F428283

General Info

Members Datasets Scaffolds Average Seq Length
379 220 758 204

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10007109|Ga0070681_100071094
Length 250
Sequence MPLHESISLNFSRVFMNRIFNRSFDPQLIILRKSLQQEIDPYKKLMMKKIFLSIIFVMVVTITFAEKYHNGAKRDTATFAAGCFWCTQAQFQELRGVESVISGFIGGHTKNPTYEEVSTGRTGYAEACNIIYDPSLISYDELLAAFFTMHDPTELNRQGNDVGTQYRSAIFYHNAVQKAKAVYYIEKLNKVKAYKSKIVTQVTPFTVFYKAKDYHQDFYNKNPNQHYCKYVIQPELEKFRKVFKDKLKQH

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
128 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
129 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
201 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
202 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
205 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
206 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
207 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
208 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
209 2738541283 Pedobacter sp. OK701 Isolate Unclassified
210 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
211 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
212 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
213 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
214 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
215 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
216 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
217 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
218 2914759650 Rhizosphaericola mali Isolate Rhizosphere
219 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
220 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 0
Rhizoplane 0.79
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 10.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10007109 3300005458 Bacteria 10899
2 JGI24740J21852_10024939 3300001979 Bacteria 2022
3 JGI24739J22299_10001092 3300001989 Bacteria 10103
4 JGI24739J22299_10002622 3300001989 Bacteria 6928
5 JGI24739J22299_10003854 3300001989 Bacteria 5726
6 JGI24737J22298_10005536 3300001990 Bacteria 4356
7 JGI24735J21928_10000001 3300002067 Bacteria 650042
8 JGI25162J39368_1000008 3300002737 Bacteria 397212
9 JGI25153J46596_10016893 3300003215 Bacteria 2900
10 rootH1_10030686 3300003316 Bacteria 10746
11 rootL2_10052601 3300003322 Bacteria 1069
12 rootL2_10072725 3300003322 Bacteria 3127
13 rootL2_10209669 3300003322 Bacteria 1114
14 rootH1_10008609 3300003323 Bacteria 127787
15 rootH1_10050809 3300003323 Bacteria 1299
16 rootH1_10083013 3300003323 Bacteria 3761
17 Ga0055528_1002878 3300003790 Bacteria 8957
18 Ga0055531_10000026 3300003794 Bacteria 160364
19 Ga0065165_1000010 3300005262 Bacteria 323737
20 Ga0070658_10033898 3300005327 Bacteria 4109
21 Ga0070658_10315553 3300005327 Unclassified 1334
22 Ga0070676_10073809 3300005328 Bacteria 2053
23 Ga0070683_100117800 3300005329 Bacteria 2508
24 Ga0070683_100135018 3300005329 Bacteria 2336
25 Ga0070690_100819517 3300005330 Bacteria 723
26 Ga0070670_100152189 3300005331 Unclassified 2002
27 Ga0068869_100439017 3300005334 Bacteria 1080
28 Ga0070666_10034941 3300005335 Bacteria 3332
29 Ga0070666_10413291 3300005335 Bacteria 971
30 Ga0070680_100028529 3300005336 Bacteria 4477
31 Ga0070680_100252120 3300005336 Unclassified 1492
32 Ga0068868_100840003 3300005338 Unclassified 831
33 Ga0070660_100117847 3300005339 Bacteria 2118
34 Ga0070689_100023341 3300005340 Bacteria 4629
35 Ga0070689_100047387 3300005340 Bacteria 3314
36 Ga0070691_10004841 3300005341 Bacteria 6129
37 Ga0070661_100683860 3300005344 Unclassified 835
38 Ga0070661_100766497 3300005344 Bacteria 790
39 Ga0070675_100042110 3300005354 Bacteria 3731
40 Ga0070675_100224138 3300005354 Unclassified 1638
41 Ga0070673_100032874 3300005364 Bacteria 3911
