F428333

General Info

Members Datasets Scaffolds Average Seq Length
379 236 758 260

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10072532|Ga0111539_100725324
Length 306
Sequence VLRCGGTIDNRPGHSKPPAPIRSCRLAAGLECGHEIEEDIHVSGKTVLIAQEGGVTRLTLNRPDKLNAFTLGMHAELRAGLEAAATDPQCRVVVLTGAGRAFSAGQDLAEIGGPTDAATDDAGSRLEKAYNPLIKLIATLEKPVICSVNGIAAGAGANVALACDLVYAARSASFLQAFARIGLVPDAGGTWALPRLVGAARARGLAMLAESLPAAQAEAWGLIWKCVDDDKLAAEVATVAGKLATAPTYALALAKRALAASSTNTLAQQLDLERDLQKLAGASPDAREGIAAFLEKRAPKYTGSKT

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
127 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
149 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
236 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.26
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.44
Nodule 0.26
Rhizoplane 5.01
Rhizosphere 82.59
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10072532 3300009094 Bacteria 4060
2 JGI25151J46595_10036997 3300003187 Bacteria 1835
3 rootL2_10000990 3300003322 Bacteria 26203
4 Ga0055543_1004609 3300004625 Bacteria 3698
5 Ga0065165_1000418 3300005262 Bacteria 67473
6 Ga0070658_10160811 3300005327 Bacteria 1884
7 Ga0070683_100022739 3300005329 Bacteria 5607
8 Ga0070690_100011486 3300005330 Bacteria 5181
9 Ga0070670_100051235 3300005331 Bacteria 3546
10 Ga0070660_100192573 3300005339 Bacteria 1652
11 Ga0070689_100003048 3300005340 Bacteria 11037
12 Ga0070661_100803957 3300005344 Bacteria 772
13 Ga0070669_100082062 3300005353 Bacteria 2403
14 Ga0070675_100140644 3300005354 Bacteria 2063
15 Ga0070671_100037427 3300005355 Bacteria 4024
16 Ga0070671_100658386 3300005355 Bacteria 907
17 Ga0070674_100013878 3300005356 Bacteria 4993
18 Ga0070674_100051547 3300005356 Bacteria 2836
19 Ga0070674_100152101 3300005356 Bacteria 1747
20 Ga0070688_100298282 3300005365 Bacteria 1164
21 Ga0070688_100417098 3300005365 Bacteria 997
22 Ga0070667_100653109 3300005367 Bacteria 971
23 Ga0070709_10021328 3300005434 Bacteria 3771
24 Ga0070714_100160786 3300005435 Bacteria 2032
25 Ga0070713_100568861 3300005436 Bacteria 1074
26 Ga0070710_10077320 3300005437 Bacteria 1934
27 Ga0070700_100019464 3300005441 Bacteria 3918
28 Ga0070694_100018399 3300005444 Bacteria 4434
29 Ga0070708_100004131 3300005445 Bacteria 11397
30 Ga0070708_100130772 3300005445 Bacteria 2323
31 Ga0070663_100192663 3300005455 Bacteria 1587
32 Ga0070681_10040560 3300005458 Bacteria 4663
33 Ga0068867_100001757 3300005459 Bacteria 15079
34 Ga0070706_100005558 3300005467 Bacteria 12000
35 Ga0070706_100087376 3300005467 Bacteria 2890
36 Ga0070707_100009119 3300005468 Bacteria 9197
37 Ga0070707_100009832 3300005468 Bacteria 8900
38 Ga0070698_100000782 3300005471 Bacteria 34479
39 Ga0070698_100000907 3300005471 Bacteria 32513
40 Ga0070698_100004807 3300005471 Bacteria 14829
41 Ga0070698_100204778 3300005471 Bacteria 1908
42 Ga0070699_100040222 3300005518 Bacteria 4048
43 Ga0070699_100147746 3300005518 Bacteria 2077
