F428287

General Info

Members Datasets Scaffolds Average Seq Length
379 185 758 295

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100146652|Ga0070698_1001466522
Length 343
Sequence LCHSLVQPYLYSALTKFKRAFRHPDNYREVGGPKIKSAPGNHRGFNLKIMSLRQSLYGTGVALVTPFKSNGEVDLDALSKIIDFVINGGTEYIVTLGTTGETPALGKEEKIAIIRYTYEKVNNRVPVVVGIGGNSTPEVVKELETFPLDKATAILSASPYYNKPSQEGIFQHYKALAAASPKPILLYNVPGRTGRNMTAATTLRLANEVPNIGGIKEASGDMAQCMQILRDRPENFLVVSGDDALVLPQIACGMEGVISVAANAFPQQFTHMVRQCLKGDFKAAKSLNDVLIEAYDLMFAENNPAGVKAFMTELELLQNYLRLPMVPLSEGLYAQVQTFLKGK

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
177 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
178 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
179 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
183 2738541278 Niastella sp. CF465 Isolate Unclassified
184 2818991444 Filimonas endophytica 3197 Isolate Unclassified
185 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 0
Rhizoplane 0.53
Rhizosphere 85.49
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100146652 3300005471 Bacteria 2309
2 MRS1b_contig_5483801 2162886011 Bacteria 1145
3 JGI24740J21852_10009956 3300001979 Bacteria 3687
4 JGI25406J46586_10018717 3300003203 Bacteria 2841
5 rootH1_10030077 3300003316 Bacteria 2281
6 rootH1_10066443 3300003316 Bacteria 1322
7 rootH2_10009673 3300003320 Bacteria 54328
8 rootH2_10011544 3300003320 Bacteria 15987
9 rootH2_10163639 3300003320 Unclassified 1875
10 rootH2_10292035 3300003320 Bacteria 1394
11 rootH1_10006250 3300003323 Bacteria 22415
12 rootH1_10026687 3300003323 Bacteria 11109
13 rootH1_10083389 3300003323 Bacteria 1590
14 rootH1_10116719 3300003323 Bacteria 3726
15 rootH1_10152618 3300003323 Bacteria 3010
16 rootH1_10171050 3300003323 Bacteria 3319
17 JGI25160J50197_1019690 3300003354 Unclassified 2061
18 Ga0065712_10096572 3300005290 Bacteria 2171
19 Ga0070683_100006190 3300005329 Bacteria 10039
20 Ga0070683_100011657 3300005329 Bacteria 7611
21 Ga0070690_100083926 3300005330 Bacteria 2087
22 Ga0070670_100045712 3300005331 Bacteria 3765
23 Ga0070670_100099800 3300005331 Bacteria 2498
24 Ga0070677_10147202 3300005333 Bacteria 1092
25 Ga0068869_100003911 3300005334 Bacteria 9192
26 Ga0070666_10000051 3300005335 Bacteria 99740
27 Ga0070666_10010924 3300005335 Bacteria 5689
28 Ga0070666_10072706 3300005335 Bacteria 2342
29 Ga0070682_100002757 3300005337 Bacteria 9727
30 Ga0068868_100010578 3300005338 Bacteria 6687
31 Ga0068868_100248679 3300005338 Bacteria 1496
32 Ga0070660_100010871 3300005339 Bacteria 6442
33 Ga0070689_100205372 3300005340 Bacteria 1610
34 Ga0070661_100060093 3300005344 Bacteria 2789
35 Ga0070661_100255985 3300005344 Bacteria 1352
36 Ga0070675_100009535 3300005354 Bacteria 7552
37 Ga0070675_100039045 3300005354 Bacteria 3872
38 Ga0070675_100574627 3300005354 Bacteria 1021
39 Ga0070671_100006498 3300005355 Bacteria 9347
40 Ga0070671_100127187 3300005355 Bacteria 2146
41 Ga0070671_100157795 3300005355 Bacteria 1917
42 Ga0070674_100194533 3300005356 Bacteria 1562
43 Ga0070673_100040924 3300005364 Bacteria 3559
44 Ga0070673_100175404 3300005364 Bacteria 1832
45 Ga0070659_100004288 3300005366 Bacteria 10182
46 Ga0070667_100048411 3300005367 Unclassified 3578
47 Ga0070667_100348583 3300005367 Bacteria 1340
48 Ga0070663_100235182 3300005455 Bacteria 1444
49 Ga0070678_100037742 3300005456 Bacteria 3395
50 Ga0070678_100040099 3300005456 Bacteria 3311
51 Ga0070678_100216475 3300005456 Unclassified 1590
52 Ga0070678_100265187 3300005456 Bacteria 1446
53 Ga0070681_10029175 3300005458 Bacteria 5539
54 Ga0070681_10071962 3300005458 Bacteria 3422
55 Ga0068867_100007399 3300005459 Bacteria 7768
56 Ga0068867_100041921 3300005459 Bacteria 3345
