Ga0495592_0427829	Ga0495592_0427829_265_804	178
149	3300046462	Ga0495651_0254643	Ga0495651_0254643_536_1075	178
150	3300048918	Ga0496115_0261583	Ga0496115_0261583_36_575	178
151	3300049537	Ga0501321_032488	Ga0501321_032488_96_632	178
152	3300049571	Ga0501034_0212680	Ga0501034_0212680_1033_1572	178
153	3300049571	Ga0501034_0753710	Ga0501034_0753710_183_722	178
154	3300050491	nmdc:mga00v17_76861_c1	nmdc:mga00v17_76861_c1_1093_1632	178
155	3300053085	Ga0495619_0383256	Ga0495619_0383256_301_840	178
156	3300053094	Ga0500566_0000391	Ga0500566_0000391_8760_9302	178
157	3300004799	Ga0058863_11585592	Ga0058863_115855921	179
158	3300005334	Ga0068869_100067032	Ga0068869_1000670326	179
159	3300005337	Ga0070682_100209076	Ga0070682_1002090761	179
160	3300005338	Ga0068868_100177485	Ga0068868_1001774853	179
161	3300005339	Ga0070660_100126018	Ga0070660_1001260185	179
162	3300005340	Ga0070689_100034533	Ga0070689_1000345337	179
163	3300005340	Ga0070689_101222457	Ga0070689_1012224571	179
164	3300005343	Ga0070687_100020949	Ga0070687_1000209497	179
165	3300005353	Ga0070669_100728534	Ga0070669_1007285342	179
166	3300005353	Ga0070669_100834166	Ga0070669_1008341661	179
167	3300005354	Ga0070675_100437248	Ga0070675_1004372482	179
168	3300005355	Ga0070671_100295825	Ga0070671_1002958253	179
169	3300005356	Ga0070674_100030615	Ga0070674_1000306156	179
170	3300005356	Ga0070674_100128480	Ga0070674_1001284803	179
171	3300005367	Ga0070667_101351813	Ga0070667_1013518131	179
172	3300005437	Ga0070710_10771325	Ga0070710_107713251	179
173	3300005440	Ga0070705_100327821	Ga0070705_1003278212	179
174	3300005441	Ga0070700_100050208	Ga0070700_1000502081	179
175	3300005455	Ga0070663_100087747	Ga0070663_1000877472	179
176	3300005455	Ga0070663_100833875	Ga0070663_1008338752	179
177	3300005456	Ga0070678_100011350	Ga0070678_1000113506	179
178	3300005459	Ga0068867_100000479	Ga0068867_10000047928	179
179	3300005466	Ga0070685_10033786	Ga0070685_100337863	179
180	3300005530	Ga0070679_100917190	Ga0070679_1009171901	179
181	3300005530	Ga0070679_101160156	Ga0070679_1011601562	179
182	3300005543	Ga0070672_100077757	Ga0070672_1000777576	179
183	3300005544	Ga0070686_100029765	Ga0070686_1000297653	179
184	3300005564	Ga0070664_100617685	Ga0070664_1006176852	179
185	3300005615	Ga0070702_100236363	Ga0070702_1002363632	179
186	3300005616	Ga0068852_100850392	Ga0068852_1008503922	179
187	3300005617	Ga0068859_100515705	Ga0068859_1005157052	179
188	3300005718	Ga0068866_10006391	Ga0068866_1000639111	179
189	3300005840	Ga0068870_10636860	Ga0068870_106368602	179
190	3300005842	Ga0068858_100013304	Ga0068858_10001330413	179
191	3300005983	Ga0081540_1016199	Ga0081540_10161996	179
192	3300006038	Ga0075365_10421418	Ga0075365_104214182	179
193	3300006173	Ga0070716_100152367	Ga0070716_1001523672	179
194	3300006237	Ga0097621_100171613	Ga0097621_1001716133	179
195	3300006358	Ga0068871_100894166	Ga0068871_1008941662	179
196	3300006871	Ga0075434_100347764	Ga0075434_1003477641	179
197	3300006931	Ga0097620_100515658	Ga0097620_1005156582	179
198	3300009098	Ga0105245_10040681	Ga0105245_100406814	179
199	3300009098	Ga0105245_10149800	Ga0105245_101498004	179
200	3300009098	Ga0105245_10272234	Ga0105245_102722342	179
201	3300009148	Ga0105243_10067064	Ga0105243_100670645	179
202	3300009148	Ga0105243_10233242	Ga0105243_102332421	179
203	3300009148	Ga0105243_10867984	Ga0105243_108679841	179
204	3300009148	Ga0105243_11150392	Ga0105243_111503922	179
205	3300009176	Ga0105242_10503544	Ga0105242_105035442	179
206	3300009177	Ga0105248_10211049	Ga0105248_102110495	179