44 Ga0070699_100261787 3300005518 Bacteria 1547
45 Ga0070699_100392697 3300005518 Bacteria 1254
46 Ga0070697_100042911 3300005536 Bacteria 3661
47 Ga0070697_100195320 3300005536 Bacteria 1718
48 Ga0070686_100112530 3300005544 Bacteria 1857
49 Ga0070695_100004197 3300005545 Bacteria 8431
50 Ga0070704_100206330 3300005549 Bacteria 1589
51 Ga0070664_100057516 3300005564 Bacteria 3306
52 Ga0068857_100077977 3300005577 Bacteria 2957
53 Ga0068856_100213885 3300005614 Bacteria 1943
54 Ga0068859_100874431 3300005617 Unclassified 984
55 Ga0068866_10011825 3300005718 Bacteria 3789
56 Ga0068861_100737645 3300005719 Bacteria 919
57 Ga0068860_100071174 3300005843 Bacteria 3306
58 Ga0081455_10000068 3300005937 Bacteria 112215
59 Ga0081538_10026682 3300005981 Bacteria 4031
60 Ga0081540_1008844 3300005983 Bacteria 6991
61 Ga0081540_1023945 3300005983 Unclassified 3555
62 Ga0081539_10181103 3300005985 Bacteria 988
63 Ga0075365_10135513 3300006038 Bacteria 1706
64 Ga0075368_10022503 3300006042 Bacteria 2400
65 Ga0075368_10084441 3300006042 Bacteria 1294
66 Ga0075363_100002559 3300006048 Bacteria 7474
67 Ga0075364_10017793 3300006051 Bacteria 4443
68 Ga0075364_10027084 3300006051 Bacteria 3660
69 Ga0075364_10135480 3300006051 Bacteria 1654
70 Ga0070716_100062639 3300006173 Bacteria 2157
71 Ga0075369_10102138 3300006186 Bacteria 1287
72 Ga0075366_10023895 3300006195 Bacteria 3562
73 Ga0075366_10205089 3300006195 Bacteria 1199
74 Ga0075370_10009206 3300006353 Bacteria 5116
75 Ga0075428_100061951 3300006844 Bacteria 4097
76 Ga0075428_100070758 3300006844 Bacteria 3813
77 Ga0075428_100352035 3300006844 Bacteria 1581
78 Ga0075428_100359881 3300006844 Bacteria 1561
79 Ga0075428_100564327 3300006844 Bacteria 1216
80 Ga0075430_100044206 3300006846 Bacteria 3768
81 Ga0075431_100011460 3300006847 Bacteria 8934
82 Ga0075431_100129028 3300006847 Bacteria 2609
83 Ga0075431_100682532 3300006847 Bacteria 1006
84 Ga0075434_100003399 3300006871 Bacteria 14250
85 Ga0075434_100155294 3300006871 Bacteria 2308
86 Ga0075429_100194056 3300006880 Bacteria 1779
87 Ga0075429_100364577 3300006880 Bacteria 1265
88 Ga0068865_100124631 3300006881 Bacteria 1921
89 Ga0075436_100018205 3300006914 Bacteria 4811
90 Ga0075436_100307082 3300006914 Bacteria 1138
91 Ga0097620_100874509 3300006931 Unclassified 984
92 Ga0075435_100100852 3300007076 Bacteria 2392
93 Ga0111539_10018626 3300009094 Bacteria 8602
94 Ga0111539_10025942 3300009094 Bacteria 7174
95 Ga0111539_10029059 3300009094 Bacteria 6740
96 Ga0111539_10038968 3300009094 Bacteria 5731
97 Ga0111539_10724951 3300009094 Bacteria 1157
98 Ga0114129_10519632 3300009147 Bacteria 1552
99 Ga0114129_10608569 3300009147 Bacteria 1415
100 Ga0114129_10617911 3300009147 Bacteria 1402
101 Ga0114129_10728154 3300009147 Bacteria 1272
102 Ga0114129_10842622 3300009147 Bacteria 1166
103 Ga0114129_11025864 3300009147 Bacteria 1037