57 Ga0070685_10238681 3300005466 Bacteria 1199
58 Ga0070679_100099285 3300005530 Bacteria 2898
59 Ga0070684_100009306 3300005535 Bacteria 7734
60 Ga0070684_100044075 3300005535 Bacteria 3856
61 Ga0070684_100070750 3300005535 Bacteria 3071
62 Ga0070684_100130335 3300005535 Bacteria 2268
63 Ga0068853_100000862 3300005539 Bacteria 21166
64 Ga0068853_100020972 3300005539 Bacteria 5439
65 Ga0068853_100174155 3300005539 Bacteria 1948
66 Ga0068853_100274539 3300005539 Bacteria 1553
67 Ga0068853_100318855 3300005539 Bacteria 1440
68 Ga0070672_100048784 3300005543 Unclassified 3292
69 Ga0070672_100231851 3300005543 Bacteria 1551
70 Ga0070672_100242297 3300005543 Bacteria 1517
71 Ga0070665_100000001 3300005548 Bacteria 1083363
72 Ga0068855_100001333 3300005563 Bacteria 30579
73 Ga0068855_100033416 3300005563 Bacteria 6138
74 Ga0068855_100056686 3300005563 Bacteria 4596
75 Ga0068855_100120093 3300005563 Bacteria 3008
76 Ga0070664_100003626 3300005564 Bacteria 12441
77 Ga0070664_100039014 3300005564 Bacteria 4000
78 Ga0070664_100228687 3300005564 Bacteria 1667
79 Ga0068857_100052292 3300005577 Bacteria 3625
80 Ga0068857_100122568 3300005577 Bacteria 2342
81 Ga0068854_100061809 3300005578 Bacteria 2714
82 Ga0068854_100102957 3300005578 Bacteria 2143
83 Ga0068856_100026002 3300005614 Bacteria 5708
84 Ga0068856_100044663 3300005614 Bacteria 4362
85 Ga0068856_100089724 3300005614 Bacteria 3057
86 Ga0068852_100093867 3300005616 Bacteria 2690
87 Ga0068852_100102353 3300005616 Bacteria 2588
88 Ga0068852_100105428 3300005616 Bacteria 2554
89 Ga0068852_100181146 3300005616 Bacteria 1981
90 Ga0068852_100221885 3300005616 Bacteria 1798
91 Ga0068852_100505316 3300005616 Bacteria 1204
92 Ga0068859_100000023 3300005617 Bacteria 221914
93 Ga0068859_100001090 3300005617 Bacteria 27692
94 Ga0068864_100105170 3300005618 Bacteria 2508
95 Ga0068864_100109347 3300005618 Bacteria 2461
96 Ga0068864_100221370 3300005618 Bacteria 1746
97 Ga0068864_100269909 3300005618 Bacteria 1585
98 Ga0068851_10039662 3300005834 Unclassified 2365
99 Ga0068851_10148657 3300005834 Bacteria 1279
100 Ga0068851_10204813 3300005834 Bacteria 1103
101 Ga0068870_10094113 3300005840 Bacteria 1681
102 Ga0068863_100008810 3300005841 Bacteria 9851
103 Ga0068863_100350862 3300005841 Bacteria 1437
104 Ga0068858_100039977 3300005842 Unclassified 4349
105 Ga0068860_100000097 3300005843 Bacteria 146573
106 Ga0068860_100017799 3300005843 Bacteria 6923
107 Ga0068860_100151644 3300005843 Bacteria 2232
108 Ga0081539_10000893 3300005985 Bacteria 57031
109 Ga0075366_10047260 3300006195 Bacteria 2551
110 Ga0097621_100000224 3300006237 Bacteria 37801
111 Ga0097621_100010422 3300006237 Bacteria 6804
112 Ga0097621_100015371 3300006237 Bacteria 5757
113 Ga0097621_100098814 3300006237 Bacteria 2452
114 Ga0097621_100365608 3300006237 Bacteria 1286
115 Ga0075370_10067601 3300006353 Bacteria 2040
116 Ga0068871_100000949 3300006358 Bacteria 19369
117 Ga0068871_100027174 3300006358 Bacteria 4472
118 Ga0068871_100034685 3300006358 Bacteria 4005
119 Ga0068871_100268662 3300006358 Bacteria 1489
120 Ga0068865_100105007 3300006881 Bacteria 2075
121 Ga0097620_100000023 3300006931 Bacteria 221914
122 Ga0097620_100001090 3300006931 Bacteria 27692
123 Ga0105240_10000208 3300009093 Bacteria 118950
124 Ga0105240_10001904 3300009093 Bacteria 34640
125 Ga0105240_10003887 3300009093 Bacteria 23076
126 Ga0105240_10063236 3300009093 Bacteria 4604
127 Ga0105240_10068793 3300009093 Bacteria 4385
128 Ga0105240_10142997 3300009093 Bacteria 2858
129 Ga0111539_10538006 3300009094 Bacteria 1361
130 Ga0105245_10179425 3300009098 Bacteria 2022
131 Ga0114129_10014118 3300009147 Bacteria 11377
132 Ga0105241_10000149 3300009174 Bacteria 50078