42 Ga0070673_100548228 3300005364 Bacteria 1050
43 Ga0070688_100216506 3300005365 Unclassified 1348
44 Ga0070659_100013097 3300005366 Bacteria 6168
45 Ga0070659_100118228 3300005366 Bacteria 2144
46 Ga0070659_100123269 3300005366 Bacteria 2101
47 Ga0070667_100131032 3300005367 Unclassified 2188
48 Ga0070667_100174935 3300005367 Bacteria 1897
49 Ga0070667_100183130 3300005367 Unclassified 1853
50 Ga0070667_100369127 3300005367 Bacteria 1302
51 Ga0070663_100202110 3300005455 Bacteria 1551
52 Ga0070663_100975681 3300005455 Bacteria 736
53 Ga0070662_100057790 3300005457 Bacteria 2820
54 Ga0070681_10143576 3300005458 Bacteria 2316
55 Ga0070679_100006277 3300005530 Bacteria 11066
56 Ga0070679_100105466 3300005530 Bacteria 2805
57 Ga0070679_101013287 3300005530 Bacteria 774
58 Ga0070684_100146119 3300005535 Bacteria 2140
59 Ga0070672_100293201 3300005543 Bacteria 1378
60 Ga0070686_100125546 3300005544 Bacteria 1768
61 Ga0070665_100147662 3300005548 Bacteria 2354
62 Ga0068855_100000943 3300005563 Bacteria 36241
63 Ga0068855_100030315 3300005563 Bacteria 6470
64 Ga0068855_100117516 3300005563 Bacteria 3047
65 Ga0068855_100349601 3300005563 Bacteria 1629
66 Ga0070664_100429317 3300005564 Unclassified 1211
67 Ga0068857_100121400 3300005577 Unclassified 2353
68 Ga0068857_100137743 3300005577 Bacteria 2205
69 Ga0068857_100451966 3300005577 Bacteria 1201
70 Ga0068856_100219298 3300005614 Bacteria 1917
71 Ga0068852_100000877 3300005616 Bacteria 19901
72 Ga0068852_100138508 3300005616 Bacteria 2250
73 Ga0068852_100336690 3300005616 Unclassified 1470
74 Ga0068859_100033050 3300005617 Bacteria 5196
75 Ga0068864_100063299 3300005618 Bacteria 3206
76 Ga0068864_100461762 3300005618 Bacteria 1216
77 Ga0068861_100580959 3300005719 Unclassified 1025
78 Ga0068863_100384524 3300005841 Unclassified 1371
79 Ga0068863_100475083 3300005841 Bacteria 1229
80 Ga0081539_10008681 3300005985 Bacteria 8745
81 Ga0075366_10003269 3300006195 Bacteria 8521
82 Ga0075366_10011884 3300006195 Bacteria 4926
83 Ga0097621_100324902 3300006237 Bacteria 1363
84 Ga0075370_10182545 3300006353 Bacteria 1235
85 Ga0068871_100563892 3300006358 Bacteria 1033
86 Ga0068871_100638487 3300006358 Bacteria 971
87 Ga0075434_100037130 3300006871 Bacteria 4822
88 Ga0068865_100100278 3300006881 Unclassified 2118
89 Ga0068865_100188300 3300006881 Bacteria 1594
90 Ga0068865_100297257 3300006881 Bacteria 1291
91 Ga0097620_100033050 3300006931 Bacteria 5196
92 Ga0075435_100857861 3300007076 Bacteria 791
93 Ga0105240_10000418 3300009093 Bacteria 78645
94 Ga0105240_10046853 3300009093 Bacteria 5474
95 Ga0105240_10267551 3300009093 Bacteria 1969
96 Ga0105240_10421806 3300009093 Bacteria 1499
97 Ga0105240_11078501 3300009093 Bacteria 856
98 Ga0105241_10069832 3300009174 Bacteria 2724
99 Ga0105241_10084973 3300009174 Bacteria 2486
100 Ga0105242_10290449 3300009176 Bacteria 1488
101 Ga0105242_10920667 3300009176 Bacteria 876
102 Ga0105248_10256415 3300009177 Unclassified 1969
103 Ga0105237_10004109 3300009545 Bacteria 16975
104 Ga0105237_10019753 3300009545 Bacteria 6956
105 Ga0105237_10113576 3300009545 Bacteria 2701
106 Ga0105237_10162017 3300009545 Bacteria 2235
107 Ga0105238_10039050 3300009551 Bacteria 4817
108 Ga0105249_10027989 3300009553 Bacteria 5088
109 Ga0105249_10932883 3300009553 Bacteria 936
110 Ga0105239_10000015 3300010375 Bacteria 319892
111 Ga0105239_10000047 3300010375 Bacteria 179834
112 Ga0105239_10000068 3300010375 Bacteria 144666
113 Ga0105239_10002839 3300010375 Bacteria 21676
114 Ga0105239_10072850 3300010375 Bacteria 3777
115 Ga0105239_10350881 3300010375 Bacteria 1666
116 Ga0105239_11104562 3300010375 Bacteria 913
117 Ga0105246_10041029 3300011119 Bacteria 3127
118 Ga0157373_10000509 3300013100 Bacteria 30602
119 Ga0157373_10007048 3300013100 Bacteria 8375