104 Ga0105243_10484101 3300009148 Bacteria 1168
105 Ga0105243_10597312 3300009148 Bacteria 1062
106 Ga0105242_10055444 3300009176 Bacteria 3242
107 Ga0105242_10174573 3300009176 Bacteria 1891
108 Ga0105242_10624176 3300009176 Bacteria 1044
109 Ga0105248_10006080 3300009177 Bacteria 13249
110 Ga0105239_10060402 3300010375 Bacteria 4160
111 Ga0157369_10023662 3300013105 Bacteria 6843
112 Ga0157374_10069643 3300013296 Bacteria 3313
113 Ga0157378_10141746 3300013297 Bacteria 2232
114 Ga0163162_10533751 3300013306 Bacteria 1302
115 Ga0163162_10647768 3300013306 Bacteria 1180
116 Ga0157372_10193175 3300013307 Bacteria 2358
117 Ga0157375_10379372 3300013308 Bacteria 1580
118 Ga0157380_10193167 3300014326 Bacteria 1799
119 Ga0157379_10836153 3300014968 Bacteria 870
120 Ga0163161_10176300 3300017792 Bacteria 1637
121 Ga0213873_10000006 3300021358 Bacteria 408723
122 Ga0213872_10174884 3300021361 Unclassified 929
123 Ga0213874_10045420 3300021377 Bacteria 1330
124 Ga0213876_10000004 3300021384 Bacteria 943822
125 Ga0213876_10078333 3300021384 Bacteria 1746
126 Ga0213875_10080013 3300021388 Bacteria 1525
127 Ga0224712_10020096 3300022467 Bacteria 2261
128 Ga0209455_1003960 3300025272 Bacteria 5025
129 Ga0207699_10016047 3300025906 Bacteria 3908
130 Ga0207645_10291768 3300025907 Bacteria 1085
131 Ga0207705_10142378 3300025909 Unclassified 1791
132 Ga0207684_10074739 3300025910 Bacteria 2879
133 Ga0207707_10072755 3300025912 Bacteria 2996
134 Ga0207646_10029792 3300025922 Bacteria 4955
135 Ga0207646_10034224 3300025922 Bacteria 4592
136 Ga0207646_10355121 3300025922 Bacteria 1324
137 Ga0207681_10560457 3300025923 Bacteria 941
138 Ga0207659_10186322 3300025926 Bacteria 1648
139 Ga0207700_10125509 3300025928 Bacteria 2088
140 Ga0207644_10522674 3300025931 Bacteria 980
141 Ga0207670_10056402 3300025936 Bacteria 2659
142 Ga0207670_10230068 3300025936 Bacteria 1423
143 Ga0207669_10033327 3300025937 Bacteria 2905
144 Ga0207669_10097684 3300025937 Bacteria 1932
145 Ga0207665_10120131 3300025939 Bacteria 1855
146 Ga0207691_10272708 3300025940 Bacteria 1456
147 Ga0207691_10279914 3300025940 Bacteria 1435
148 Ga0207711_10010289 3300025941 Bacteria 7769
149 Ga0207689_10064747 3300025942 Bacteria 3007
150 Ga0207689_10071735 3300025942 Bacteria 2845
151 Ga0207679_10018708 3300025945 Bacteria 4646
152 Ga0207651_10509884 3300025960 Bacteria 1041
153 Ga0207658_10003890 3300025986 Bacteria 10509
154 Ga0207639_10432862 3300026041 Bacteria 1191
155 Ga0207708_10213795 3300026075 Bacteria 1542
156 Ga0207648_10004672 3300026089 Bacteria 14008
157 Ga0207648_10041026 3300026089 Bacteria 4065
158 Ga0207648_10218646 3300026089 Bacteria 1693
159 Ga0207674_10062057 3300026116 Bacteria 3775
160 Ga0207674_10291418 3300026116 Bacteria 1581
161 Ga0207674_10833712 3300026116 Bacteria 889
162 Ga0207675_100463676 3300026118 Bacteria 1257
163 Ga0207683_10087063 3300026121 Bacteria 2778
164 Ga0207428_10034870 3300027907 Bacteria 4118