133 Ga0105242_10270983 3300009176 Bacteria 1538
134 Ga0105237_10001017 3300009545 Bacteria 37740
135 Ga0105237_10002490 3300009545 Bacteria 22826
136 Ga0105237_10003181 3300009545 Bacteria 19693
137 Ga0105237_10013107 3300009545 Bacteria 8702
138 Ga0105237_10062999 3300009545 Unclassified 3706
139 Ga0105237_10226240 3300009545 Bacteria 1871
140 Ga0105237_10235665 3300009545 Bacteria 1831
141 Ga0105238_10086837 3300009551 Bacteria 3115
142 Ga0105238_10119098 3300009551 Bacteria 2620
143 Ga0105249_10040349 3300009553 Bacteria 4240
144 Ga0105239_10000436 3300010375 Bacteria 61031
145 Ga0105239_10024007 3300010375 Bacteria 6716
146 Ga0105239_10038167 3300010375 Bacteria 5264
147 Ga0105239_10046834 3300010375 Bacteria 4738
148 Ga0105239_10091008 3300010375 Bacteria 3366
149 Ga0105239_10128102 3300010375 Bacteria 2822
150 Ga0105239_10425250 3300010375 Unclassified 1505
151 Ga0157373_10001117 3300013100 Bacteria 20595
152 Ga0157373_10224607 3300013100 Bacteria 1325
153 Ga0157371_10023195 3300013102 Bacteria 4537
154 Ga0157370_10007050 3300013104 Bacteria 12268
155 Ga0157370_10127449 3300013104 Bacteria 2376
156 Ga0157369_10003748 3300013105 Bacteria 18059
157 Ga0157369_10082189 3300013105 Bacteria 3447
158 Ga0157369_10100633 3300013105 Bacteria 3081
159 Ga0157369_10253160 3300013105 Bacteria 1838
160 Ga0157374_10000001 3300013296 Bacteria 1077351
161 Ga0157374_10010111 3300013296 Bacteria 8103
162 Ga0157374_10131393 3300013296 Bacteria 2423
163 Ga0157374_10149783 3300013296 Bacteria 2268
164 Ga0157374_10190308 3300013296 Bacteria 2007
165 Ga0157378_10011188 3300013297 Bacteria 7850
166 Ga0157378_10014671 3300013297 Bacteria 6862
167 Ga0157378_10018627 3300013297 Bacteria 6104
168 Ga0157378_10037967 3300013297 Bacteria 4268
169 Ga0157378_10067327 3300013297 Bacteria 3209
170 Ga0157378_10668195 3300013297 Unclassified 1056
171 Ga0163162_10000161 3300013306 Bacteria 62198
172 Ga0163162_10002183 3300013306 Bacteria 18347
173 Ga0163162_10006168 3300013306 Bacteria 11613
174 Ga0163162_10013253 3300013306 Bacteria 8052
175 Ga0163162_10014326 3300013306 Bacteria 7747
176 Ga0163162_10323479 3300013306 Bacteria 1675
177 Ga0163162_10325041 3300013306 Bacteria 1671
178 Ga0157372_10000595 3300013307 Bacteria 39419
179 Ga0157372_10075797 3300013307 Bacteria 3796
180 Ga0157372_10215184 3300013307 Bacteria 2227
181 Ga0157372_10223345 3300013307 Bacteria 2183
182 Ga0157372_10326599 3300013307 Bacteria 1786
183 Ga0157372_10351316 3300013307 Unclassified 1718
184 Ga0157372_10438954 3300013307 Bacteria 1522
185 Ga0157375_10008904 3300013308 Bacteria 8784
186 Ga0157375_10028423 3300013308 Bacteria 5241
187 Ga0157375_10068335 3300013308 Bacteria 3555
188 Ga0157375_10196750 3300013308 Unclassified 2171
189 Ga0163163_10004599 3300014325 Bacteria 11782
190 Ga0163163_10062217 3300014325 Unclassified 3698
191 Ga0157380_10013873 3300014326 Bacteria 5885
192 Ga0157377_10147494 3300014745 Bacteria 1452
193 Ga0157379_10089706 3300014968 Bacteria 2758
194 Ga0157379_10264758 3300014968 Bacteria 1563
195 Ga0157376_10004691 3300014969 Bacteria 9526
196 Ga0157376_10027137 3300014969 Bacteria 4535
197 Ga0157376_10029184 3300014969 Bacteria 4392
198 Ga0163161_10003964 3300017792 Bacteria 10379
199 Ga0163161_10312134 3300017792 Unclassified 1241
200 Ga0213876_10030088 3300021384 Bacteria 2862
201 Ga0207426_1000189 3300025302 Bacteria 153457
202 Ga0207656_10020256 3300025321 Bacteria 2642
203 Ga0207656_10024010 3300025321 Unclassified 2461
204 Ga0207680_10000053 3300025903 Bacteria 55149
205 Ga0207680_10014833 3300025903 Bacteria 4048
206 Ga0207680_10054944 3300025903 Bacteria 2398
207 Ga0207647_10004651 3300025904 Bacteria 10169
208 Ga0207647_10104362 3300025904 Bacteria 1680