207	3300009551	Ga0105238_12034804	Ga0105238_120348041	179
208	3300011119	Ga0105246_10078392	Ga0105246_100783924	179
209	3300011119	Ga0105246_10791264	Ga0105246_107912642	179
210	3300013296	Ga0157374_10250573	Ga0157374_102505733	179
211	3300013297	Ga0157378_10014133	Ga0157378_100141338	179
212	3300013306	Ga0163162_10072349	Ga0163162_100723496	179
213	3300013306	Ga0163162_10221794	Ga0163162_102217942	179
214	3300013307	Ga0157372_10565027	Ga0157372_105650272	179
215	3300013308	Ga0157375_10039781	Ga0157375_1003978110	179
216	3300014325	Ga0163163_10040604	Ga0163163_100406047	179
217	3300014325	Ga0163163_10260089	Ga0163163_102600892	179
218	3300014325	Ga0163163_10455664	Ga0163163_104556642	179
219	3300014325	Ga0163163_10998725	Ga0163163_109987252	179
220	3300014745	Ga0157377_10138235	Ga0157377_101382352	179
221	3300014968	Ga0157379_10075804	Ga0157379_100758045	179
222	3300014968	Ga0157379_10253453	Ga0157379_102534533	179
223	3300015265	Ga0182005_1062522	Ga0182005_10625222	179
224	3300017792	Ga0163161_10201201	Ga0163161_102012013	179
225	3300017792	Ga0163161_10530335	Ga0163161_105303352	179
226	3300021377	Ga0213874_10293566	Ga0213874_102935661	179
227	3300025271	Ga0207666_1002632	Ga0207666_10026323	179
228	3300025899	Ga0207642_10026787	Ga0207642_100267872	179
229	3300025901	Ga0207688_10098748	Ga0207688_100987484	179
230	3300025918	Ga0207662_10007284	Ga0207662_100072849	179
231	3300025921	Ga0207652_10223748	Ga0207652_102237483	179
232	3300025927	Ga0207687_10033423	Ga0207687_100334236	179
233	3300025927	Ga0207687_10113053	Ga0207687_101130533	179
234	3300025927	Ga0207687_11487788	Ga0207687_114877881	179
235	3300025931	Ga0207644_11001802	Ga0207644_110018022	179
236	3300025932	Ga0207690_10739124	Ga0207690_107391242	179
237	3300025933	Ga0207706_10083036	Ga0207706_100830363	179
238	3300025935	Ga0207709_10031452	Ga0207709_100314524	179
239	3300025935	Ga0207709_10040697	Ga0207709_100406975	179
240	3300025937	Ga0207669_10052680	Ga0207669_100526805	179
241	3300025938	Ga0207704_10655461	Ga0207704_106554611	179
242	3300025939	Ga0207665_10406326	Ga0207665_104063262	179
243	3300025940	Ga0207691_10439485	Ga0207691_104394853	179
244	3300025940	Ga0207691_10496399	Ga0207691_104963992	179
245	3300025940	Ga0207691_10938457	Ga0207691_109384571	179
246	3300025942	Ga0207689_10182685	Ga0207689_101826852	179
247	3300025944	Ga0207661_10053311	Ga0207661_100533116	179
248	3300025945	Ga0207679_10665479	Ga0207679_106654792	179
249	3300025960	Ga0207651_10822924	Ga0207651_108229241	179
250	3300025986	Ga0207658_10550830	Ga0207658_105508302	179
251	3300026023	Ga0207677_10151973	Ga0207677_101519732	179
252	3300026035	Ga0207703_10044345	Ga0207703_100443453	179
253	3300026075	Ga0207708_10056364	Ga0207708_100563642	179
254	3300026089	Ga0207648_10002304	Ga0207648_1000230410	179
255	3300026089	Ga0207648_11545905	Ga0207648_115459051	179
256	3300026095	Ga0207676_10285173	Ga0207676_102851731	179
257	3300026095	Ga0207676_10415805	Ga0207676_104158052	179
258	3300026118	Ga0207675_100013791	Ga0207675_1000137919	179
259	3300026121	Ga0207683_10064538	Ga0207683_100645385	179
260	3300026142	Ga0207698_10111228	Ga0207698_101112283	179
261	3300026142	Ga0207698_10216663	Ga0207698_102166633	179
262	3300028381	Ga0268264_10431733	Ga0268264_104317331	179
263	3300031247	Ga0265340_10011241	Ga0265340_100112412	179
264	3300031727	Ga0316576_10003776	Ga0316576_100037765	179
265	3300031728	Ga0316578_10010235	Ga0316578_100102355	179
266	3300031731	Ga0307405_10422230	Ga0307405_104222301	179
267	3300031733	Ga0316577_10275110	Ga0316577_102751102	179
