F428303

General Info

Members Datasets Scaffolds Average Seq Length
379 229 379 242

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10690795|Ga0070717_106907951
Length 273
Sequence MKRERKKLLDSSFILDPCEDMVCPFLMGEVVMQVLVVDVGGNHVKMLVTGQEAPREFASGPSMTAEEMVSGVLKAAKGWKYETVSIGYPGPVLRGKPVAEPHNLGPGWVGFNFEAAFGCPVKLINDAAMQALGSYEGGKMLFLGLGTGLGSAMIVDGIVEPMELGHLPYRKRTYEDYVGIRGWERVGEKKWRHYVADVVARLIAALEPDDVVLGGGNVHKLKEMPPGCRAGTNANAFLGGFRLWEEAGKWSASAPPNSPRQRKDKQAAEGEKT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 6.6
Rhizosphere 89.45
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1860016 2162886007 Unclassified 1081
2 CNXas_1000595 3300000545 Bacteria 2390
3 JGI24743J22301_10015981 3300001991 Bacteria 1396
4 JGI24748J21848_1005073 3300002074 Bacteria 1523
5 JGI24742J22300_10001465 3300002244 Bacteria 3723
6 JGI24751J29686_10019605 3300002459 Bacteria 1401
7 Ga0070658_10004461 3300005327 Bacteria 11399
8 Ga0070690_100029702 3300005330 Bacteria 3393
9 Ga0070690_100214805 3300005330 Bacteria 1345
10 Ga0070670_100099920 3300005331 Bacteria 2497
11 Ga0070670_100221749 3300005331 Bacteria 1645
12 Ga0070680_100363617 3300005336 Unclassified 1231
13 Ga0068868_100003067 3300005338 Bacteria 11632
14 Ga0068868_100110154 3300005338 Bacteria 2237
15 Ga0070660_100195616 3300005339 Bacteria 1639
16 Ga0070689_100010183 3300005340 Bacteria 6696
17 Ga0070689_100253816 3300005340 Bacteria 1452
18 Ga0070687_100098878 3300005343 Bacteria 1630
19 Ga0070669_100415451 3300005353 Bacteria 1103
20 Ga0070675_100083754 3300005354 Bacteria 2662
21 Ga0070675_100155675 3300005354 Bacteria 1962
22 Ga0070675_100269608 3300005354 Bacteria 1493
23 Ga0070671_100014889 3300005355 Bacteria 6284
24 Ga0070671_100223220 3300005355 Bacteria 1598
25 Ga0070673_100027939 3300005364 Bacteria 4189
26 Ga0070673_100042982 3300005364 Bacteria 3488
27 Ga0070673_100237343 3300005364 Bacteria 1584
28 Ga0070673_100686102 3300005364 Bacteria 940
29 Ga0070709_10061867 3300005434 Bacteria 2385
30 Ga0070713_100636484 3300005436 Bacteria 1015
31 Ga0070713_101044283 3300005436 Bacteria 789
32 Ga0070710_10212550 3300005437 Bacteria 1227
33 Ga0070701_10012696 3300005438 Bacteria 3807
34 Ga0070711_100111117 3300005439 Bacteria 2012
35 Ga0070711_100158496 3300005439 Bacteria 1714
36 Ga0070711_100224689 3300005439 Bacteria 1461
37 Ga0070711_100258551 3300005439 Unclassified 1369
38 Ga0070705_100178006 3300005440 Bacteria 1438
39 Ga0070708_100011916 3300005445 Bacteria 7082
40 Ga0070708_100054154 3300005445 Bacteria 3562
41 Ga0070708_100120611 3300005445 Bacteria 2419
42 Ga0070708_100325456 3300005445 Unclassified 1448
43 Ga0070663_100018782 3300005455 Bacteria 4541
44 Ga0070678_100077369 3300005456 Bacteria 2510
45 Ga0070678_100425899 3300005456 Bacteria 1158
46 Ga0070678_100500701 3300005456 Bacteria 1072
47 Ga0070662_100039702 3300005457 Bacteria 3348
48 Ga0070662_100040639 3300005457 Bacteria 3313
49 Ga0070681_10062181 3300005458 Bacteria 3707
50 Ga0068867_100069960 3300005459 Bacteria 2622
51 Ga0068867_100176950 3300005459 Bacteria 1694
52 Ga0068867_100195240 3300005459 Bacteria 1617
53 Ga0070685_10070562 3300005466 Bacteria 2069
54 Ga0070706_100066134 3300005467 Bacteria 3344
55 Ga0070706_100383745 3300005467 Bacteria 1308
56 Ga0070707_100188685 3300005468 Bacteria 2010
57 Ga0070707_100341077 3300005468 Bacteria 1455
58 Ga0070707_100622892 3300005468 Bacteria 1041
59 Ga0070698_100219889 3300005471 Bacteria 1833
60 Ga0070699_100606282 3300005518 Unclassified 998
61 Ga0070679_100080061 3300005530 Bacteria 3256
62 Ga0070684_100279420 3300005535 Bacteria 1530
63 Ga0070684_100310055 3300005535 Bacteria 1449
64 Ga0070697_100135054 3300005536 Bacteria 2071
65 Ga0070697_100256444 3300005536 Bacteria 1496
66 Ga0070697_100364901 3300005536 Bacteria 1249
67 Ga0070697_100508096 3300005536 Unclassified 1054
68 Ga0068853_100086252 3300005539 Bacteria 2752
69 Ga0070672_100041590 3300005543 Bacteria 3534
70 Ga0070672_100068513 3300005543 Bacteria 2814
71 Ga0070686_100170431 3300005544 Bacteria 1539
72 Ga0070686_100210010 3300005544 Bacteria 1401
73 Ga0070695_100170176 3300005545 Unclassified 1536
74 Ga0070665_100120329 3300005548 Bacteria 2627
75 Ga0068856_100149165 3300005614 Bacteria 2347
76 Ga0070702_100003788 3300005615 Bacteria 6832
77 Ga0068852_100199842 3300005616 Bacteria 1891
78 Ga0068859_100229358 3300005617 Bacteria 1945
79 Ga0068864_100161578 3300005618 Bacteria 2036
80 Ga0068866_10194836 3300005718 Bacteria 1206
81 Ga0068861_100097181 3300005719 Bacteria 2335
82 Ga0068851_10153941 3300005834 Bacteria 1259
83 Ga0068870_10007855 3300005840 Bacteria 4770
84 Ga0068870_10056456 3300005840 Bacteria 2096
85 Ga0068870_10294911 3300005840 Bacteria 1022
86 Ga0068863_100115866 3300005841 Bacteria 2553
87 Ga0068863_100136273 3300005841 Bacteria 2345
88 Ga0068863_100262351 3300005841 Bacteria 1670
89 Ga0068858_100077622 3300005842 Bacteria 3085
90 Ga0068858_100081830 3300005842 Bacteria 3001
91 Ga0068860_100007324 3300005843 Bacteria 11029
92 Ga0068862_100058279 3300005844 Bacteria 3313
93 Ga0068862_100120412 3300005844 Bacteria 2313
94 Ga0068862_100336577 3300005844 Bacteria 1397
95 Ga0081455_10006753 3300005937 Bacteria 12249
96 Ga0081455_10013424 3300005937 Bacteria 8096
97 Ga0081455_10014206 3300005937 Bacteria 7817
98 Ga0070717_10223802 3300006028 Bacteria 1654
99 Ga0070717_10690795 3300006028 Bacteria 927
100 Ga0075365_10000646 3300006038 Bacteria 13838
101 Ga0075365_10161481 3300006038 Bacteria 1561