120 Ga0157373_10058141 3300013100 Bacteria 2742
121 Ga0157373_10121559 3300013100 Bacteria 1835
122 Ga0157371_10000421 3300013102 Bacteria 52219
123 Ga0157371_10007233 3300013102 Bacteria 9016
124 Ga0157371_10082399 3300013102 Bacteria 2278
125 Ga0157371_10125102 3300013102 Bacteria 1828
126 Ga0157370_10000926 3300013104 Bacteria 37246
127 Ga0157370_10007604 3300013104 Bacteria 11767
128 Ga0157370_10024899 3300013104 Bacteria 5925
129 Ga0157370_10093228 3300013104 Bacteria 2826
130 Ga0157370_10126944 3300013104 Bacteria 2381
131 Ga0157370_10403553 3300013104 Bacteria 1258
132 Ga0157369_10053051 3300013105 Bacteria 4383
133 Ga0157369_10059151 3300013105 Bacteria 4133
134 Ga0157369_10214573 3300013105 Bacteria 2016
135 Ga0157369_10258932 3300013105 Bacteria 1815
136 Ga0157369_10349397 3300013105 Bacteria 1536
137 Ga0157374_10002668 3300013296 Bacteria 15027
138 Ga0157374_10035035 3300013296 Bacteria 4591
139 Ga0157374_10118786 3300013296 Bacteria 2550
140 Ga0157378_10040712 3300013297 Unclassified 4121
141 Ga0157378_10208316 3300013297 Unclassified 1853
142 Ga0157378_10498579 3300013297 Unclassified 1216
143 Ga0163162_10015623 3300013306 Bacteria 7419
144 Ga0163162_10018129 3300013306 Bacteria 6892
145 Ga0163162_10196473 3300013306 Bacteria 2146
146 Ga0163162_10230097 3300013306 Bacteria 1984
147 Ga0157372_10002567 3300013307 Bacteria 19693
148 Ga0157372_10012453 3300013307 Bacteria 9067
149 Ga0157372_10012804 3300013307 Bacteria 8938
150 Ga0157372_10032350 3300013307 Bacteria 5735
151 Ga0157372_10043639 3300013307 Bacteria 4965
152 Ga0157372_10141288 3300013307 Bacteria 2774
153 Ga0157372_10150050 3300013307 Bacteria 2690
154 Ga0157372_10610819 3300013307 Bacteria 1271
155 Ga0157375_10026307 3300013308 Bacteria 5420
156 Ga0157375_10031166 3300013308 Bacteria 5035
157 Ga0163163_10000509 3300014325 Bacteria 34781
158 Ga0163163_10053428 3300014325 Bacteria 3988
159 Ga0157380_10400381 3300014326 Unclassified 1302
160 Ga0182008_10001586 3300014497 Bacteria 15141
161 Ga0157377_10003828 3300014745 Bacteria 6842
162 Ga0157377_10006098 3300014745 Bacteria 5723
163 Ga0157379_10173857 3300014968 Unclassified 1944
164 Ga0157379_10184771 3300014968 Bacteria 1883
165 Ga0157376_10043095 3300014969 Bacteria 3702
166 Ga0157376_10192315 3300014969 Bacteria 1872
167 Ga0157376_10282283 3300014969 Unclassified 1564
168 Ga0182006_1022102 3300015261 Bacteria 2647
169 Ga0182005_1000093 3300015265 Bacteria 67293
170 Ga0163161_10000870 3300017792 Bacteria 23533
171 Ga0163161_10327294 3300017792 Bacteria 1213
172 Ga0209437_100030 3300025233 Bacteria 532466
173 Ga0209437_100262 3300025233 Bacteria 81344
174 Ga0209129_1005039 3300025258 Bacteria 4854
175 Ga0209673_1000082 3300025273 Bacteria 219716
176 Ga0209564_1009549 3300025295 Bacteria 4597
177 Ga0209758_1007718 3300025297 Bacteria 7223
178 Ga0209050_1001435 3300025298 Bacteria 25640
179 Ga0207426_1002748 3300025302 Bacteria 10650
180 Ga0207426_1042082 3300025302 Bacteria 1412
181 Ga0209051_1013814 3300025303 Unclassified 3812
182 Ga0209257_1000004 3300025304 Bacteria 1678347
183 Ga0209257_1004890 3300025304 Bacteria 9894
184 Ga0207697_10038903 3300025315 Bacteria 1951
185 Ga0207697_10272487 3300025315 Bacteria 750
186 Ga0207680_10025350 3300025903 Bacteria 3270
187 Ga0207647_10044960 3300025904 Bacteria 2757
188 Ga0207647_10055904 3300025904 Bacteria 2423
189 Ga0207645_10090585 3300025907 Bacteria 1967
190 Ga0207705_10064389 3300025909 Unclassified 2649
191 Ga0207705_10522731 3300025909 Bacteria 922
192 Ga0207654_10035558 3300025911 Bacteria 2777
193 Ga0207654_10152362 3300025911 Bacteria 1485
194 Ga0207695_10000039 3300025913 Bacteria 454801
195 Ga0207695_10001761 3300025913 Bacteria 34314
196 Ga0207695_10394300 3300025913 Bacteria 1269