268	3300031824	Ga0307413_10317680	Ga0307413_103176802	179
269	3300032004	Ga0307414_10205192	Ga0307414_102051922	179
270	3300032137	Ga0316585_10027179	Ga0316585_100271792	179
271	3300032168	Ga0316593_10194501	Ga0316593_101945012	179
272	3300037466	Ga0395898_0129171	Ga0395898_0129171_566_1123	179
273	3300039437	Ga0436365_1564473	Ga0436365_1564473_403_954	179
274	3300039450	Ga0436363_0745948	Ga0436363_0745948_740_1282	179
275	3300041509	Ga0451843_0594403	Ga0451843_0594403_475_1017	179
276	3300044694	Ga0466963_0256625	Ga0466963_0256625_545_1087	179
277	3300044765	Ga0466970_0334778	Ga0466970_0334778_116_655	179
278	3300044765	Ga0466970_0619707	Ga0466970_0619707_41_580	179
279	3300046517	Ga0495630_0559775	Ga0495630_0559775_45_596	179
280	3300046523	Ga0495644_0076055	Ga0495644_0076055_396_935	179
281	3300046615	Ga0495656_0248792	Ga0495656_0248792_34_573	179
282	3300046683	Ga0495658_0160062	Ga0495658_0160062_383_922	179
283	3300046690	Ga0495624_0120928	Ga0495624_0120928_905_1456	179
284	3300046691	Ga0495670_0048528	Ga0495670_0048528_1531_2085	179
285	3300047321	Ga0495676_0062696	Ga0495676_0062696_643_1194	179
286	3300048903	Ga0496100_0333129	Ga0496100_0333129_396_935	179
287	3300048904	Ga0496101_1080042	Ga0496101_1080042_43_582	179
288	3300048905	Ga0496102_0093608	Ga0496102_0093608_1756_2313	179
289	3300048905	Ga0496102_0409845	Ga0496102_0409845_270_809	179
290	3300048906	Ga0496103_0067521	Ga0496103_0067521_773_1330	179
291	3300048906	Ga0496103_0097396	Ga0496103_0097396_622_1161	179
292	3300048907	Ga0496104_0003461	Ga0496104_0003461_11744_12301	179
293	3300048907	Ga0496104_0044998	Ga0496104_0044998_901_1440	179
294	3300048908	Ga0496105_0019578	Ga0496105_0019578_1406_1945	179
295	3300048908	Ga0496105_0291104	Ga0496105_0291104_418_957	179
296	3300048909	Ga0496106_0005388	Ga0496106_0005388_3900_4457	179
297	3300048910	Ga0496107_0045026	Ga0496107_0045026_372_929	179
298	3300048910	Ga0496107_0101838	Ga0496107_0101838_1134_1673	179
299	3300048911	Ga0496108_0030672	Ga0496108_0030672_1185_1724	179
300	3300048911	Ga0496108_0244205	Ga0496108_0244205_480_1019	179
301	3300048911	Ga0496108_0309845	Ga0496108_0309845_572_1129	179
302	3300048912	Ga0496109_0087981	Ga0496109_0087981_410_949	179
303	3300048912	Ga0496109_0169897	Ga0496109_0169897_960_1517	179
304	3300048912	Ga0496109_0180823	Ga0496109_0180823_357_896	179
305	3300048913	Ga0496110_0005006	Ga0496110_0005006_8859_9416	179
306	3300048913	Ga0496110_0029793	Ga0496110_0029793_922_1461	179
307	3300048913	Ga0496110_0256852	Ga0496110_0256852_147_686	179
308	3300048913	Ga0496110_0549806	Ga0496110_0549806_186_728	179
309	3300048914	Ga0496111_0083898	Ga0496111_0083898_47_586	179
310	3300048915	Ga0496112_0007859	Ga0496112_0007859_3950_4489	179
311	3300048916	Ga0496113_0026764	Ga0496113_0026764_935_1474	179
312	3300048917	Ga0496114_0023838	Ga0496114_0023838_3575_4114	179
313	3300048917	Ga0496114_0032918	Ga0496114_0032918_1283_1825	179
314	3300048917	Ga0496114_0260277	Ga0496114_0260277_219_758	179
315	3300048917	Ga0496114_0369827	Ga0496114_0369827_631_1182	179
316	3300048917	Ga0496114_0583536	Ga0496114_0583536_180_719	179
317	3300048921	Ga0496118_0114304	Ga0496118_0114304_95_634	179
318	3300049532	Ga0501316_000965	Ga0501316_000965_288_827	179
319	3300049533	Ga0501317_010875	Ga0501317_010875_234_773	179
320	3300049537	Ga0501321_011355	Ga0501321_011355_248_787	179
321	3300049540	Ga0501324_013376	Ga0501324_013376_40_579	179
322	3300049541	Ga0501325_007235	Ga0501325_007235_267_806	179
323	3300049572	Ga0501036_0380919	Ga0501036_0380919_113_652	179