102 Ga0070715_10129713 3300006163 Bacteria 1212
103 Ga0070716_100571198 3300006173 Bacteria 846
104 Ga0070712_100117579 3300006175 Bacteria 1995
105 Ga0070712_100240650 3300006175 Bacteria 1441
106 Ga0070712_100325275 3300006175 Bacteria 1251
107 Ga0070712_100506025 3300006175 Unclassified 1013
108 Ga0075362_10043455 3300006177 Bacteria 1990
109 Ga0097621_100060274 3300006237 Bacteria 3110
110 Ga0097621_100077403 3300006237 Bacteria 2761
111 Ga0068871_100135594 3300006358 Bacteria 2090
112 Ga0075428_100140536 3300006844 Bacteria 2625
113 Ga0075428_100409704 3300006844 Bacteria 1452
114 Ga0075430_100163399 3300006846 Bacteria 1853
115 Ga0075431_100364262 3300006847 Unclassified 1451
116 Ga0075433_10014237 3300006852 Bacteria 6495
117 Ga0075434_100076200 3300006871 Bacteria 3349
118 Ga0075434_100450628 3300006871 Bacteria 1308
119 Ga0068865_100079078 3300006881 Bacteria 2354
120 Ga0075436_100190611 3300006914 Bacteria 1450
121 Ga0097620_100229369 3300006931 Bacteria 1945
122 Ga0075435_100020764 3300007076 Bacteria 5039
123 Ga0099794_10000036 3300007265 Bacteria 55505
124 Ga0111539_10061070 3300009094 Bacteria 4465
125 Ga0111539_10155901 3300009094 Bacteria 2672
126 Ga0111539_10169026 3300009094 Bacteria 2555
127 Ga0111539_10520695 3300009094 Bacteria 1385
128 Ga0105245_10136514 3300009098 Bacteria 2306
129 Ga0105245_10168602 3300009098 Bacteria 2083
130 Ga0105245_10289424 3300009098 Bacteria 1604
131 Ga0114129_10082066 3300009147 Bacteria 4481
132 Ga0114129_10163682 3300009147 Bacteria 3037
133 Ga0114129_10310694 3300009147 Bacteria 2098
134 Ga0114129_10381371 3300009147 Bacteria 1862
135 Ga0105243_10072826 3300009148 Bacteria 2782
136 Ga0105243_10228784 3300009148 Bacteria 1648
137 Ga0105242_10079029 3300009176 Bacteria 2747
138 Ga0105242_10107550 3300009176 Bacteria 2372
139 Ga0105248_10088225 3300009177 Bacteria 3491
140 Ga0105248_10607970 3300009177 Bacteria 1233
141 Ga0105237_10087845 3300009545 Bacteria 3098
142 Ga0105249_10049259 3300009553 Bacteria 3842
143 Ga0105249_10205429 3300009553 Bacteria 1930
144 Ga0105249_10708059 3300009553 Bacteria 1067
145 Ga0105239_10097680 3300010375 Bacteria 3246
146 Ga0105239_10230321 3300010375 Bacteria 2079
147 Ga0105246_10012811 3300011119 Bacteria 5243
148 Ga0105246_10464210 3300011119 Bacteria 1067
149 Ga0157370_10278830 3300013104 Unclassified 1544
150 Ga0157369_10109006 3300013105 Bacteria 2945
151 Ga0157374_10217071 3300013296 Bacteria 1876
152 Ga0157374_10263769 3300013296 Bacteria 1697
153 Ga0157374_10557184 3300013296 Bacteria 1154
154 Ga0157378_10094886 3300013297 Bacteria 2716
155 Ga0157378_10154206 3300013297 Bacteria 2142
156 Ga0157378_10916409 3300013297 Bacteria 908
157 Ga0163162_10035103 3300013306 Bacteria 4994
158 Ga0163162_10113249 3300013306 Bacteria 2811
159 Ga0163162_10335793 3300013306 Bacteria 1644
160 Ga0157372_11216912 3300013307 Bacteria 870
161 Ga0157375_10041475 3300013308 Bacteria 4444
162 Ga0157375_10118257 3300013308 Bacteria 2757
163 Ga0157375_10828314 3300013308 Bacteria 1073
164 Ga0157375_10863690 3300013308 Bacteria 1051
165 Ga0163163_10000094 3300014325 Bacteria 94493
166 Ga0163163_10687611 3300014325 Unclassified 1087
167 Ga0157380_10011481 3300014326 Bacteria 6402
168 Ga0157380_10046090 3300014326 Bacteria 3423
169 Ga0157379_10020074 3300014968 Bacteria 5905
170 Ga0157376_10021143 3300014969 Bacteria 5050
171 Ga0157376_10118928 3300014969 Bacteria 2338
172 Ga0157376_10331221 3300014969 Bacteria 1451
173 Ga0157376_10994616 3300014969 Bacteria 861
174 Ga0163161_10021486 3300017792 Bacteria 4535
175 Ga0163161_10050600 3300017792 Bacteria 3007
176 Ga0213872_10004023 3300021361 Bacteria 7932
177 Ga0213872_10015503 3300021361 Bacteria 3541
178 Ga0213876_10000248 3300021384 Bacteria 51560
179 Ga0213871_10100131 3300021441 Bacteria 847
180 Ga0207697_10098968 3300025315 Unclassified 1242
181 Ga0207697_10126626 3300025315 Bacteria 1102
182 Ga0207653_10008984 3300025885 Bacteria 3118
183 Ga0207692_10047150 3300025898 Bacteria 2163
184 Ga0207688_10006272 3300025901 Bacteria 6475
185 Ga0207647_10019384 3300025904 Bacteria 4576
186 Ga0207699_10294895 3300025906 Bacteria 1131
187 Ga0207645_10053310 3300025907 Bacteria 2585
188 Ga0207643_10013358 3300025908 Bacteria 4446
189 Ga0207643_10161101 3300025908 Bacteria 1350
190 Ga0207684_10005794 3300025910 Bacteria 11329
191 Ga0207684_10016509 3300025910 Bacteria 6339
192 Ga0207684_10048299 3300025910 Bacteria 3609
193 Ga0207684_10190525 3300025910 Bacteria 1769
194 Ga0207654_10121804 3300025911 Bacteria 1639
195 Ga0207707_10143715 3300025912 Bacteria 2085
196 Ga0207671_10243835 3300025914 Bacteria 1412
197 Ga0207693_10018868 3300025915 Bacteria 5490
198 Ga0207693_10077080 3300025915 Bacteria 2610
199 Ga0207693_10192685 3300025915 Bacteria 1604
200 Ga0207693_10206982 3300025915 Bacteria 1542
201 Ga0207693_10248728 3300025915 Bacteria 1395
202 Ga0207693_10281907 3300025915 Unclassified 1302
203 Ga0207663_10109257 3300025916 Bacteria 1874
204 Ga0207663_10196816 3300025916 Bacteria 1451
205 Ga0207660_10053848 3300025917 Bacteria 2869
206 Ga0207662_10102465 3300025918 Bacteria 1775
207 Ga0207657_10058933 3300025919 Bacteria 3302
208 Ga0207646_10022272 3300025922 Bacteria 5840
209 Ga0207646_10035764 3300025922 Bacteria 4484
210 Ga0207681_10230164 3300025923 Bacteria 1438
211 Ga0207681_10439682 3300025923 Bacteria 1059
212 Ga0207650_10034178 3300025925 Bacteria 3686
213 Ga0207650_10052045 3300025925 Bacteria 3032
214 Ga0207659_10015977 3300025926 Bacteria 4876