209 Ga0207647_10190283 3300025904 Bacteria 1189
210 Ga0207705_10171707 3300025909 Bacteria 1633
211 Ga0207707_10022898 3300025912 Bacteria 5464
212 Ga0207695_10000076 3300025913 Bacteria 307969
213 Ga0207695_10000084 3300025913 Bacteria 282392
214 Ga0207695_10000090 3300025913 Bacteria 272143
215 Ga0207695_10000257 3300025913 Bacteria 134853
216 Ga0207695_10002714 3300025913 Bacteria 25834
217 Ga0207695_10007357 3300025913 Bacteria 14048
218 Ga0207671_10001353 3300025914 Bacteria 28612
219 Ga0207671_10003092 3300025914 Bacteria 16963
220 Ga0207671_10020465 3300025914 Bacteria 5035
221 Ga0207671_10032225 3300025914 Bacteria 3902
222 Ga0207671_10033064 3300025914 Bacteria 3849
223 Ga0207671_10040735 3300025914 Bacteria 3437
224 Ga0207671_10101819 3300025914 Bacteria 2177
225 Ga0207660_10108983 3300025917 Bacteria 2081
226 Ga0207657_10001494 3300025919 Bacteria 25019
227 Ga0207649_10071041 3300025920 Bacteria 2222
228 Ga0207649_10362236 3300025920 Bacteria 1076
229 Ga0207681_10226249 3300025923 Bacteria 1450
230 Ga0207650_10047355 3300025925 Unclassified 3168
231 Ga0207650_10132137 3300025925 Bacteria 1954
232 Ga0207659_10121334 3300025926 Bacteria 2003
233 Ga0207644_10043341 3300025931 Bacteria 3193
234 Ga0207644_10056915 3300025931 Bacteria 2822
235 Ga0207644_10076675 3300025931 Bacteria 2460
236 Ga0207644_10282168 3300025931 Bacteria 1334
237 Ga0207706_10006153 3300025933 Bacteria 11146
238 Ga0207670_10144436 3300025936 Bacteria 1758
239 Ga0207669_10151040 3300025937 Bacteria 1627
240 Ga0207704_10058062 3300025938 Bacteria 2381
241 Ga0207691_10068545 3300025940 Unclassified 3205
242 Ga0207691_10231772 3300025940 Bacteria 1599
243 Ga0207691_10388811 3300025940 Bacteria 1190
244 Ga0207689_10003009 3300025942 Bacteria 15544
245 Ga0207661_10016699 3300025944 Bacteria 5418
246 Ga0207661_10054907 3300025944 Bacteria 3192
247 Ga0207679_10013083 3300025945 Bacteria 5432
248 Ga0207679_10135816 3300025945 Bacteria 1980
249 Ga0207667_10000911 3300025949 Bacteria 37650
250 Ga0207667_10029268 3300025949 Bacteria 5974
251 Ga0207667_10035976 3300025949 Bacteria 5310
252 Ga0207667_10209367 3300025949 Unclassified 1999
253 Ga0207651_10021947 3300025960 Bacteria 3892
254 Ga0207651_10164037 3300025960 Bacteria 1745
255 Ga0207651_10164154 3300025960 Bacteria 1745
256 Ga0207651_10488085 3300025960 Bacteria 1063
257 Ga0207668_10269968 3300025972 Bacteria 1390
258 Ga0207640_10035618 3300025981 Bacteria 3116
259 Ga0207658_10047033 3300025986 Bacteria 3155
260 Ga0207658_10434181 3300025986 Bacteria 1160
261 Ga0207677_10027793 3300026023 Bacteria 3569
262 Ga0207639_10006147 3300026041 Bacteria 8151
263 Ga0207639_10015187 3300026041 Bacteria 5427
264 Ga0207639_10027360 3300026041 Bacteria 4155
265 Ga0207639_10063766 3300026041 Unclassified 2855
266 Ga0207702_10079696 3300026078 Bacteria 2839
267 Ga0207702_10106670 3300026078 Bacteria 2483
268 Ga0207702_10234350 3300026078 Unclassified 1717
269 Ga0207641_10000202 3300026088 Bacteria 79668
270 Ga0207641_10007365 3300026088 Bacteria 9163
271 Ga0207641_10517825 3300026088 Bacteria 1160
272 Ga0207648_10077258 3300026089 Bacteria 2902
273 Ga0207648_10324983 3300026089 Bacteria 1383
274 Ga0207676_10367233 3300026095 Bacteria 1336
275 Ga0207674_10044961 3300026116 Bacteria 4546
276 Ga0207674_10081181 3300026116 Bacteria 3244
277 Ga0207683_10022620 3300026121 Bacteria 5398
278 Ga0207683_10311581 3300026121 Bacteria 1441
279 Ga0207683_10542958 3300026121 Bacteria 1074
280 Ga0207683_10551893 3300026121 Unclassified 1065
281 Ga0207698_10037620 3300026142 Bacteria 3566
282 Ga0207698_10312775 3300026142 Unclassified 1467
283 Ga0207698_10375427 3300026142 Bacteria 1351
284 Ga0268266_10000038 3300028379 Bacteria 325729