197 Ga0207671_10001796 3300025914 Bacteria 24003
198 Ga0207671_10005427 3300025914 Bacteria 11740
199 Ga0207671_10012168 3300025914 Bacteria 6941
200 Ga0207671_10013830 3300025914 Bacteria 6409
201 Ga0207660_10008043 3300025917 Bacteria 6819
202 Ga0207657_10022466 3300025919 Bacteria 5899
203 Ga0207657_10277176 3300025919 Bacteria 1332
204 Ga0207649_10617700 3300025920 Unclassified 835
205 Ga0207652_10000115 3300025921 Bacteria 87927
206 Ga0207652_10001696 3300025921 Bacteria 19285
207 Ga0207652_10047038 3300025921 Bacteria 3685
208 Ga0207681_10607796 3300025923 Bacteria 904
209 Ga0207659_10142155 3300025926 Bacteria 1864
210 Ga0207644_10196435 3300025931 Unclassified 1589
211 Ga0207690_10023183 3300025932 Bacteria 3872
212 Ga0207690_10028040 3300025932 Bacteria 3565
213 Ga0207690_10094632 3300025932 Bacteria 2120
214 Ga0207690_10297105 3300025932 Unclassified 1263
215 Ga0207706_10020166 3300025933 Bacteria 5990
216 Ga0207670_10037593 3300025936 Bacteria 3156
217 Ga0207691_10115497 3300025940 Bacteria 2383
218 Ga0207691_10260482 3300025940 Bacteria 1495
219 Ga0207661_10169488 3300025944 Unclassified 1900
220 Ga0207679_10069367 3300025945 Bacteria 2652
221 Ga0207667_10019805 3300025949 Bacteria 7499
222 Ga0207667_10033351 3300025949 Bacteria 5536
223 Ga0207667_10061231 3300025949 Bacteria 3938
224 Ga0207667_10205108 3300025949 Bacteria 2022
225 Ga0207640_10038382 3300025981 Bacteria 3022
226 Ga0207640_10325092 3300025981 Bacteria 1226
227 Ga0207640_10482082 3300025981 Bacteria 1029
228 Ga0207640_10806427 3300025981 Unclassified 814
229 Ga0207658_10189448 3300025986 Unclassified 1708
230 Ga0207677_10041461 3300026023 Bacteria 3044
231 Ga0207677_10091451 3300026023 Bacteria 2213
232 Ga0207677_10696716 3300026023 Unclassified 901
233 Ga0207703_10026546 3300026035 Bacteria 4559
234 Ga0207639_10122511 3300026041 Bacteria 2139
235 Ga0207639_10331011 3300026041 Bacteria 1355
236 Ga0207678_10068379 3300026067 Bacteria 3048
237 Ga0207702_10075938 3300026078 Bacteria 2903
238 Ga0207702_10352941 3300026078 Bacteria 1408
239 Ga0207702_10411019 3300026078 Bacteria 1307
240 Ga0207676_10159536 3300026095 Unclassified 1952
241 Ga0207674_10012640 3300026116 Bacteria 9437
242 Ga0207674_10094643 3300026116 Bacteria 2974
243 Ga0207674_10113083 3300026116 Unclassified 2688
244 Ga0207674_10221125 3300026116 Unclassified 1842
245 Ga0207674_10501332 3300026116 Bacteria 1173
246 Ga0207698_10010629 3300026142 Bacteria 5931
247 Ga0207698_10141647 3300026142 Bacteria 2073
248 Ga0207698_10190908 3300026142 Bacteria 1824
249 Ga0268266_10111335 3300028379 Bacteria 2426
250 Ga0307515_10000523 3300028794 Bacteria 91316
251 Ga0316177_1006669 3300030731 Unclassified 3919
252 Ga0316176_1043863 3300030732 Bacteria 7252
253 Ga0316176_1070747 3300030732 Bacteria 28508
254 Ga0316176_1099664 3300030732 Unclassified 4171
255 Ga0316183_1073918 3300030742 Bacteria 38322
256 Ga0316183_1081447 3300030742 Bacteria 28525
257 Ga0316183_1152562 3300030742 Bacteria 15614
258 Ga0316181_1015713 3300030744 Bacteria 7529
259 Ga0316181_1121975 3300030744 Bacteria 30956
260 Ga0316182_1412300 3300030745 Bacteria 4168
261 Ga0307516_10155677 3300031730 Bacteria 2041
262 Ga0307407_10000021 3300031903 Bacteria 122064
263 Ga0307414_10023738 3300032004 Bacteria 3895
264 Ga0373923_0204857 3300035111 Bacteria 913
265 Ga0373953_0094911 3300035117 Bacteria 1251
266 Ga0373956_0098573 3300035119 Bacteria 1354
267 Ga0373955_0118110 3300035172 Bacteria 1539
268 Ga0373924_0003862 3300035410 Bacteria 5190
269 Ga0373933_0032071 3300035724 Bacteria 3052
270 Ga0373947_0076206 3300035725 Unclassified 2067
271 Ga0373937_0020346 3300036401 Bacteria 5950
272 Ga0373925_0327883 3300037068 Unclassified 1240
273 Ga0395899_0055103 3300037312 Bacteria 2941
274 Ga0395899_0127596 3300037312 Bacteria 1818