215 Ga0207659_10135180 3300025926 Bacteria 1908
216 Ga0207659_10210232 3300025926 Bacteria 1559
217 Ga0207687_10111773 3300025927 Bacteria 2029
218 Ga0207644_10197457 3300025931 Bacteria 1585
219 Ga0207644_10470337 3300025931 Bacteria 1034
220 Ga0207690_10244508 3300025932 Bacteria 1383
221 Ga0207706_10011227 3300025933 Bacteria 8167
222 Ga0207686_10015227 3300025934 Bacteria 4296
223 Ga0207709_10016329 3300025935 Bacteria 4126
224 Ga0207670_10005571 3300025936 Bacteria 6921
225 Ga0207669_10076437 3300025937 Bacteria 2125
226 Ga0207704_10352566 3300025938 Bacteria 1146
227 Ga0207665_10096919 3300025939 Bacteria 2052
228 Ga0207665_10231759 3300025939 Bacteria 1357
229 Ga0207665_10597387 3300025939 Bacteria 861
230 Ga0207691_10008737 3300025940 Bacteria 9716
231 Ga0207691_10026602 3300025940 Bacteria 5428
232 Ga0207711_10015272 3300025941 Bacteria 6375
233 Ga0207711_10234879 3300025941 Bacteria 1680
234 Ga0207689_10002062 3300025942 Bacteria 18969
235 Ga0207689_10164474 3300025942 Bacteria 1828
236 Ga0207667_10084996 3300025949 Bacteria 3275
237 Ga0207651_10015326 3300025960 Bacteria 4452
238 Ga0207712_10019482 3300025961 Bacteria 4431
239 Ga0207658_10018930 3300025986 Bacteria 4761
240 Ga0207677_10010093 3300026023 Bacteria 5331
241 Ga0207677_10140955 3300026023 Bacteria 1845
242 Ga0207703_10021323 3300026035 Bacteria 5073
243 Ga0207703_10354564 3300026035 Bacteria 1351
244 Ga0207639_10164007 3300026041 Bacteria 1875
245 Ga0207678_10001556 3300026067 Bacteria 21059
246 Ga0207702_10643240 3300026078 Bacteria 1043
247 Ga0207641_10105308 3300026088 Bacteria 2491
248 Ga0207641_10176956 3300026088 Bacteria 1951
249 Ga0207648_10030645 3300026089 Bacteria 4761
250 Ga0207648_10043557 3300026089 Bacteria 3939
251 Ga0207648_10249631 3300026089 Bacteria 1582
252 Ga0207676_10024909 3300026095 Bacteria 4434
253 Ga0207676_10815275 3300026095 Unclassified 911
254 Ga0207675_100004661 3300026118 Bacteria 13210
255 Ga0207675_100036737 3300026118 Bacteria 4569
256 Ga0207675_100038933 3300026118 Bacteria 4436
257 Ga0207683_10158963 3300026121 Bacteria 2042
258 Ga0207683_10186864 3300026121 Bacteria 1880
259 Ga0207698_10051840 3300026142 Bacteria 3139
260 Ga0209588_1000020 3300027671 Bacteria 93596
261 Ga0207428_10010798 3300027907 Bacteria 8140
262 Ga0268265_10017188 3300028380 Bacteria 4986
263 Ga0268265_10118046 3300028380 Bacteria 2180
264 Ga0268265_10126495 3300028380 Bacteria 2116
265 Ga0268264_10072676 3300028381 Bacteria 2917
266 Ga0268264_10114656 3300028381 Bacteria 2366
267 Ga0268264_10147400 3300028381 Bacteria 2106
268 Ga0265338_10000096 3300028800 Bacteria 164859
269 Ga0265338_10000660 3300028800 Bacteria 59683
270 Ga0316583_10000143 3300032133 Bacteria 17023
271 Ga0373946_0169194 3300035171 Unclassified 1030
272 Ga0373947_0257775 3300035725 Bacteria 1155
273 Ga0373937_0423271 3300036401 Bacteria 1264
274 Ga0373925_0184110 3300037068 Bacteria 1655
275 Ga0395900_0530795 3300037418 Unclassified 1124
276 Ga0395905_0216602 3300037471 Unclassified 1793
277 Ga0395905_0339304 3300037471 Bacteria 1394
278 Ga0436364_1161089 3300037853 Bacteria 1602
279 Ga0436365_0519842 3300039437 Bacteria 1250
280 Ga0436365_1279257 3300039437 Bacteria 36311
281 Ga0436360_0388867 3300039438 Bacteria 3936
282 Ga0436360_0447538 3300039438 Unclassified 1543
283 Ga0436361_0079738 3300039447 Bacteria 122121
284 Ga0436361_0514504 3300039447 Unclassified 2955
285 Ga0436361_0749733 3300039447 Bacteria 1940
286 Ga0436361_0782622 3300039447 Unclassified 1155
287 Ga0436361_1079138 3300039447 Bacteria 2367
288 Ga0436363_1002948 3300039450 Bacteria 15044
289 Ga0436362_0126760 3300039453 Bacteria 2073
290 Ga0451576_0124807 3300045051 Bacteria 2682
291 Ga0495580_0458354 3300046472 Bacteria 855
292 Ga0495582_0308467 3300046473 Bacteria 910
293 Ga0495664_0013995 3300046477 Bacteria 4545
294 Ga0495584_0028984 3300046491 Bacteria 2806
295 Ga0495630_0001347 3300046517 Bacteria 16886
296 Ga0495665_0341774 3300046531 Bacteria 763
297 Ga0495640_0020947 3300046533 Unclassified 4807
298 Ga0495640_0381129 3300046533 Unclassified 868
299 Ga0495586_0000906 3300046535 Bacteria 16899
300 Ga0495587_0073513 3300046536 Bacteria 1986
301 Ga0495667_0151385 3300046559 Bacteria 1494
302 Ga0495668_0188602 3300046616 Bacteria 1129
303 Ga0495634_0009693 3300046642 Bacteria 7089
304 Ga0495623_0069344 3300046679 Bacteria 2198
305 Ga0495669_0331387 3300046684 Bacteria 735
306 Ga0495613_0194114 3300046689 Bacteria 1434
307 Ga0495581_0173020 3300047315 Bacteria 1263
308 Ga0495604_0097065 3300047317 Bacteria 2174
309 Ga0495674_0002791 3300047319 Bacteria 16951
310 Ga0495674_0023465 3300047319 Bacteria 5684
311 Ga0495674_0210261 3300047319 Bacteria 1612
312 Ga0495676_0018255 3300047321 Bacteria 6185
313 Ga0495675_0080442 3300047444 Bacteria 2052
314 Ga0495679_037818 3300047446 Bacteria 1516
315 Ga0495684_0066138 3300047471 Bacteria 2748
316 Ga0495684_0271040 3300047471 Bacteria 1228
317 Ga0496100_0013220 3300048903 Bacteria 4753
318 Ga0496101_0039104 3300048904 Bacteria 3371
319 Ga0496101_0133310 3300048904 Bacteria 1888
320 Ga0496101_0171236 3300048904 Bacteria 1669
321 Ga0496101_0425741 3300048904 Bacteria 1046
322 Ga0496102_0032198 3300048905 Bacteria 4710
323 Ga0496103_0003147 3300048906 Bacteria 10138
324 Ga0496104_0018903 3300048907 Bacteria 6294
325 Ga0496105_0001762 3300048908 Bacteria 15472
326 Ga0496106_0009698 3300048909 Bacteria 7108
327 Ga0496107_0044542 3300048910 Bacteria 3189
328 Ga0496107_0498643 3300048910 Bacteria 903