285 Ga0268264_10000525 3300028381 Bacteria 48553
286 Ga0268264_10006805 3300028381 Bacteria 9603
287 Ga0307517_10039167 3300028786 Bacteria 5217
288 Ga0307517_10198040 3300028786 Unclassified 1261
289 Ga0307515_10000002 3300028794 Bacteria 1231751
290 Ga0307515_10000076 3300028794 Bacteria 228736
291 Ga0307511_10001429 3300030521 Bacteria 25196
292 Ga0265327_10000245 3300031251 Bacteria 108670
293 Ga0265327_10068468 3300031251 Bacteria 1785
294 Ga0307513_10093409 3300031456 Bacteria 3058
295 Ga0307509_10058624 3300031507 Bacteria 4076
296 Ga0307509_10084770 3300031507 Bacteria 3263
297 Ga0307509_10184280 3300031507 Bacteria 1948
298 Ga0307509_10189587 3300031507 Bacteria 1909
299 Ga0307508_10002012 3300031616 Bacteria 22143
300 Ga0307508_10108242 3300031616 Bacteria 2379
301 Ga0307516_10003848 3300031730 Bacteria 18983
302 Ga0307414_10007878 3300032004 Bacteria 6010
303 Ga0307510_10071891 3300033180 Bacteria 3440
304 Ga0307510_10264132 3300033180 Bacteria 1201
305 Ga0373931_0191827 3300035691 Unclassified 1216
306 Ga0373935_0123084 3300035692 Bacteria 1735
307 Ga0373927_0099965 3300035695 Bacteria 1886
308 Ga0373925_0216048 3300037068 Bacteria 1529
309 Ga0436365_0142833 3300039437 Unclassified 2324
310 Ga0436365_1081651 3300039437 Bacteria 12424
311 Ga0439436_0041398 3300041404 Bacteria 1318
312 Ga0439439_0014095 3300041406 Bacteria 1943
313 Ga0451802_0124700 3300041460 Bacteria 1431
314 Ga0439449_0003119 3300042007 Bacteria 6454
315 Ga0439457_000062 3300042014 Bacteria 23176
316 Ga0439462_0002057 3300042015 Bacteria 4617
317 Ga0466969_0000772 3300044656 Bacteria 17435
318 Ga0466969_0042179 3300044656 Bacteria 2280
319 Ga0466972_0000055 3300044658 Bacteria 111338
320 Ga0466972_0000897 3300044658 Bacteria 14302
321 Ga0466972_0012675 3300044658 Bacteria 4235
322 Ga0466965_0110691 3300044683 Bacteria 1411
323 Ga0466966_0000080 3300044684 Bacteria 60746
324 Ga0466970_0024270 3300044765 Bacteria 3170
325 Ga0466970_0094103 3300044765 Unclassified 1628
326 Ga0466957_0002949 3300044842 Bacteria 9223
327 Ga0466957_0012231 3300044842 Bacteria 4968
328 Ga0466957_0184453 3300044842 Unclassified 1364
329 Ga0466959_0000009 3300045049 Bacteria 176964
330 Ga0466959_0051659 3300045049 Bacteria 3014
331 Ga0466958_0075077 3300045836 Bacteria 2073
332 Ga0495638_0000003 3300046460 Bacteria 888792
333 Ga0495638_0021426 3300046460 Bacteria 4260
334 Ga0495638_0041874 3300046460 Bacteria 2895
335 Ga0495638_0124145 3300046460 Bacteria 1523
336 Ga0495606_0004940 3300046507 Bacteria 13040
337 Ga0495648_0011249 3300046524 Bacteria 6756
338 Ga0495622_0096363 3300046557 Bacteria 1358
339 Ga0495668_0000521 3300046616 Bacteria 47898
340 Ga0495668_0010666 3300046616 Bacteria 5553
341 Ga0495611_0000828 3300046648 Bacteria 17074
342 Ga0495611_0011673 3300046648 Bacteria 3727
343 Ga0495687_000001 3300047443 Bacteria 1215582
344 Ga0495686_0000004 3300047472 Bacteria 869019
345 Ga0496101_0270199 3300048904 Bacteria 1327
346 Ga0501037_0056250 3300049573 Bacteria 2874
347 Ga0501043_0157196 3300049579 Bacteria 1778
348 Ga0501047_0030619 3300049581 Bacteria 5187
349 Ga0501047_0180841 3300049581 Bacteria 1975
350 Ga0501048_0083566 3300049582 Bacteria 2252
351 Ga0501219_000291 3300049703 Bacteria 8885
352 Ga0501225_0024879 3300049705 Bacteria 1648
353 Ga0501035_0135363 3300049822 Bacteria 2146
354 Ga0501044_0070002 3300049823 Bacteria 3570
355 Ga0501284_00098 3300050005 Bacteria 18256
356 nmdc:mga0k408_40713_c1 3300050493 Bacteria 2674
357 nmdc:mga05p37_13803_c1 3300050507 Bacteria 9679
358 nmdc:mga05p37_72139_c1 3300050507 Bacteria 4248
359 nmdc:mga06r32_60578_c1 3300050510 Bacteria 3643
360 nmdc:mga08y16_50116_c1 3300050511 Bacteria 4369