165 Ga0207428_10058752 3300027907 Bacteria 3051
166 Ga0207428_10113883 3300027907 Bacteria 2079
167 Ga0207428_10195612 3300027907 Bacteria 1523
168 Ga0268264_10057818 3300028381 Unclassified 3245
169 Ga0307515_10271157 3300028794 Bacteria 1418
170 Ga0265325_10013096 3300031241 Bacteria 4726
171 Ga0307408_100165815 3300031548 Bacteria 1759
172 Ga0316575_10127323 3300031665 Bacteria 1044
173 Ga0316579_10089113 3300031691 Bacteria 1473
174 Ga0307405_10249007 3300031731 Unclassified 1321
175 Ga0307413_10063697 3300031824 Unclassified 2287
176 Ga0307410_10132621 3300031852 Unclassified 1832
177 Ga0307412_10038262 3300031911 Bacteria 3088
178 Ga0307409_100053434 3300031995 Unclassified 3104
179 Ga0307409_100752918 3300031995 Bacteria 978
180 Ga0307416_100007821 3300032002 Bacteria 6834
181 Ga0307415_100027545 3300032126 Bacteria 3602
182 Ga0307415_100163063 3300032126 Bacteria 1730
183 Ga0307510_10000156 3300033180 Bacteria 56919
184 Ga0373930_0039981 3300034816 Bacteria 996
185 Ga0373958_0007065 3300034819 Bacteria 1774
186 Ga0373958_0015103 3300034819 Bacteria 1359
187 Ga0373940_0004728 3300035088 Bacteria 2899
188 Ga0373944_0030481 3300035089 Unclassified 1618
189 Ga0373951_0014388 3300035091 Bacteria 1779
190 Ga0373932_0011829 3300035112 Bacteria 2139
191 Ga0373939_0032022 3300035114 Bacteria 1525
192 Ga0373960_0018646 3300035121 Bacteria 1813
193 Ga0373961_0098510 3300035241 Bacteria 944
194 Ga0373962_0000810 3300035242 Bacteria 7149
195 Ga0373962_0006534 3300035242 Bacteria 2826
196 Ga0316574_0009564 3300035398 Bacteria 5434
197 Ga0373931_0000396 3300035691 Bacteria 17851
198 Ga0373931_0000718 3300035691 Bacteria 13735
199 Ga0373931_0069298 3300035691 Bacteria 1922
200 Ga0373935_0421601 3300035692 Bacteria 961
201 Ga0316582_0041298 3300036647 Bacteria 2883
202 Ga0395900_0518971 3300037418 Bacteria 1140
203 Ga0436364_0768897 3300037853 Bacteria 1339
204 Ga0436364_1189901 3300037853 Bacteria 1597
205 Ga0395901_0120364 3300038443 Bacteria 2759
206 Ga0436365_0470587 3300039437 Bacteria 4136
207 Ga0436365_0643552 3300039437 Bacteria 27729
208 Ga0436360_0201345 3300039438 Bacteria 1108
209 Ga0436360_0620466 3300039438 Bacteria 2994
210 Ga0436361_0285592 3300039447 Unclassified 1115
211 Ga0436361_0487874 3300039447 Bacteria 7808
212 Ga0436361_0803641 3300039447 Unclassified 1158
213 Ga0436363_1447961 3300039450 Bacteria 2644
214 Ga0436362_0949954 3300039453 Bacteria 89092
215 Ga0439439_0033536 3300041406 Unclassified 1315
216 Ga0439453_0000491 3300041408 Bacteria 4352
217 Ga0451853_4099449 3300041512 Bacteria 3227
218 Ga0439445_0024503 3300042004 Bacteria 1535
219 Ga0439457_041247 3300042014 Bacteria 1028
220 Ga0451577_0007186 3300042876 Bacteria 10976
221 Ga0466972_0005916 3300044658 Bacteria 6137
222 Ga0466963_0059224 3300044694 Bacteria 2556
223 Ga0453684_0034097 3300044712 Bacteria 7075
224 Ga0453684_0096284 3300044712 Bacteria 3637