329 Ga0496108_0008535 3300048911 Bacteria 8308
330 Ga0496108_0174990 3300048911 Bacteria 1858
331 Ga0496109_0011377 3300048912 Bacteria 7645
332 Ga0496110_0004777 3300048913 Bacteria 10548
333 Ga0496111_0037676 3300048914 Bacteria 3461
334 Ga0496112_0013483 3300048915 Bacteria 7547
335 Ga0496112_0645330 3300048915 Bacteria 988
336 Ga0496113_0011048 3300048916 Bacteria 6003
337 Ga0496113_0548388 3300048916 Bacteria 927
338 Ga0496114_0055620 3300048917 Bacteria 3300
339 Ga0496114_0175926 3300048917 Bacteria 1867
340 Ga0496115_0123863 3300048918 Bacteria 2128
341 Ga0496115_0254355 3300048918 Bacteria 1445
342 Ga0501047_0046285 3300049581 Bacteria 4205
343 Ga0501074_0444663 3300049590 Bacteria 919
344 Ga0501075_0028996 3300049591 Bacteria 4091
345 Ga0501076_0021979 3300049592 Bacteria 4900
346 Ga0501081_0042658 3300049743 Bacteria 3109
347 Ga0501083_0205263 3300049744 Bacteria 1285
348 nmdc:mga03683_43281_c1 3300050489 Bacteria 1857
349 nmdc:mga0yw44_3430_c1 3300050492 Bacteria 7038
350 nmdc:mga0yw44_90193_c1 3300050492 Bacteria 1936
351 nmdc:mga0yw44_9302_c1 3300050492 Bacteria 4957
352 nmdc:mga0yw44_99689_c1 3300050492 Bacteria 1848
353 nmdc:mga06z11_12330_c1 3300050494 Bacteria 3716
354 nmdc:mga05p37_1338900_c1 3300050507 Unclassified 726
355 nmdc:mga05p37_270256_c1 3300050507 Bacteria 2032
356 nmdc:mga05p37_652937_c1 3300050507 Bacteria 1178
357 nmdc:mga05p37_860971_c1 3300050507 Bacteria 983
358 nmdc:mga09592_5639_c1 3300050508 Bacteria 10207
359 nmdc:mga0qj67_77885_c1 3300050509 Bacteria 2653
360 nmdc:mga06r32_113145_c1 3300050510 Bacteria 2671
361 nmdc:mga06r32_131971_c1 3300050510 Bacteria 2471
362 nmdc:mga06r32_518006_c1 3300050510 Bacteria 1168
363 nmdc:mga08y16_125974_c1 3300050511 Bacteria 2665
364 nmdc:mga08y16_136723_c1 3300050511 Bacteria 2547
365 nmdc:mga08y16_207852_c1 3300050511 Bacteria 2027
366 nmdc:mga08y16_507753_c1 3300050511 Bacteria 1224
367 nmdc:mga0n895_108298_c1 3300050512 Bacteria 2793
368 nmdc:mga0n895_11984_c1 3300050512 Bacteria 7759
369 nmdc:mga0n895_273585_c1 3300050512 Bacteria 1713
370 nmdc:mga0rr50_119676_c1 3300050513 Bacteria 2094
371 nmdc:mga08x19_337282_c1 3300050514 Unclassified 1051
372 nmdc:mga0a205_3977_c1 3300050515 Bacteria 13219
373 nmdc:mga0a205_407661_c1 3300050515 Bacteria 1223
374 nmdc:mga0sz30_204695_c1 3300050516 Unclassified 876
375 Ga0495601_0114755 3300053077 Bacteria 1746
376 Ga0495601_0413168 3300053077 Bacteria 874
377 Ga0495655_0014548 3300053083 Bacteria 1652
378 Ga0501084_0069243 3300054114 Bacteria 2954
379 Ga0530510_0262200 3300061734 Bacteria 1289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025885 Ga0207653_10008984 Ga0207653_100089842 209
2 3300005468 Ga0070707_100622892 Ga0070707_1006228922 211
3 3300005536 Ga0070697_100256444 Ga0070697_1002564442 211
4 3300025910 Ga0207684_10016509 Ga0207684_100165092 211
5 3300005937 Ga0081455_10014206 Ga0081455_100142068 214
6 3300026121 Ga0207683_10186864 Ga0207683_101868641 216
7 3300005330 Ga0070690_100214805 Ga0070690_1002148051 219
8 3300005331 Ga0070670_100221749 Ga0070670_1002217492 219
9 3300005338 Ga0068868_100110154 Ga0068868_1001101542 219
10 3300005340 Ga0070689_100253816 Ga0070689_1002538161 219
11 3300005354 Ga0070675_100083754 Ga0070675_1000837541 219
12 3300005364 Ga0070673_100027939 Ga0070673_1000279392 219
13 3300005456 Ga0070678_100425899 Ga0070678_1004258992 219
14 3300005459 Ga0068867_100069960 Ga0068867_1000699602 219
15 3300005719 Ga0068861_100097181 Ga0068861_1000971812 219
16 3300005840 Ga0068870_10056456 Ga0068870_100564562 219
17 3300005841 Ga0068863_100115866 Ga0068863_1001158662 219
18 3300005842 Ga0068858_100077622 Ga0068858_1000776222 219
19 3300005844 Ga0068862_100058279 Ga0068862_1000582793 219
20 3300006237 Ga0097621_100060274 Ga0097621_1000602742 219
21 3300006358 Ga0068871_100135594 Ga0068871_1001355942 219
22 3300009098 Ga0105245_10168602 Ga0105245_101686022 219
23 3300009148 Ga0105243_10228784 Ga0105243_102287842 219
24 3300009177 Ga0105248_10088225 Ga0105248_100882252 219
25 3300010375 Ga0105239_10230321 Ga0105239_102303212 219
26 3300011119 Ga0105246_10464210 Ga0105246_104642102 219
27 3300013297 Ga0157378_10154206 Ga0157378_101542062 219
28 3300013308 Ga0157375_10118257 Ga0157375_101182572 219
29 3300014969 Ga0157376_10021143 Ga0157376_100211434 219
30 3300025926 Ga0207659_10210232 Ga0207659_102102321 219
31 3300025941 Ga0207711_10015272 Ga0207711_100152724 219
32 3300025942 Ga0207689_10002062 Ga0207689_100020623 219
33 3300026023 Ga0207677_10140955 Ga0207677_101409552 219
34 3300026035 Ga0207703_10354564 Ga0207703_103545642 219
35 3300026088 Ga0207641_10176956 Ga0207641_101769562 219
36 3300026089 Ga0207648_10030645 Ga0207648_100306454 219
37 3300026118 Ga0207675_100036737 Ga0207675_1000367374 219
38 3300028380 Ga0268265_10118046 Ga0268265_101180462 219
39 3300028381 Ga0268264_10114656 Ga0268264_101146562 219
40 3300032133 Ga0316583_10000143 Ga0316583_1000014314 220
41 3300036401 Ga0373937_0423271 Ga0373937_0423271_233_895 220
42 3300050511 nmdc:mga08y16_507753_c1 nmdc:mga08y16_507753_c1_174_875 220
43 3300005471 Ga0070698_100219889 Ga0070698_1002198892 221
44 3300006852 Ga0075433_10014237 Ga0075433_100142374 221
45 3300006871 Ga0075434_100076200 Ga0075434_1000762002 221
46 3300006914 Ga0075436_100190611 Ga0075436_1001906112 221
47 3300007265 Ga0099794_10000036 Ga0099794_1000003636 221
48 3300009094 Ga0111539_10061070 Ga0111539_100610702 221
49 3300021441 Ga0213871_10100131 Ga0213871_101001311 221