275 Ga0395900_0001238 3300037418 Bacteria 31389
276 Ga0395900_0102299 3300037418 Bacteria 2943
277 Ga0395900_0310619 3300037418 Bacteria 1560
278 Ga0395898_0001651 3300037466 Bacteria 30118
279 Ga0395898_0003839 3300037466 Bacteria 16653
280 Ga0395898_0176590 3300037466 Bacteria 2041
281 Ga0395905_0000003 3300037471 Bacteria 1347396
282 Ga0395905_0792126 3300037471 Bacteria 851
283 Ga0395901_0004458 3300038443 Bacteria 14124
284 Ga0395901_0041369 3300038443 Bacteria 4775
285 Ga0395901_0053434 3300038443 Bacteria 4197
286 Ga0451577_0037884 3300042876 Bacteria 4339
287 Ga0466972_0000019 3300044658 Bacteria 198523
288 Ga0453684_0009845 3300044712 Bacteria 16551
289 Ga0495592_0255381 3300046454 Bacteria 1157
290 Ga0495653_0066948 3300046463 Bacteria 2700
291 Ga0495585_0000132 3300046492 Bacteria 80905
292 Ga0495585_0000785 3300046492 Bacteria 28010
293 Ga0495583_0019108 3300046506 Bacteria 3586
294 Ga0495606_0000130 3300046507 Bacteria 127805
295 Ga0495606_0065417 3300046507 Bacteria 2310
296 Ga0495606_0311105 3300046507 Bacteria 850
297 Ga0495610_0012305 3300046512 Bacteria 5160
298 Ga0495610_0088360 3300046512 Bacteria 1409
299 Ga0495616_0011621 3300046513 Bacteria 5036
300 Ga0495616_0013165 3300046513 Bacteria 4675
301 Ga0495618_0007264 3300046514 Bacteria 6702
302 Ga0495628_0004985 3300046516 Bacteria 11667
303 Ga0495637_0166511 3300046520 Bacteria 824
304 Ga0495648_0008927 3300046524 Bacteria 7835
305 Ga0495648_0010174 3300046524 Bacteria 7192
306 Ga0495652_0397162 3300046529 Bacteria 977
307 Ga0495654_0050661 3300046530 Bacteria 2028
308 Ga0495586_0258098 3300046535 Unclassified 995
309 Ga0495587_0012954 3300046536 Bacteria 5243
310 Ga0495609_0011689 3300046538 Bacteria 4177
311 Ga0495633_0000785 3300046558 Bacteria 28402
312 Ga0495668_0000011 3300046616 Bacteria 472186
313 Ga0495668_0000648 3300046616 Bacteria 41759
314 Ga0495668_0182588 3300046616 Bacteria 1149
315 Ga0495634_0012792 3300046642 Bacteria 6073
316 Ga0495625_0001013 3300046660 Bacteria 37051
317 Ga0495625_0001500 3300046660 Bacteria 28046
318 Ga0495625_0027201 3300046660 Bacteria 4311
319 Ga0495625_0124945 3300046660 Bacteria 1747
320 Ga0495625_0255513 3300046660 Bacteria 1136
321 Ga0495635_0433479 3300046663 Bacteria 870
322 Ga0495661_0054610 3300046665 Bacteria 2397
323 Ga0495661_0179417 3300046665 Bacteria 1123
324 Ga0495657_0097768 3300046675 Bacteria 1874
325 Ga0495649_0000419 3300046694 Bacteria 36929
326 Ga0495600_0211055 3300046809 Bacteria 1244
327 Ga0495604_0207022 3300047317 Bacteria 1357
328 Ga0495680_0081768 3300047322 Bacteria 2438
329 Ga0495683_0037059 3300047323 Bacteria 2474
330 Ga0495687_000413 3300047443 Bacteria 52876
331 Ga0495687_003027 3300047443 Bacteria 12646
332 Ga0495687_077553 3300047443 Bacteria 1312
333 Ga0495675_0465103 3300047444 Unclassified 730
334 Ga0495686_0000040 3300047472 Bacteria 301210
335 Ga0495686_0000150 3300047472 Bacteria 135172
336 Ga0495686_0000309 3300047472 Bacteria 82637
337 Ga0495686_0001245 3300047472 Bacteria 29041
338 Ga0495686_0020376 3300047472 Bacteria 4423
339 Ga0495686_0128193 3300047472 Bacteria 1507
340 Ga0496108_0326355 3300048911 Bacteria 1338
341 Ga0496110_0217310 3300048913 Bacteria 1738
342 Ga0496121_0000028 3300048924 Bacteria 439193
343 Ga0496122_0002455 3300048925 Bacteria 26237
344 Ga0496123_0005573 3300048926 Bacteria 12596
345 Ga0496125_0069331 3300048928 Bacteria 2768
346 Ga0501034_0037345 3300049571 Bacteria 4918
347 Ga0501037_0334562 3300049573 Bacteria 1047
348 Ga0501047_0441826 3300049581 Bacteria 1131
349 Ga0501070_0325250 3300049586 Bacteria 1250
350 Ga0501072_0087666 3300049588 Unclassified 2470
351 Ga0501035_0277155 3300049822 Bacteria 1418
352 nmdc:mga07m45_174990_c1 3300050496 Bacteria 1248