225 Ga0453684_0553880 3300044712 Bacteria 1266
226 Ga0466970_0000348 3300044765 Bacteria 22524
227 Ga0495629_0188522 3300046459 Bacteria 1428
228 Ga0495638_0054148 3300046460 Bacteria 2495
229 Ga0495606_0012188 3300046507 Bacteria 6928
230 Ga0495634_0117444 3300046642 Bacteria 1706
231 Ga0496101_0459811 3300048904 Bacteria 1004
232 Ga0496102_0391701 3300048905 Bacteria 1307
233 Ga0496104_0002518 3300048907 Bacteria 15782
234 Ga0496104_0099530 3300048907 Bacteria 2783
235 Ga0496106_0030701 3300048909 Bacteria 4006
236 Ga0496106_0113380 3300048909 Bacteria 2113
237 Ga0496108_0023502 3300048911 Bacteria 5073
238 Ga0496108_0175297 3300048911 Bacteria 1856
239 Ga0496109_0180248 3300048912 Bacteria 1984
240 Ga0496109_0302386 3300048912 Bacteria 1508
241 Ga0496110_0035572 3300048913 Bacteria 4322
242 Ga0496112_0052798 3300048915 Bacteria 3990
243 Ga0496112_0170411 3300048915 Bacteria 2142
244 Ga0496112_0479088 3300048915 Bacteria 1181
245 Ga0496113_0036433 3300048916 Bacteria 3605
246 Ga0496114_0217875 3300048917 Bacteria 1675
247 Ga0496114_0218155 3300048917 Bacteria 1674
248 Ga0496114_0343283 3300048917 Bacteria 1320
249 Ga0496115_0009332 3300048918 Bacteria 7290
250 Ga0501032_0031149 3300049569 Bacteria 3657
251 Ga0501033_0003698 3300049570 Bacteria 12442
252 Ga0501033_0031365 3300049570 Bacteria 3993
253 Ga0501034_0064828 3300049571 Bacteria 3666
254 Ga0501034_0868952 3300049571 Bacteria 791
255 Ga0501036_0027701 3300049572 Bacteria 4788
256 Ga0501037_0001353 3300049573 Bacteria 17990
257 Ga0501037_0003538 3300049573 Bacteria 11340
258 Ga0501038_0002042 3300049574 Bacteria 18676
259 Ga0501038_0057216 3300049574 Bacteria 3348
260 Ga0501039_0009794 3300049575 Bacteria 7301
261 Ga0501039_0106131 3300049575 Bacteria 2194
262 Ga0501039_0123676 3300049575 Bacteria 2028
263 Ga0501039_0500640 3300049575 Bacteria 954
264 Ga0501040_0057205 3300049576 Bacteria 2677
265 Ga0501042_0030271 3300049578 Bacteria 3822
266 Ga0501042_0235870 3300049578 Bacteria 1320
267 Ga0501043_0014623 3300049579 Bacteria 6144
268 Ga0501043_0020696 3300049579 Bacteria 5160
269 Ga0501046_0018218 3300049580 Bacteria 5847
270 Ga0501046_0123446 3300049580 Bacteria 1969
271 Ga0501047_0015616 3300049581 Bacteria 7235
272 Ga0501047_0041018 3300049581 Bacteria 4473
273 Ga0501048_0042510 3300049582 Bacteria 3254
274 Ga0501067_0004340 3300049583 Bacteria 7808
275 Ga0501067_0008090 3300049583 Bacteria 5843
276 Ga0501067_0044995 3300049583 Bacteria 2452
277 Ga0501068_0024507 3300049584 Bacteria 3544
278 Ga0501068_0030220 3300049584 Bacteria 3212
279 Ga0501069_0001371 3300049585 Bacteria 11947
280 Ga0501069_0003992 3300049585 Bacteria 7614
281 Ga0501070_0002946 3300049586 Bacteria 14821
282 Ga0501070_0259597 3300049586 Bacteria 1420
283 Ga0501071_0015007 3300049587 Bacteria 5309
284 Ga0501072_0101203 3300049588 Bacteria 2290
285 Ga0501073_0000442 3300049589 Bacteria 28617
286 Ga0501073_0022732 3300049589 Bacteria 4511