324	3300049575	Ga0501039_0139746	Ga0501039_0139746_109_648	179
325	3300049576	Ga0501040_0345338	Ga0501040_0345338_84_635	179
326	3300049580	Ga0501046_0421109	Ga0501046_0421109_85_624	179
327	3300049582	Ga0501048_0195110	Ga0501048_0195110_371_910	179
328	3300050491	nmdc:mga00v17_586959_c1	nmdc:mga00v17_586959_c1_142_699	179
329	3300050492	nmdc:mga0yw44_388181_c1	nmdc:mga0yw44_388181_c1_389_928	179
330	3300050493	nmdc:mga0k408_166045_c1	nmdc:mga0k408_166045_c1_458_1012	179
331	3300053083	Ga0495655_0033712	Ga0495655_0033712_546_1085	179
332	3300053085	Ga0495619_0276611	Ga0495619_0276611_418_957	179
333	3300053153	Ga0500616_0000171	Ga0500616_0000171_40230_40772	179
334	3300059504	Ga0587082_057412	Ga0587082_057412_108_650	179
335	3300001979	JGI24740J21852_10024009	JGI24740J21852_100240095	180
336	3300001979	JGI24740J21852_10079538	JGI24740J21852_100795382	180
337	3300002067	JGI24735J21928_10143507	JGI24735J21928_101435071	180
338	3300003163	Ga0006759J45824_1198260	Ga0006759J45824_11982601	180
339	3300003203	JGI25406J46586_10147741	JGI25406J46586_101477411	180
340	3300005327	Ga0070658_10308216	Ga0070658_103082162	180
341	3300005329	Ga0070683_100345752	Ga0070683_1003457521	180
342	3300005456	Ga0070678_100756053	Ga0070678_1007560532	180
343	3300005535	Ga0070684_100057814	Ga0070684_1000578145	180
344	3300005535	Ga0070684_100629961	Ga0070684_1006299612	180
345	3300005614	Ga0068856_100447122	Ga0068856_1004471222	180
346	3300005844	Ga0068862_101846140	Ga0068862_1018461401	180
347	3300005985	Ga0081539_10065612	Ga0081539_100656123	180
348	3300005985	Ga0081539_10105266	Ga0081539_101052663	180
349	3300006844	Ga0075428_101480001	Ga0075428_1014800011	180
350	3300006847	Ga0075431_100496595	Ga0075431_1004965952	180
351	3300006871	Ga0075434_100661537	Ga0075434_1006615372	180
352	3300009147	Ga0114129_10462384	Ga0114129_104623842	180
353	3300013105	Ga0157369_10597198	Ga0157369_105971983	180
354	3300020069	Ga0197907_11062436	Ga0197907_110624362	180
355	3300020082	Ga0206353_11479686	Ga0206353_114796863	180
356	3300025904	Ga0207647_10369854	Ga0207647_103698541	180
357	3300025914	Ga0207671_10031792	Ga0207671_100317926	180
358	3300025944	Ga0207661_10180360	Ga0207661_101803602	180
359	3300026067	Ga0207678_10201741	Ga0207678_102017411	180
360	3300026078	Ga0207702_10497733	Ga0207702_104977332	180
361	3300026116	Ga0207674_10289059	Ga0207674_102890591	180
362	3300026118	Ga0207675_100204003	Ga0207675_1002040033	180
363	3300026121	Ga0207683_10289232	Ga0207683_102892322	180
364	3300028380	Ga0268265_11841785	Ga0268265_118417851	180
365	3300031901	Ga0307406_10681131	Ga0307406_106811311	180
366	3300031995	Ga0307409_100170067	Ga0307409_1001700671	180
367	3300032126	Ga0307415_100014503	Ga0307415_1000145035	180
368	3300044693	Ga0466961_0508724	Ga0466961_0508724_83_625	180
369	3300046463	Ga0495653_0405357	Ga0495653_0405357_131_673	180
370	3300048905	Ga0496102_0000840	Ga0496102_0000840_4742_5284	180
371	3300048906	Ga0496103_0048352	Ga0496103_0048352_1299_1841	180
372	3300048929	Ga0496126_0629326	Ga0496126_0629326_72_614	180
373	3300049592	Ga0501076_0148865	Ga0501076_0148865_204_755	180
374	3300050508	nmdc:mga09592_621397_c1	nmdc:mga09592_621397_c1_27_569	180
375	3300050509	nmdc:mga0qj67_1038021_c1	nmdc:mga0qj67_1038021_c1_71_613	180
376	3300050510	nmdc:mga06r32_269445_c1	nmdc:mga06r32_269445_c1_128_670	180
377	3300050512	nmdc:mga0n895_211328_c1	nmdc:mga0n895_211328_c1_506_1048	180
378	3300059503	Ga0587080_021386	Ga0587080_021386_503_1048	180
379	3300059604	Ga0587098_056488	Ga0587098_056488_11_556	180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