353 nmdc:mga0n895_103310_c1 3300050512 Bacteria 2861
354 Ga0495619_0274276 3300053085 Bacteria 1169
355 Ga0500578_0040920 3300053086 Bacteria 2978
356 Ga0500556_0045930 3300053104 Bacteria 1561
357 Ga0500618_000021 3300053125 Bacteria 160813
358 Ga0500618_025698 3300053125 Bacteria 1410
359 Ga0500642_0085472 3300053130 Bacteria 1453
360 Ga0500564_098583 3300053138 Bacteria 1294
361 Ga0500616_0042815 3300053153 Bacteria 2423
362 Ga0500619_185965 3300053154 Bacteria 700
363 Ga0500624_000262 3300053157 Bacteria 18417
364 Ga0500627_0009147 3300053158 Bacteria 3556
365 2599477166 2599185184 Bacteria 6430550
366 2644009478 2643221600 Bacteria 5530138
367 2738756926 2738541283 Bacteria 7222293
368 2740057287 2739367874 Bacteria 4872888
369 2819682173 2818991460 Bacteria 7595395
370 2821139599 2821136567 Bacteria 8080116
371 2842905463 2842903701 Bacteria 6986368
372 2842907515 2842903701 Bacteria 6986368
373 2852624570 2852623160 Bacteria 4376875
374 2884794799 2884791551 Bacteria 8511252
375 2884936544 2884933994 Bacteria 4535041
376 2904471765 2904467357 Bacteria 8057758
377 2914761135 2914759650 Bacteria 4701441
378 2919194516 2919191525 Bacteria 5765973
379 2932085840 2932082852 Bacteria 6563563
380 Ga0070681_10007109
381 JGI24740J21852_10024939
382 JGI24739J22299_10001092
383 JGI24739J22299_10002622
384 JGI24739J22299_10003854
385 JGI24737J22298_10005536
386 JGI24735J21928_10000001
387 JGI25162J39368_1000008
388 JGI25153J46596_10016893
389 rootH1_10030686
390 rootL2_10052601
391 rootL2_10072725
392 rootL2_10209669
393 rootH1_10008609
394 rootH1_10050809
395 rootH1_10083013
396 Ga0055528_1002878
397 Ga0055531_10000026
398 Ga0065165_1000010
399 Ga0070658_10033898
400 Ga0070658_10315553
401 Ga0070676_10073809
402 Ga0070683_100117800
403 Ga0070683_100135018
404 Ga0070690_100819517
405 Ga0070670_100152189
406 Ga0068869_100439017
407 Ga0070666_10034941
408 Ga0070666_10413291
409 Ga0070680_100028529
410 Ga0070680_100252120
411 Ga0068868_100840003
412 Ga0070660_100117847
413 Ga0070689_100023341
414 Ga0070689_100047387
415 Ga0070691_10004841
416 Ga0070661_100683860
417 Ga0070661_100766497
418 Ga0070675_100042110
419 Ga0070675_100224138
420 Ga0070673_100032874
421 Ga0070673_100548228
422 Ga0070688_100216506
423 Ga0070659_100013097
424 Ga0070659_100118228
425 Ga0070659_100123269
426 Ga0070667_100131032
427 Ga0070667_100174935
428 Ga0070667_100183130
429 Ga0070667_100369127
430 Ga0070663_100202110
431 Ga0070663_100975681
432 Ga0070662_100057790
433 Ga0070681_10143576
434 Ga0070679_100006277
435 Ga0070679_100105466
436 Ga0070679_101013287
437 Ga0070684_100146119
438 Ga0070672_100293201
439 Ga0070686_100125546
440 Ga0070665_100147662
441 Ga0068855_100000943
442 Ga0068855_100030315
443 Ga0068855_100117516
444 Ga0068855_100349601
445 Ga0070664_100429317
446 Ga0068857_100121400
447 Ga0068857_100137743
448 Ga0068857_100451966
449 Ga0068856_100219298
450 Ga0068852_100000877
451 Ga0068852_100138508
452 Ga0068852_100336690
453 Ga0068859_100033050
454 Ga0068864_100063299
455 Ga0068864_100461762
456 Ga0068861_100580959
457 Ga0068863_100384524
458 Ga0068863_100475083
459 Ga0081539_10008681
460 Ga0075366_10003269
461 Ga0075366_10011884
462 Ga0097621_100324902
463 Ga0075370_10182545
464 Ga0068871_100563892
465 Ga0068871_100638487
466 Ga0075434_100037130
467 Ga0068865_100100278
468 Ga0068865_100188300
469 Ga0068865_100297257
470 Ga0097620_100033050
471 Ga0075435_100857861
472 Ga0105240_10000418
473 Ga0105240_10046853
474 Ga0105240_10267551
475 Ga0105240_10421806
476 Ga0105240_11078501
477 Ga0105241_10069832
478 Ga0105241_10084973
479 Ga0105242_10290449
480 Ga0105242_10920667
481 Ga0105248_10256415
482 Ga0105237_10004109
483 Ga0105237_10019753
484 Ga0105237_10113576
485 Ga0105237_10162017
486 Ga0105238_10039050
487 Ga0105249_10027989