50 3300027671 Ga0209588_1000020 Ga0209588_100002016 221
51 3300037853 Ga0436364_1161089 Ga0436364_1161089_337_1002 221
52 3300039437 Ga0436365_0519842 Ga0436365_0519842_540_1205 221
53 3300039438 Ga0436360_0388867 Ga0436360_0388867_750_1415 221
54 3300039438 Ga0436360_0447538 Ga0436360_0447538_665_1330 221
55 3300039447 Ga0436361_0749733 Ga0436361_0749733_969_1634 221
56 3300039447 Ga0436361_1079138 Ga0436361_1079138_984_1649 221
57 3300039450 Ga0436363_1002948 Ga0436363_1002948_2639_3304 221
58 3300039453 Ga0436362_0126760 Ga0436362_0126760_482_1147 221
59 3300050511 nmdc:mga08y16_207852_c1 nmdc:mga08y16_207852_c1_942_1628 221
60 3300050512 nmdc:mga0n895_108298_c1 nmdc:mga0n895_108298_c1_1758_2462 221
61 3300050515 nmdc:mga0a205_3977_c1 nmdc:mga0a205_3977_c1_1841_2545 221
62 3300005437 Ga0070710_10212550 Ga0070710_102125502 222
63 3300005439 Ga0070711_100224689 Ga0070711_1002246892 222
64 3300013296 Ga0157374_10557184 Ga0157374_105571842 222
65 3300021361 Ga0213872_10015503 Ga0213872_100155033 222
66 3300039447 Ga0436361_0782622 Ga0436361_0782622_320_988 222
67 3300046517 Ga0495630_0001347 Ga0495630_0001347_1068_1748 222
68 3300046533 Ga0495640_0020947 Ga0495640_0020947_3044_3724 222
69 3300046535 Ga0495586_0000906 Ga0495586_0000906_15139_15819 222
70 3300046642 Ga0495634_0009693 Ga0495634_0009693_5336_6016 222
71 3300047315 Ga0495581_0173020 Ga0495581_0173020_93_773 222
72 3300047319 Ga0495674_0002791 Ga0495674_0002791_1079_1759 222
73 3300047321 Ga0495676_0018255 Ga0495676_0018255_188_868 222
74 3300050510 nmdc:mga06r32_518006_c1 nmdc:mga06r32_518006_c1_57_728 222
75 3300000545 CNXas_1000595 CNXas_10005952 223
76 3300005434 Ga0070709_10061867 Ga0070709_100618672 223
77 3300005436 Ga0070713_101044283 Ga0070713_1010442831 223
78 3300005439 Ga0070711_100158496 Ga0070711_1001584962 223
79 3300005439 Ga0070711_100258551 Ga0070711_1002585511 223
80 3300005445 Ga0070708_100011916 Ga0070708_1000119163 223
81 3300005544 Ga0070686_100170431 Ga0070686_1001704312 223
82 3300006173 Ga0070716_100571198 Ga0070716_1005711982 223
83 3300006175 Ga0070712_100506025 Ga0070712_1005060252 223
84 3300009098 Ga0105245_10289424 Ga0105245_102894242 223
85 3300009147 Ga0114129_10381371 Ga0114129_103813712 223
86 3300013308 Ga0157375_10828314 Ga0157375_108283142 223
87 3300013308 Ga0157375_10863690 Ga0157375_108636902 223
88 3300014325 Ga0163163_10000094 Ga0163163_1000009417 223
89 3300014325 Ga0163163_10687611 Ga0163163_106876112 223
90 3300014969 Ga0157376_10994616 Ga0157376_109946162 223
91 3300021361 Ga0213872_10004023 Ga0213872_100040235 223
92 3300025898 Ga0207692_10047150 Ga0207692_100471503 223
93 3300025906 Ga0207699_10294895 Ga0207699_102948952 223
94 3300025910 Ga0207684_10005794 Ga0207684_100057945 223
95 3300025915 Ga0207693_10248728 Ga0207693_102487282 223
96 3300025915 Ga0207693_10281907 Ga0207693_102819072 223
97 3300025916 Ga0207663_10109257 Ga0207663_101092572 223
98 3300025939 Ga0207665_10231759 Ga0207665_102317592 223
99 3300025942 Ga0207689_10164474 Ga0207689_101644742 223
100 3300026078 Ga0207702_10643240 Ga0207702_106432402 223
101 3300028381 Ga0268264_10072676 Ga0268264_100726762 223
102 3300035171 Ga0373946_0169194 Ga0373946_0169194_309_998 223
103 3300037068 Ga0373925_0184110 Ga0373925_0184110_506_1195 223
104 3300037418 Ga0395900_0530795 Ga0395900_0530795_185_895 223
105 3300037471 Ga0395905_0339304 Ga0395905_0339304_282_992 223
106 3300039447 Ga0436361_0079738 Ga0436361_0079738_108330_109154 223
107 3300046472 Ga0495580_0458354 Ga0495580_0458354_128_817 223
108 3300046473 Ga0495582_0308467 Ga0495582_0308467_87_776 223
109 3300046531 Ga0495665_0341774 Ga0495665_0341774_34_723 223
110 3300046533 Ga0495640_0381129 Ga0495640_0381129_166_855 223
111 3300046536 Ga0495587_0073513 Ga0495587_0073513_392_1081 223
112 3300046559 Ga0495667_0151385 Ga0495667_0151385_720_1409 223
113 3300046679 Ga0495623_0069344 Ga0495623_0069344_1090_1779 223
114 3300046684 Ga0495669_0331387 Ga0495669_0331387_12_701 223
115 3300047317 Ga0495604_0097065 Ga0495604_0097065_477_1166 223
116 3300047444 Ga0495675_0080442 Ga0495675_0080442_262_951 223
117 3300048904 Ga0496101_0171236 Ga0496101_0171236_799_1482 223
118 3300049590 Ga0501074_0444663 Ga0501074_0444663_47_751 223
119 3300049591 Ga0501075_0028996 Ga0501075_0028996_1201_1905 223
120 3300049592 Ga0501076_0021979 Ga0501076_0021979_3198_3902 223
121 3300049743 Ga0501081_0042658 Ga0501081_0042658_1443_2147 223
122 3300050507 nmdc:mga05p37_270256_c1 nmdc:mga05p37_270256_c1_775_1494 223
123 3300054114 Ga0501084_0069243 Ga0501084_0069243_847_1551 223
124 3300061734 Ga0530510_0262200 Ga0530510_0262200_244_948 223
125 3300005353 Ga0070669_100415451 Ga0070669_1004154511 224
126 3300005354 Ga0070675_100269608 Ga0070675_1002696082 224
127 3300005355 Ga0070671_100223220 Ga0070671_1002232202 224
128 3300005364 Ga0070673_100042982 Ga0070673_1000429822 224
129 3300005364 Ga0070673_100686102 Ga0070673_1006861022 224
130 3300005457 Ga0070662_100040639 Ga0070662_1000406393 224
131 3300005459 Ga0068867_100176950 Ga0068867_1001769502 224
132 3300005467 Ga0070706_100066134 Ga0070706_1000661343 224
133 3300005536 Ga0070697_100508096 Ga0070697_1005080962 224
134 3300005543 Ga0070672_100041590 Ga0070672_1000415902 224
135 3300005840 Ga0068870_10294911 Ga0068870_102949111 224
136 3300005841 Ga0068863_100262351 Ga0068863_1002623512 224
137 3300005844 Ga0068862_100336577 Ga0068862_1003365772 224
138 3300009147 Ga0114129_10163682 Ga0114129_101636822 224