287 Ga0501073_0063679 3300049589 Bacteria 2572
288 Ga0501074_0000430 3300049590 Bacteria 25105
289 Ga0501074_0000641 3300049590 Bacteria 21709
290 Ga0501074_0012959 3300049590 Bacteria 6062
291 Ga0501075_0098214 3300049591 Bacteria 2223
292 Ga0501075_0563876 3300049591 Bacteria 869
293 Ga0501076_0001576 3300049592 Bacteria 15313
294 Ga0501076_0430849 3300049592 Bacteria 1085
295 Ga0501077_0010099 3300049593 Bacteria 5877
296 Ga0501077_0155854 3300049593 Bacteria 1450
297 Ga0501201_008941 3300049651 Bacteria 970
298 Ga0501223_004331 3300049663 Bacteria 3048
299 Ga0501235_017504 3300049669 Bacteria 1585
300 Ga0501225_0014227 3300049705 Bacteria 2223
301 Ga0501079_0111831 3300049741 Bacteria 2122
302 Ga0501079_0299861 3300049741 Bacteria 1257
303 Ga0501080_0005001 3300049742 Bacteria 11806
304 Ga0501080_0011277 3300049742 Bacteria 8181
305 Ga0501080_0046640 3300049742 Bacteria 4034
306 Ga0501081_0023179 3300049743 Bacteria 4160
307 Ga0501081_0156754 3300049743 Bacteria 1638
308 Ga0501083_0002509 3300049744 Bacteria 12595
309 Ga0501083_0019619 3300049744 Bacteria 4709
310 Ga0501266_013893 3300049763 Bacteria 1051
311 Ga0501035_0005255 3300049822 Bacteria 12252
312 Ga0501035_0027722 3300049822 Bacteria 5176
313 Ga0501044_0161580 3300049823 Bacteria 2216
314 Ga0501045_0033326 3300049824 Bacteria 3734
315 Ga0501045_0095142 3300049824 Bacteria 2204
316 Ga0501045_0199490 3300049824 Bacteria 1491
317 nmdc:mga00v17_164839_c1 3300050491 Bacteria 1428
318 nmdc:mga00v17_168458_c1 3300050491 Bacteria 1412
319 nmdc:mga00v17_25884_c1 3300050491 Bacteria 3413
320 nmdc:mga00v17_85016_c1 3300050491 Bacteria 1981
321 nmdc:mga0k408_182516_c1 3300050493 Bacteria 1252
322 nmdc:mga06z11_195061_c1 3300050494 Bacteria 1174
323 nmdc:mga06z11_197879_c1 3300050494 Bacteria 1166
324 nmdc:mga06z11_55650_c1 3300050494 Bacteria 2043
325 nmdc:mga06z11_68901_c1 3300050494 Bacteria 1866
326 nmdc:mga04h51_88102_c1 3300050495 Bacteria 1113
327 nmdc:mga05p37_145027_c1 3300050507 Bacteria 2908
328 nmdc:mga05p37_487066_c1 3300050507 Bacteria 1419
329 nmdc:mga05p37_552122_c1 3300050507 Bacteria 1311
330 nmdc:mga05p37_890403_c1 3300050507 Bacteria 961
331 nmdc:mga09592_163549_c1 3300050508 Bacteria 1923
332 nmdc:mga09592_24142_c1 3300050508 Bacteria 5027
333 nmdc:mga09592_521258_c1 3300050508 Bacteria 1022
334 nmdc:mga09592_712108_c1 3300050508 Bacteria 854
335 nmdc:mga0qj67_103680_c1 3300050509 Bacteria 2295
336 nmdc:mga0qj67_505180_c1 3300050509 Bacteria 972
337 nmdc:mga0qj67_75833_c1 3300050509 Bacteria 2688
338 nmdc:mga06r32_511880_c1 3300050510 Bacteria 1177
339 nmdc:mga06r32_616669_c1 3300050510 Bacteria 1055
340 nmdc:mga06r32_686237_c1 3300050510 Unclassified 990
341 nmdc:mga06r32_74892_c1 3300050510 Bacteria 3283
342 nmdc:mga06r32_9871_c1 3300050510 Bacteria 8616
343 nmdc:mga08y16_103163_c1 3300050511 Bacteria 2969
344 nmdc:mga08y16_132688_c1 3300050511 Bacteria 2589