488 Ga0105249_10932883
489 Ga0105239_10000015
490 Ga0105239_10000047
491 Ga0105239_10000068
492 Ga0105239_10002839
493 Ga0105239_10072850
494 Ga0105239_10350881
495 Ga0105239_11104562
496 Ga0105246_10041029
497 Ga0157373_10000509
498 Ga0157373_10007048
499 Ga0157373_10058141
500 Ga0157373_10121559
501 Ga0157371_10000421
502 Ga0157371_10007233
503 Ga0157371_10082399
504 Ga0157371_10125102
505 Ga0157370_10000926
506 Ga0157370_10007604
507 Ga0157370_10024899
508 Ga0157370_10093228
509 Ga0157370_10126944
510 Ga0157370_10403553
511 Ga0157369_10053051
512 Ga0157369_10059151
513 Ga0157369_10214573
514 Ga0157369_10258932
515 Ga0157369_10349397
516 Ga0157374_10002668
517 Ga0157374_10035035
518 Ga0157374_10118786
519 Ga0157378_10040712
520 Ga0157378_10208316
521 Ga0157378_10498579
522 Ga0163162_10015623
523 Ga0163162_10018129
524 Ga0163162_10196473
525 Ga0163162_10230097
526 Ga0157372_10002567
527 Ga0157372_10012453
528 Ga0157372_10012804
529 Ga0157372_10032350
530 Ga0157372_10043639
531 Ga0157372_10141288
532 Ga0157372_10150050
533 Ga0157372_10610819
534 Ga0157375_10026307
535 Ga0157375_10031166
536 Ga0163163_10000509
537 Ga0163163_10053428
538 Ga0157380_10400381
539 Ga0182008_10001586
540 Ga0157377_10003828
541 Ga0157377_10006098
542 Ga0157379_10173857
543 Ga0157379_10184771
544 Ga0157376_10043095
545 Ga0157376_10192315
546 Ga0157376_10282283
547 Ga0182006_1022102
548 Ga0182005_1000093
549 Ga0163161_10000870
550 Ga0163161_10327294
551 Ga0209437_100030
552 Ga0209437_100262
553 Ga0209129_1005039
554 Ga0209673_1000082
555 Ga0209564_1009549
556 Ga0209758_1007718
557 Ga0209050_1001435
558 Ga0207426_1002748
559 Ga0207426_1042082
560 Ga0209051_1013814
561 Ga0209257_1000004
562 Ga0209257_1004890
563 Ga0207697_10038903
564 Ga0207697_10272487
565 Ga0207680_10025350
566 Ga0207647_10044960
567 Ga0207647_10055904
568 Ga0207645_10090585
569 Ga0207705_10064389
570 Ga0207705_10522731
571 Ga0207654_10035558
572 Ga0207654_10152362
573 Ga0207695_10000039
574 Ga0207695_10001761
575 Ga0207695_10394300
576 Ga0207671_10001796
577 Ga0207671_10005427
578 Ga0207671_10012168
579 Ga0207671_10013830
580 Ga0207660_10008043
581 Ga0207657_10022466
582 Ga0207657_10277176
583 Ga0207649_10617700
584 Ga0207652_10000115
585 Ga0207652_10001696
586 Ga0207652_10047038
587 Ga0207681_10607796
588 Ga0207659_10142155
589 Ga0207644_10196435
590 Ga0207690_10023183
591 Ga0207690_10028040
592 Ga0207690_10094632
593 Ga0207690_10297105
594 Ga0207706_10020166
595 Ga0207670_10037593
596 Ga0207691_10115497
597 Ga0207691_10260482
598 Ga0207661_10169488
599 Ga0207679_10069367
600 Ga0207667_10019805
601 Ga0207667_10033351
602 Ga0207667_10061231
603 Ga0207667_10205108
604 Ga0207640_10038382
605 Ga0207640_10325092
606 Ga0207640_10482082
607 Ga0207640_10806427
608 Ga0207658_10189448
609 Ga0207677_10041461
610 Ga0207677_10091451
611 Ga0207677_10696716
612 Ga0207703_10026546
613 Ga0207639_10122511
614 Ga0207639_10331011
615 Ga0207678_10068379
616 Ga0207702_10075938
617 Ga0207702_10352941
618 Ga0207702_10411019
619 Ga0207676_10159536
620 Ga0207674_10012640
621 Ga0207674_10094643
622 Ga0207674_10113083
623 Ga0207674_10221125
624 Ga0207674_10501332
625 Ga0207698_10010629
626 Ga0207698_10141647
627 Ga0207698_10190908
628 Ga0268266_10111335
629 Ga0307515_10000523
630 Ga0316177_1006669
631 Ga0316176_1043863
632 Ga0316176_1070747
633 Ga0316176_1099664
634 Ga0316183_1073918
635 Ga0316183_1081447
636 Ga0316183_1152562
637 Ga0316181_1015713
638 Ga0316181_1121975
639 Ga0316182_1412300
640 Ga0307516_10155677
641 Ga0307407_10000021
642 Ga0307414_10023738
643 Ga0373923_0204857
644 Ga0373953_0094911
645 Ga0373956_0098573
646 Ga0373955_0118110
647 Ga0373924_0003862
648 Ga0373933_0032071
649 Ga0373947_0076206
650 Ga0373937_0020346
651 Ga0373925_0327883
652 Ga0395899_0055103