361 Ga0500578_0000218 3300053086 Bacteria 71049
362 Ga0500578_0083274 3300053086 Bacteria 2033
363 Ga0500646_0013116 3300053090 Bacteria 2145
364 Ga0500646_0019375 3300053090 Bacteria 1800
365 Ga0500583_0000325 3300053092 Bacteria 16030
366 Ga0500583_0001274 3300053092 Bacteria 7200
367 Ga0500557_001627 3300053105 Bacteria 3771
368 Ga0500577_0077296 3300053142 Bacteria 1320
369 Ga0500588_0008063 3300053146 Bacteria 2447
370 Ga0500603_008993 3300053150 Bacteria 2230
371 Ga0500616_0000007 3300053153 Bacteria 836875
372 Ga0500616_0022897 3300053153 Bacteria 3486
373 Ga0500622_0001882 3300053156 Bacteria 15851
374 Ga0500622_0013853 3300053156 Bacteria 4343
375 Ga0500622_0049659 3300053156 Bacteria 2163
376 Ga0500627_0003294 3300053158 Bacteria 4975
377 2738731110 2738541278 Bacteria 9755573
378 2819586844 2818991444 Bacteria 6968812
379 2881956693 2881955468 Bacteria 3545609
380 Ga0070698_100146652
381 MRS1b_contig_5483801
382 JGI24740J21852_10009956
383 JGI25406J46586_10018717
384 rootH1_10030077
385 rootH1_10066443
386 rootH2_10009673
387 rootH2_10011544
388 rootH2_10163639
389 rootH2_10292035
390 rootH1_10006250
391 rootH1_10026687
392 rootH1_10083389
393 rootH1_10116719
394 rootH1_10152618
395 rootH1_10171050
396 JGI25160J50197_1019690
397 Ga0065712_10096572
398 Ga0070683_100006190
399 Ga0070683_100011657
400 Ga0070690_100083926
401 Ga0070670_100045712
402 Ga0070670_100099800
403 Ga0070677_10147202
404 Ga0068869_100003911
405 Ga0070666_10000051
406 Ga0070666_10010924
407 Ga0070666_10072706
408 Ga0070682_100002757
409 Ga0068868_100010578
410 Ga0068868_100248679
411 Ga0070660_100010871
412 Ga0070689_100205372
413 Ga0070661_100060093
414 Ga0070661_100255985
415 Ga0070675_100009535
416 Ga0070675_100039045
417 Ga0070675_100574627
418 Ga0070671_100006498
419 Ga0070671_100127187
420 Ga0070671_100157795
421 Ga0070674_100194533
422 Ga0070673_100040924
423 Ga0070673_100175404
424 Ga0070659_100004288
425 Ga0070667_100048411
426 Ga0070667_100348583
427 Ga0070663_100235182
428 Ga0070678_100037742
429 Ga0070678_100040099
430 Ga0070678_100216475
431 Ga0070678_100265187
432 Ga0070681_10029175
433 Ga0070681_10071962
434 Ga0068867_100007399
435 Ga0068867_100041921
436 Ga0070685_10238681
437 Ga0070679_100099285
438 Ga0070684_100009306
439 Ga0070684_100044075
440 Ga0070684_100070750
441 Ga0070684_100130335
442 Ga0068853_100000862
443 Ga0068853_100020972
444 Ga0068853_100174155
445 Ga0068853_100274539
446 Ga0068853_100318855
447 Ga0070672_100048784
448 Ga0070672_100231851
449 Ga0070672_100242297
450 Ga0070665_100000001
451 Ga0068855_100001333
452 Ga0068855_100033416
453 Ga0068855_100056686
454 Ga0068855_100120093
455 Ga0070664_100003626
456 Ga0070664_100039014
457 Ga0070664_100228687
458 Ga0068857_100052292
459 Ga0068857_100122568
460 Ga0068854_100061809
461 Ga0068854_100102957
462 Ga0068856_100026002
463 Ga0068856_100044663
464 Ga0068856_100089724
465 Ga0068852_100093867
466 Ga0068852_100102353
467 Ga0068852_100105428
468 Ga0068852_100181146
469 Ga0068852_100221885
470 Ga0068852_100505316
471 Ga0068859_100000023
472 Ga0068859_100001090
473 Ga0068864_100105170
474 Ga0068864_100109347
475 Ga0068864_100221370
476 Ga0068864_100269909
477 Ga0068851_10039662
478 Ga0068851_10148657
479 Ga0068851_10204813
480 Ga0068870_10094113
481 Ga0068863_100008810
482 Ga0068863_100350862
483 Ga0068858_100039977
484 Ga0068860_100000097
485 Ga0068860_100017799
486 Ga0068860_100151644
487 Ga0081539_10000893
488 Ga0075366_10047260
489 Ga0097621_100000224
490 Ga0097621_100010422
491 Ga0097621_100015371
492 Ga0097621_100098814
493 Ga0097621_100365608
494 Ga0075370_10067601
495 Ga0068871_100000949
496 Ga0068871_100027174
497 Ga0068871_100034685
498 Ga0068871_100268662
499 Ga0068865_100105007