139 3300009177 Ga0105248_10607970 Ga0105248_106079702 224
140 3300013296 Ga0157374_10263769 Ga0157374_102637692 224
141 3300013306 Ga0163162_10035103 Ga0163162_100351032 224
142 3300013308 Ga0157375_10041475 Ga0157375_100414753 224
143 3300014326 Ga0157380_10046090 Ga0157380_100460903 224
144 3300014969 Ga0157376_10118928 Ga0157376_101189282 224
145 3300017792 Ga0163161_10021486 Ga0163161_100214864 224
146 3300021384 Ga0213876_10000248 Ga0213876_100002484 224
147 3300025315 Ga0207697_10126626 Ga0207697_101266261 224
148 3300025908 Ga0207643_10161101 Ga0207643_101611012 224
149 3300025910 Ga0207684_10190525 Ga0207684_101905252 224
150 3300025923 Ga0207681_10439682 Ga0207681_104396822 224
151 3300025925 Ga0207650_10034178 Ga0207650_100341782 224
152 3300025931 Ga0207644_10470337 Ga0207644_104703371 224
153 3300025933 Ga0207706_10011227 Ga0207706_100112273 224
154 3300025940 Ga0207691_10008737 Ga0207691_100087373 224
155 3300025941 Ga0207711_10234879 Ga0207711_102348792 224
156 3300026089 Ga0207648_10249631 Ga0207648_102496312 224
157 3300026095 Ga0207676_10815275 Ga0207676_108152752 224
158 3300026118 Ga0207675_100038933 Ga0207675_1000389333 224
159 3300028380 Ga0268265_10126495 Ga0268265_101264952 224
160 3300039437 Ga0436365_1279257 Ga0436365_1279257_19700_20386 224
161 3300005327 Ga0070658_10004461 Ga0070658_100044618 225
162 3300005445 Ga0070708_100120611 Ga0070708_1001206112 225
163 3300005468 Ga0070707_100341077 Ga0070707_1003410772 225
164 3300005530 Ga0070679_100080061 Ga0070679_1000800612 225
165 3300005536 Ga0070697_100135054 Ga0070697_1001350542 225
166 3300005536 Ga0070697_100364901 Ga0070697_1003649011 225
167 3300005545 Ga0070695_100170176 Ga0070695_1001701762 225
168 3300005614 Ga0068856_100149165 Ga0068856_1001491653 225
169 3300009147 Ga0114129_10082066 Ga0114129_100820663 225
170 3300025910 Ga0207684_10048299 Ga0207684_100482991 225
171 3300025922 Ga0207646_10022272 Ga0207646_100222725 225
172 3300025949 Ga0207667_10084996 Ga0207667_100849962 225
173 3300049581 Ga0501047_0046285 Ga0501047_0046285_1851_2543 225
174 3300049744 Ga0501083_0205263 Ga0501083_0205263_79_771 225
175 3300006163 Ga0070715_10129713 Ga0070715_101297132 226
176 3300009176 Ga0105242_10079029 Ga0105242_100790292 226
177 3300014969 Ga0157376_10331221 Ga0157376_103312212 226
178 3300028800 Ga0265338_10000096 Ga0265338_1000009618 226
179 3300028800 Ga0265338_10000660 Ga0265338_1000066021 226
180 3300045051 Ga0451576_0124807 Ga0451576_0124807_1155_1898 226
181 3300005336 Ga0070680_100363617 Ga0070680_1003636171 227
182 3300005445 Ga0070708_100325456 Ga0070708_1003254562 227
183 3300005458 Ga0070681_10062181 Ga0070681_100621812 227
184 3300005535 Ga0070684_100279420 Ga0070684_1002794202 227
185 3300005937 Ga0081455_10013424 Ga0081455_100134248 227
186 3300009094 Ga0111539_10155901 Ga0111539_101559012 227
187 3300013104 Ga0157370_10278830 Ga0157370_102788302 227
188 3300013105 Ga0157369_10109006 Ga0157369_101090062 227
189 3300025912 Ga0207707_10143715 Ga0207707_101437152 227
190 3300025917 Ga0207660_10053848 Ga0207660_100538481 227
191 3300035725 Ga0373947_0257775 Ga0373947_0257775_238_936 227
192 3300037471 Ga0395905_0216602 Ga0395905_0216602_580_1317 227
193 3300046477 Ga0495664_0013995 Ga0495664_0013995_2347_3057 227
194 3300046491 Ga0495584_0028984 Ga0495584_0028984_1204_1986 227
195 3300047319 Ga0495674_0023465 Ga0495674_0023465_842_1552 227
196 3300047471 Ga0495684_0066138 Ga0495684_0066138_1448_2158 227
197 3300050507 nmdc:mga05p37_1338900_c1 nmdc:mga05p37_1338900_c1_24_707 227
198 3300046689 Ga0495613_0194114 Ga0495613_0194114_101_790 228
199 3300047471 Ga0495684_0271040 Ga0495684_0271040_410_1099 228
200 3300053077 Ga0495601_0114755 Ga0495601_0114755_904_1593 228
201 3300007076 Ga0075435_100020764 Ga0075435_1000207643 229
202 3300025915 Ga0207693_10206982 Ga0207693_102069822 229
203 3300025939 Ga0207665_10597387 Ga0207665_105973872 229
204 3300039447 Ga0436361_0514504 Ga0436361_0514504_967_1677 229
205 3300050513 nmdc:mga0rr50_119676_c1 nmdc:mga0rr50_119676_c1_100_900 229
206 3300050514 nmdc:mga08x19_337282_c1 nmdc:mga08x19_337282_c1_194_994 229
207 3300005445 Ga0070708_100054154 Ga0070708_1000541543 230
208 3300005467 Ga0070706_100383745 Ga0070706_1003837452 230
209 3300005468 Ga0070707_100188685 Ga0070707_1001886853 230
210 3300006175 Ga0070712_100117579 Ga0070712_1001175792 230
211 3300013306 Ga0163162_10335793 Ga0163162_103357932 230
212 3300025915 Ga0207693_10018868 Ga0207693_100188681 230
213 3300025915 Ga0207693_10077080 Ga0207693_100770802 230
214 3300025922 Ga0207646_10035764 Ga0207646_100357644 230
215 3300005518 Ga0070699_100606282 Ga0070699_1006062822 231
216 3300048910 Ga0496107_0498643 Ga0496107_0498643_134_850 231
217 3300048917 Ga0496114_0175926 Ga0496114_0175926_1019_1735 231
218 3300048918 Ga0496115_0123863 Ga0496115_0123863_794_1510 231
219 3300050516 nmdc:mga0sz30_204695_c1 nmdc:mga0sz30_204695_c1_29_745 231
220 3300005354 Ga0070675_100155675 Ga0070675_1001556752 232
221 3300006846 Ga0075430_100163399 Ga0075430_1001633992 232
222 3300006871 Ga0075434_100450628 Ga0075434_1004506282 232
223 3300009094 Ga0111539_10169026 Ga0111539_101690262 232
224 3300009147 Ga0114129_10310694 Ga0114129_103106941 232
225 3300009553 Ga0105249_10205429 Ga0105249_102054292 232
226 3300025926 Ga0207659_10135180 Ga0207659_101351802 232
227 3300027907 Ga0207428_10010798 Ga0207428_100107983 232
228 3300050507 nmdc:mga05p37_652937_c1 nmdc:mga05p37_652937_c1_388_1140 232