96

172

0.98 PF00347

Ribosomal_L6

Ribosomal protein L6

11

88

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5li0-assembly1.cif.gz_H	70s ribosome from staphylococcus aureus	0.9723	9	172
6yef-assembly1.cif.gz_H	70s initiation complex with assigned rrna modifications from staphylococcus aureus	0.9633	9	170
7nhn-assembly1.cif.gz_K	vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes	0.9613	9	173
5li0-assembly1.cif.gz_H	70s ribosome from staphylococcus aureus	0.9607	9	172
5dm7-assembly1.cif.gz_E	crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a	0.9577	8	176

ID	Description	Score	Start	End	Superfamily
3knmH02	Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6	0.9574	84	169	3.90.930.12
3knmH02	Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6	0.9467	84	169	3.90.930.12
af_Q09865_118_210_3.90.930.12	Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6	0.9446	84	176	3.90.930.12
2awbG02	Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6	0.938	84	176	3.90.930.12
af_O21037_77_170_3.90.930.12	Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6	0.9366	84	176	3.90.930.12

ID	Description	Score	Start	End	GO Terms
AF-A0A4Q7CIM0-F1-model_v4	50S ribosomal protein L6	1.001	86	162	GO:0002181 GO:0003735 GO:0019843 GO:0022625
AF-A0A357CQG9-F1-model_v4	50S ribosomal protein L6	0.9986	52	162	GO:0002181 GO:0003735 GO:0019843 GO:0022625
AF-X1G5X1-F1-model_v4	Large ribosomal subunit protein uL6 alpha-beta domain-containing protein	0.9853	82	155	GO:0002181 GO:0003735 GO:0019843 GO:0022625
AF-A0A357CQG9-F1-model_v4	50S ribosomal protein L6	0.9809	52	162	GO:0002181 GO:0003735 GO:0019843 GO:0022625
AF-A0A6B3I972-F1-model_v4	50S ribosomal protein L6	0.9787	70	143	GO:0002181 GO:0003735 GO:0019843 GO:0022625

Feature Viewer

pLDDT	pTM	Quality
91.69	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F428257

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00347

Ribosomal_L6

Ribosomal protein L6

96

172

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

11

88

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map