500 Ga0097620_100000023
501 Ga0097620_100001090
502 Ga0105240_10000208
503 Ga0105240_10001904
504 Ga0105240_10003887
505 Ga0105240_10063236
506 Ga0105240_10068793
507 Ga0105240_10142997
508 Ga0111539_10538006
509 Ga0105245_10179425
510 Ga0114129_10014118
511 Ga0105241_10000149
512 Ga0105242_10270983
513 Ga0105237_10001017
514 Ga0105237_10002490
515 Ga0105237_10003181
516 Ga0105237_10013107
517 Ga0105237_10062999
518 Ga0105237_10226240
519 Ga0105237_10235665
520 Ga0105238_10086837
521 Ga0105238_10119098
522 Ga0105249_10040349
523 Ga0105239_10000436
524 Ga0105239_10024007
525 Ga0105239_10038167
526 Ga0105239_10046834
527 Ga0105239_10091008
528 Ga0105239_10128102
529 Ga0105239_10425250
530 Ga0157373_10001117
531 Ga0157373_10224607
532 Ga0157371_10023195
533 Ga0157370_10007050
534 Ga0157370_10127449
535 Ga0157369_10003748
536 Ga0157369_10082189
537 Ga0157369_10100633
538 Ga0157369_10253160
539 Ga0157374_10000001
540 Ga0157374_10010111
541 Ga0157374_10131393
542 Ga0157374_10149783
543 Ga0157374_10190308
544 Ga0157378_10011188
545 Ga0157378_10014671
546 Ga0157378_10018627
547 Ga0157378_10037967
548 Ga0157378_10067327
549 Ga0157378_10668195
550 Ga0163162_10000161
551 Ga0163162_10002183
552 Ga0163162_10006168
553 Ga0163162_10013253
554 Ga0163162_10014326
555 Ga0163162_10323479
556 Ga0163162_10325041
557 Ga0157372_10000595
558 Ga0157372_10075797
559 Ga0157372_10215184
560 Ga0157372_10223345
561 Ga0157372_10326599
562 Ga0157372_10351316
563 Ga0157372_10438954
564 Ga0157375_10008904
565 Ga0157375_10028423
566 Ga0157375_10068335
567 Ga0157375_10196750
568 Ga0163163_10004599
569 Ga0163163_10062217
570 Ga0157380_10013873
571 Ga0157377_10147494
572 Ga0157379_10089706
573 Ga0157379_10264758
574 Ga0157376_10004691
575 Ga0157376_10027137
576 Ga0157376_10029184
577 Ga0163161_10003964
578 Ga0163161_10312134
579 Ga0213876_10030088
580 Ga0207426_1000189
581 Ga0207656_10020256
582 Ga0207656_10024010
583 Ga0207680_10000053
584 Ga0207680_10014833
585 Ga0207680_10054944
586 Ga0207647_10004651
587 Ga0207647_10104362
588 Ga0207647_10190283
589 Ga0207705_10171707
590 Ga0207707_10022898
591 Ga0207695_10000076
592 Ga0207695_10000084
593 Ga0207695_10000090
594 Ga0207695_10000257
595 Ga0207695_10002714
596 Ga0207695_10007357
597 Ga0207671_10001353
598 Ga0207671_10003092
599 Ga0207671_10020465
600 Ga0207671_10032225
601 Ga0207671_10033064
602 Ga0207671_10040735
603 Ga0207671_10101819
604 Ga0207660_10108983
605 Ga0207657_10001494
606 Ga0207649_10071041
607 Ga0207649_10362236
608 Ga0207681_10226249
609 Ga0207650_10047355
610 Ga0207650_10132137
611 Ga0207659_10121334
612 Ga0207644_10043341
613 Ga0207644_10056915
614 Ga0207644_10076675
615 Ga0207644_10282168
616 Ga0207706_10006153
617 Ga0207670_10144436
618 Ga0207669_10151040
619 Ga0207704_10058062
620 Ga0207691_10068545
621 Ga0207691_10231772
622 Ga0207691_10388811
623 Ga0207689_10003009
624 Ga0207661_10016699
625 Ga0207661_10054907
626 Ga0207679_10013083
627 Ga0207679_10135816
628 Ga0207667_10000911
629 Ga0207667_10029268
630 Ga0207667_10035976
631 Ga0207667_10209367
632 Ga0207651_10021947
633 Ga0207651_10164037
634 Ga0207651_10164154
635 Ga0207651_10488085
636 Ga0207668_10269968
637 Ga0207640_10035618
638 Ga0207658_10047033
639 Ga0207658_10434181
640 Ga0207677_10027793
641 Ga0207639_10006147
642 Ga0207639_10015187
643 Ga0207639_10027360
644 Ga0207639_10063766
645 Ga0207702_10079696
646 Ga0207702_10106670
647 Ga0207702_10234350
648 Ga0207641_10000202
649 Ga0207641_10007365
650 Ga0207641_10517825
651 Ga0207648_10077258
652 Ga0207648_10324983
653 Ga0207676_10367233
654 Ga0207674_10044961
655 Ga0207674_10081181
656 Ga0207683_10022620
657 Ga0207683_10311581
658 Ga0207683_10542958
659 Ga0207683_10551893