229 3300050508 nmdc:mga09592_5639_c1 nmdc:mga09592_5639_c1_6955_7707 232
230 3300050509 nmdc:mga0qj67_77885_c1 nmdc:mga0qj67_77885_c1_379_1131 232
231 3300050510 nmdc:mga06r32_131971_c1 nmdc:mga06r32_131971_c1_408_1160 232
232 3300050511 nmdc:mga08y16_125974_c1 nmdc:mga08y16_125974_c1_915_1667 232
233 3300050512 nmdc:mga0n895_11984_c1 nmdc:mga0n895_11984_c1_5485_6237 232
234 3300050515 nmdc:mga0a205_407661_c1 nmdc:mga0a205_407661_c1_180_932 232
235 3300006038 Ga0075365_10000646 Ga0075365_100006464 233
236 3300006177 Ga0075362_10043455 Ga0075362_100434552 233
237 3300006844 Ga0075428_100140536 Ga0075428_1001405363 233
238 3300006847 Ga0075431_100364262 Ga0075431_1003642622 233
239 3300050489 nmdc:mga03683_43281_c1 nmdc:mga03683_43281_c1_757_1476 233
240 3300050492 nmdc:mga0yw44_3430_c1 nmdc:mga0yw44_3430_c1_3047_3766 233
241 3300050507 nmdc:mga05p37_860971_c1 nmdc:mga05p37_860971_c1_175_894 233
242 3300050510 nmdc:mga06r32_113145_c1 nmdc:mga06r32_113145_c1_823_1542 233
243 3300050511 nmdc:mga08y16_136723_c1 nmdc:mga08y16_136723_c1_1799_2518 233
244 3300050512 nmdc:mga0n895_273585_c1 nmdc:mga0n895_273585_c1_727_1521 233
245 3300001991 JGI24743J22301_10015981 JGI24743J22301_100159812 234
246 3300002074 JGI24748J21848_1005073 JGI24748J21848_10050732 234
247 3300002244 JGI24742J22300_10001465 JGI24742J22300_100014654 234
248 3300002459 JGI24751J29686_10019605 JGI24751J29686_100196052 234
249 3300005330 Ga0070690_100029702 Ga0070690_1000297022 234
250 3300005331 Ga0070670_100099920 Ga0070670_1000999202 234
251 3300005338 Ga0068868_100003067 Ga0068868_10000306712 234
252 3300005339 Ga0070660_100195616 Ga0070660_1001956162 234
253 3300005340 Ga0070689_100010183 Ga0070689_1000101835 234
254 3300005343 Ga0070687_100098878 Ga0070687_1000988782 234
255 3300005355 Ga0070671_100014889 Ga0070671_1000148893 234
256 3300005364 Ga0070673_100237343 Ga0070673_1002373432 234
257 3300005436 Ga0070713_100636484 Ga0070713_1006364842 234
258 3300005438 Ga0070701_10012696 Ga0070701_100126962 234
259 3300005439 Ga0070711_100111117 Ga0070711_1001111172 234
260 3300005440 Ga0070705_100178006 Ga0070705_1001780062 234
261 3300005455 Ga0070663_100018782 Ga0070663_1000187824 234
262 3300005456 Ga0070678_100077369 Ga0070678_1000773692 234
263 3300005456 Ga0070678_100500701 Ga0070678_1005007012 234
264 3300005457 Ga0070662_100039702 Ga0070662_1000397022 234
265 3300005459 Ga0068867_100195240 Ga0068867_1001952402 234
266 3300005466 Ga0070685_10070562 Ga0070685_100705622 234
267 3300005535 Ga0070684_100310055 Ga0070684_1003100552 234
268 3300005539 Ga0068853_100086252 Ga0068853_1000862522 234
269 3300005543 Ga0070672_100068513 Ga0070672_1000685132 234
270 3300005544 Ga0070686_100210010 Ga0070686_1002100102 234
271 3300005548 Ga0070665_100120329 Ga0070665_1001203292 234
272 3300005615 Ga0070702_100003788 Ga0070702_1000037886 234
273 3300005616 Ga0068852_100199842 Ga0068852_1001998422 234
274 3300005617 Ga0068859_100229358 Ga0068859_1002293582 234
275 3300005618 Ga0068864_100161578 Ga0068864_1001615782 234
276 3300005718 Ga0068866_10194836 Ga0068866_101948362 234
277 3300005834 Ga0068851_10153941 Ga0068851_101539412 234
278 3300005840 Ga0068870_10007855 Ga0068870_100078552 234
279 3300005841 Ga0068863_100136273 Ga0068863_1001362732 234
280 3300005842 Ga0068858_100081830 Ga0068858_1000818302 234
281 3300005843 Ga0068860_100007324 Ga0068860_1000073242 234
282 3300005844 Ga0068862_100120412 Ga0068862_1001204122 234
283 3300006028 Ga0070717_10223802 Ga0070717_102238022 234
284 3300006028 Ga0070717_10690795 Ga0070717_106907951 234
285 3300006038 Ga0075365_10161481 Ga0075365_101614812 234
286 3300006175 Ga0070712_100240650 Ga0070712_1002406502 234
287 3300006175 Ga0070712_100325275 Ga0070712_1003252752 234
288 3300006237 Ga0097621_100077403 Ga0097621_1000774032 234
289 3300006881 Ga0068865_100079078 Ga0068865_1000790783 234
290 3300006931 Ga0097620_100229369 Ga0097620_1002293692 234
291 3300009094 Ga0111539_10520695 Ga0111539_105206952 234
292 3300009098 Ga0105245_10136514 Ga0105245_101365142 234
293 3300009148 Ga0105243_10072826 Ga0105243_100728262 234
294 3300009176 Ga0105242_10107550 Ga0105242_101075503 234
295 3300009545 Ga0105237_10087845 Ga0105237_100878453 234
296 3300009553 Ga0105249_10049259 Ga0105249_100492592 234
297 3300009553 Ga0105249_10708059 Ga0105249_107080592 234
298 3300010375 Ga0105239_10097680 Ga0105239_100976802 234
299 3300011119 Ga0105246_10012811 Ga0105246_100128113 234
300 3300013297 Ga0157378_10094886 Ga0157378_100948861 234
301 3300013297 Ga0157378_10916409 Ga0157378_109164091 234
302 3300013306 Ga0163162_10113249 Ga0163162_101132492 234
303 3300013307 Ga0157372_11216912 Ga0157372_112169121 234
304 3300014326 Ga0157380_10011481 Ga0157380_100114812 234
305 3300014968 Ga0157379_10020074 Ga0157379_100200744 234
306 3300017792 Ga0163161_10050600 Ga0163161_100506003 234
307 3300025901 Ga0207688_10006272 Ga0207688_100062725 234
308 3300025904 Ga0207647_10019384 Ga0207647_100193842 234
309 3300025907 Ga0207645_10053310 Ga0207645_100533102 234
310 3300025908 Ga0207643_10013358 Ga0207643_100133583 234
311 3300025911 Ga0207654_10121804 Ga0207654_101218042 234
312 3300025914 Ga0207671_10243835 Ga0207671_102438352 234
313 3300025915 Ga0207693_10192685 Ga0207693_101926852 234
314 3300025916 Ga0207663_10196816 Ga0207663_101968162 234
315 3300025918 Ga0207662_10102465 Ga0207662_101024652 234
316 3300025919 Ga0207657_10058933 Ga0207657_100589333 234
317 3300025923 Ga0207681_10230164 Ga0207681_102301642 234