653 Ga0395899_0127596
654 Ga0395900_0001238
655 Ga0395900_0102299
656 Ga0395900_0310619
657 Ga0395898_0001651
658 Ga0395898_0003839
659 Ga0395898_0176590
660 Ga0395905_0000003
661 Ga0395905_0792126
662 Ga0395901_0004458
663 Ga0395901_0041369
664 Ga0395901_0053434
665 Ga0451577_0037884
666 Ga0466972_0000019
667 Ga0453684_0009845
668 Ga0495592_0255381
669 Ga0495653_0066948
670 Ga0495585_0000132
671 Ga0495585_0000785
672 Ga0495583_0019108
673 Ga0495606_0000130
674 Ga0495606_0065417
675 Ga0495606_0311105
676 Ga0495610_0012305
677 Ga0495610_0088360
678 Ga0495616_0011621
679 Ga0495616_0013165
680 Ga0495618_0007264
681 Ga0495628_0004985
682 Ga0495637_0166511
683 Ga0495648_0008927
684 Ga0495648_0010174
685 Ga0495652_0397162
686 Ga0495654_0050661
687 Ga0495586_0258098
688 Ga0495587_0012954
689 Ga0495609_0011689
690 Ga0495633_0000785
691 Ga0495668_0000011
692 Ga0495668_0000648
693 Ga0495668_0182588
694 Ga0495634_0012792
695 Ga0495625_0001013
696 Ga0495625_0001500
697 Ga0495625_0027201
698 Ga0495625_0124945
699 Ga0495625_0255513
700 Ga0495635_0433479
701 Ga0495661_0054610
702 Ga0495661_0179417
703 Ga0495657_0097768
704 Ga0495649_0000419
705 Ga0495600_0211055
706 Ga0495604_0207022
707 Ga0495680_0081768
708 Ga0495683_0037059
709 Ga0495687_000413
710 Ga0495687_003027
711 Ga0495687_077553
712 Ga0495675_0465103
713 Ga0495686_0000040
714 Ga0495686_0000150
715 Ga0495686_0000309
716 Ga0495686_0001245
717 Ga0495686_0020376
718 Ga0495686_0128193
719 Ga0496108_0326355
720 Ga0496110_0217310
721 Ga0496121_0000028
722 Ga0496122_0002455
723 Ga0496123_0005573
724 Ga0496125_0069331
725 Ga0501034_0037345
726 Ga0501037_0334562
727 Ga0501047_0441826
728 Ga0501070_0325250
729 Ga0501072_0087666
730 Ga0501035_0277155
731 nmdc:mga07m45_174990_c1
732 nmdc:mga0n895_103310_c1
733 Ga0495619_0274276
734 Ga0500578_0040920
735 Ga0500556_0045930
736 Ga0500618_000021
737 Ga0500618_025698
738 Ga0500642_0085472
739 Ga0500564_098583
740 Ga0500616_0042815
741 Ga0500619_185965
742 Ga0500624_000262
743 Ga0500627_0009147
744 2599477166
745 2644009478
746 2738756926
747 2740057287
748 2819682173
749 2821139599
750 2842905463
751 2842907515
752 2852624570
753 2884794799
754 2884936544
755 2904471765
756 2914761135
757 2919194516
758 2932085840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

76

229

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqh-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (oxidized form) 0.9353 26 179
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9299 28 178
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9297 24 178
4lwl-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55a from clostridium oremlandii 0.9242 27 186
4lwm-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55d from clostridium oremlandii with methionie sulfoxide 0.9222 27 186
ID Description Score Start End Superfamily
4lwkB00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9219 27 186 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9215 28 174 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9044 28 174 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.902 27 191 3.30.1060.10
af_A4HTE0_2_175_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8979 26 178 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A7Z9UCF9-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9544 25 202 GO:0008113
GO:0036211
AF-A0A2E5ZMT9-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9521 28 201 GO:0008113
GO:0036211
AF-U5T4Z0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9521 28 202 GO:0008113
GO:0033744
GO:0036211
AF-Q22A27-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9516 27 202 GO:0008113
AF-A0A1G2M5H5-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9511 27 202 GO:0008113
GO:0033744
GO:0036211

Map