660 Ga0207698_10037620
661 Ga0207698_10312775
662 Ga0207698_10375427
663 Ga0268266_10000038
664 Ga0268264_10000525
665 Ga0268264_10006805
666 Ga0307517_10039167
667 Ga0307517_10198040
668 Ga0307515_10000002
669 Ga0307515_10000076
670 Ga0307511_10001429
671 Ga0265327_10000245
672 Ga0265327_10068468
673 Ga0307513_10093409
674 Ga0307509_10058624
675 Ga0307509_10084770
676 Ga0307509_10184280
677 Ga0307509_10189587
678 Ga0307508_10002012
679 Ga0307508_10108242
680 Ga0307516_10003848
681 Ga0307414_10007878
682 Ga0307510_10071891
683 Ga0307510_10264132
684 Ga0373931_0191827
685 Ga0373935_0123084
686 Ga0373927_0099965
687 Ga0373925_0216048
688 Ga0436365_0142833
689 Ga0436365_1081651
690 Ga0439436_0041398
691 Ga0439439_0014095
692 Ga0451802_0124700
693 Ga0439449_0003119
694 Ga0439457_000062
695 Ga0439462_0002057
696 Ga0466969_0000772
697 Ga0466969_0042179
698 Ga0466972_0000055
699 Ga0466972_0000897
700 Ga0466972_0012675
701 Ga0466965_0110691
702 Ga0466966_0000080
703 Ga0466970_0024270
704 Ga0466970_0094103
705 Ga0466957_0002949
706 Ga0466957_0012231
707 Ga0466957_0184453
708 Ga0466959_0000009
709 Ga0466959_0051659
710 Ga0466958_0075077
711 Ga0495638_0000003
712 Ga0495638_0021426
713 Ga0495638_0041874
714 Ga0495638_0124145
715 Ga0495606_0004940
716 Ga0495648_0011249
717 Ga0495622_0096363
718 Ga0495668_0000521
719 Ga0495668_0010666
720 Ga0495611_0000828
721 Ga0495611_0011673
722 Ga0495687_000001
723 Ga0495686_0000004
724 Ga0496101_0270199
725 Ga0501037_0056250
726 Ga0501043_0157196
727 Ga0501047_0030619
728 Ga0501047_0180841
729 Ga0501048_0083566
730 Ga0501219_000291
731 Ga0501225_0024879
732 Ga0501035_0135363
733 Ga0501044_0070002
734 Ga0501284_00098
735 nmdc:mga0k408_40713_c1
736 nmdc:mga05p37_13803_c1
737 nmdc:mga05p37_72139_c1
738 nmdc:mga06r32_60578_c1
739 nmdc:mga08y16_50116_c1
740 Ga0500578_0000218
741 Ga0500578_0083274
742 Ga0500646_0013116
743 Ga0500646_0019375
744 Ga0500583_0000325
745 Ga0500583_0001274
746 Ga0500557_001627
747 Ga0500577_0077296
748 Ga0500588_0008063
749 Ga0500603_008993
750 Ga0500616_0000007
751 Ga0500616_0022897
752 Ga0500622_0001882
753 Ga0500622_0013853
754 Ga0500622_0049659
755 Ga0500627_0003294
756 2738731110
757 2819586844
758 2881956693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

55

343

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.9629 7 292
3flu-assembly1.cif.gz_B crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis 0.9627 7 292
3noe-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa 0.9624 7 292
3qze-assembly2.cif.gz_D crystal structure of dapa (pa1010) at 1.6 a resolution 0.961 7 292
6p90-assembly1.cif.gz_B crystal structure of padhdps2-h56q mutant 0.9603 7 292
ID Description Score Start End Superfamily
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9595 7 293 3.20.20.70
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9586 4 292 3.20.20.70
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9545 3 294 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9528 8 299 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9507 8 295 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q3V431-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9804 3 236 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-E4M8I6-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9788 3 293 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-L1P4I3-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9788 7 290 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A3XRN1-F1-model_v4 Putative dihydrodipicolinate synthase 0.9784 191 293 GO:0005829
GO:0008840
AF-A0A838TPX4-F1-model_v4 N-acetylneuraminate lyase (EC 4.1.3.3) 0.9783 1 120 GO:0005829
GO:0008747
GO:0019262

Map