318 3300025925 Ga0207650_10052045 Ga0207650_100520452 234
319 3300025926 Ga0207659_10015977 Ga0207659_100159774 234
320 3300025927 Ga0207687_10111773 Ga0207687_101117732 234
321 3300025931 Ga0207644_10197457 Ga0207644_101974572 234
322 3300025932 Ga0207690_10244508 Ga0207690_102445082 234
323 3300025934 Ga0207686_10015227 Ga0207686_100152273 234
324 3300025935 Ga0207709_10016329 Ga0207709_100163292 234
325 3300025936 Ga0207670_10005571 Ga0207670_100055712 234
326 3300025937 Ga0207669_10076437 Ga0207669_100764372 234
327 3300025938 Ga0207704_10352566 Ga0207704_103525662 234
328 3300025939 Ga0207665_10096919 Ga0207665_100969193 234
329 3300025940 Ga0207691_10026602 Ga0207691_100266024 234
330 3300025960 Ga0207651_10015326 Ga0207651_100153264 234
331 3300025961 Ga0207712_10019482 Ga0207712_100194822 234
332 3300025986 Ga0207658_10018930 Ga0207658_100189302 234
333 3300026023 Ga0207677_10010093 Ga0207677_100100934 234
334 3300026035 Ga0207703_10021323 Ga0207703_100213234 234
335 3300026041 Ga0207639_10164007 Ga0207639_101640072 234
336 3300026067 Ga0207678_10001556 Ga0207678_1000155618 234
337 3300026088 Ga0207641_10105308 Ga0207641_101053082 234
338 3300026089 Ga0207648_10043557 Ga0207648_100435573 234
339 3300026095 Ga0207676_10024909 Ga0207676_100249093 234
340 3300026118 Ga0207675_100004661 Ga0207675_10000466110 234
341 3300026121 Ga0207683_10158963 Ga0207683_101589632 234
342 3300026142 Ga0207698_10051840 Ga0207698_100518402 234
343 3300028380 Ga0268265_10017188 Ga0268265_100171882 234
344 3300028381 Ga0268264_10147400 Ga0268264_101474002 234
345 3300046616 Ga0495668_0188602 Ga0495668_0188602_88_858 234
346 3300047319 Ga0495674_0210261 Ga0495674_0210261_378_1148 234
347 3300047446 Ga0495679_037818 Ga0495679_037818_477_1247 234
348 3300048903 Ga0496100_0013220 Ga0496100_0013220_960_1730 234
349 3300048904 Ga0496101_0039104 Ga0496101_0039104_705_1475 234
350 3300048904 Ga0496101_0133310 Ga0496101_0133310_770_1540 234
351 3300048904 Ga0496101_0425741 Ga0496101_0425741_238_1008 234
352 3300048905 Ga0496102_0032198 Ga0496102_0032198_2300_3070 234
353 3300048906 Ga0496103_0003147 Ga0496103_0003147_4242_5012 234
354 3300048907 Ga0496104_0018903 Ga0496104_0018903_4122_4892 234
355 3300048908 Ga0496105_0001762 Ga0496105_0001762_4209_4979 234
356 3300048909 Ga0496106_0009698 Ga0496106_0009698_3911_4681 234
357 3300048910 Ga0496107_0044542 Ga0496107_0044542_485_1255 234
358 3300048911 Ga0496108_0008535 Ga0496108_0008535_3329_4099 234
359 3300048911 Ga0496108_0174990 Ga0496108_0174990_1043_1813 234
360 3300048912 Ga0496109_0011377 Ga0496109_0011377_5127_5897 234
361 3300048913 Ga0496110_0004777 Ga0496110_0004777_6955_7725 234
362 3300048914 Ga0496111_0037676 Ga0496111_0037676_875_1645 234
363 3300048915 Ga0496112_0013483 Ga0496112_0013483_3460_4230 234
364 3300048915 Ga0496112_0645330 Ga0496112_0645330_168_938 234
365 3300048916 Ga0496113_0011048 Ga0496113_0011048_3231_4001 234
366 3300048916 Ga0496113_0548388 Ga0496113_0548388_97_867 234
367 3300048917 Ga0496114_0055620 Ga0496114_0055620_1128_1898 234
368 3300048918 Ga0496115_0254355 Ga0496115_0254355_385_1155 234
369 3300050492 nmdc:mga0yw44_90193_c1 nmdc:mga0yw44_90193_c1_40_810 234
370 3300050492 nmdc:mga0yw44_9302_c1 nmdc:mga0yw44_9302_c1_3537_4307 234
371 3300050492 nmdc:mga0yw44_99689_c1 nmdc:mga0yw44_99689_c1_130_903 234
372 3300050494 nmdc:mga06z11_12330_c1 nmdc:mga06z11_12330_c1_532_1302 234
373 3300053077 Ga0495601_0413168 Ga0495601_0413168_34_804 234
374 3300053083 Ga0495655_0014548 Ga0495655_0014548_309_1079 234
375 3300013296 Ga0157374_10217071 Ga0157374_102170711 235
376 3300025315 Ga0207697_10098968 Ga0207697_100989681 235
377 3300005937 Ga0081455_10006753 Ga0081455_100067533 236
378 3300006844 Ga0075428_100409704 Ga0075428_1004097042 236
379 2162886007 SwRhRL2b_contig_1860016 SwRhRL2b_0571.00003650 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

34

175

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lm2-assembly1.cif.gz_B crystal structure of putative kinase. (17743352) from agrobacterium tumefaciens str. c58 (dupont) at 1.70 a resolution 0.9813 12 227
3lm2-assembly1.cif.gz_B crystal structure of putative kinase. (17743352) from agrobacterium tumefaciens str. c58 (dupont) at 1.70 a resolution 0.9509 12 227
1woq-assembly2.cif.gz_B crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution 0.8633 12 221
4gw3-assembly1.cif.gz_A crystal structure of the lipase from proteus mirabilis 0.8628 168 195
5nck-assembly1.cif.gz_B the crystal structure of n-acetylmannosamine kinase in fusobacterium nucleatum 0.8302 12 223
ID Description Score Start End Superfamily
3lm2B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9696 12 105 3.30.420.40
3lm2B02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9504 108 227 3.30.420.40
3lm2B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9488 12 105 3.30.420.40
3lm2B02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9053 108 227 3.30.420.40
af_P23917_121_283_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8486 116 198 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7M3BJ78-F1-model_v4 ROK family protein 1.001 100 196
AF-A0A5F2HX51-F1-model_v4 ROK family protein 0.9989 92 215
AF-A0A1Q6YLA4-F1-model_v4 ROK family protein 0.9984 12 215 GO:0003824
AF-A0A3S1PZM9-F1-model_v4 deleted 0.9966 46 225
AF-A0A531MKJ4-F1-model_v4 ROK family protein 0.996 97 225

Feature Viewer

pLDDT pTM Quality
89.17 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map