345 nmdc:mga08y16_162586_c1 3300050511 Bacteria 2320
346 nmdc:mga08y16_4100_c1 3300050511 Bacteria 15210
347 nmdc:mga08y16_43046_c1 3300050511 Bacteria 4730
348 nmdc:mga08y16_626344_c1 3300050511 Bacteria 1082
349 nmdc:mga0n895_295191_c1 3300050512 Bacteria 1643
350 nmdc:mga0n895_511091_c1 3300050512 Bacteria 1209
351 nmdc:mga0n895_8761_c1 3300050512 Bacteria 8796
352 nmdc:mga0rr50_8706_c1 3300050513 Bacteria 6328
353 nmdc:mga0a205_124151_c1 3300050515 Bacteria 2481
354 nmdc:mga0a205_16437_c1 3300050515 Bacteria 6930
355 Ga0495601_0040617 3300053077 Bacteria 2914
356 Ga0495655_0028037 3300053083 Bacteria 1341
357 Ga0495595_0064455 3300053084 Bacteria 1722
358 Ga0495595_0064577 3300053084 Bacteria 1721
359 Ga0495619_0177640 3300053085 Bacteria 1473
360 Ga0495619_0311311 3300053085 Unclassified 1090
361 Ga0500641_0038006 3300053096 Bacteria 1933
362 Ga0500650_0216275 3300053098 Bacteria 869
363 Ga0500562_019253 3300053108 Bacteria 1765
364 Ga0500595_018522 3300053119 Bacteria 2544
365 Ga0500628_006173 3300053129 Unclassified 2019
366 Ga0500616_0017829 3300053153 Bacteria 4022
367 Ga0500611_000001 3300053727 Bacteria 385744
368 Ga0501084_0003635 3300054114 Bacteria 12520
369 Ga0501084_0005409 3300054114 Bacteria 10469
370 Ga0501084_0122725 3300054114 Bacteria 2185
371 Ga0501084_0146079 3300054114 Bacteria 1992
372 Ga0590075_057026 3300059424 Bacteria 1005
373 Ga0501082_0004998 3300060353 Bacteria 11572
374 Ga0501082_0008026 3300060353 Bacteria 9111
375 Ga0501082_0030355 3300060353 Bacteria 4659
376 Ga0501082_0044456 3300060353 Bacteria 3831
377 Ga0501082_0068352 3300060353 Bacteria 3059
378 2913295982 2913295892 Bacteria 6333755
379 3003669026 3003665799 Bacteria 7279786
380 Ga0111539_10072532
381 JGI25151J46595_10036997
382 rootL2_10000990
383 Ga0055543_1004609
384 Ga0065165_1000418
385 Ga0070658_10160811
386 Ga0070683_100022739
387 Ga0070690_100011486
388 Ga0070670_100051235
389 Ga0070660_100192573
390 Ga0070689_100003048
391 Ga0070661_100803957
392 Ga0070669_100082062
393 Ga0070675_100140644
394 Ga0070671_100037427
395 Ga0070671_100658386
396 Ga0070674_100013878
397 Ga0070674_100051547
398 Ga0070674_100152101
399 Ga0070688_100298282
400 Ga0070688_100417098
401 Ga0070667_100653109
402 Ga0070709_10021328
403 Ga0070714_100160786
404 Ga0070713_100568861
405 Ga0070710_10077320
406 Ga0070700_100019464
407 Ga0070694_100018399
408 Ga0070708_100004131
409 Ga0070708_100130772
410 Ga0070663_100192663
411 Ga0070681_10040560
412 Ga0068867_100001757
413 Ga0070706_100005558
414 Ga0070706_100087376
415 Ga0070707_100009119
416 Ga0070707_100009832
417 Ga0070698_100000782
418 Ga0070698_100000907
419 Ga0070698_100004807
420 Ga0070698_100204778
421 Ga0070699_100040222
422 Ga0070699_100147746
423 Ga0070699_100261787
424 Ga0070699_100392697
425 Ga0070697_100042911
426 Ga0070697_100195320
427 Ga0070686_100112530
428 Ga0070695_100004197
429 Ga0070704_100206330
430 Ga0070664_100057516
431 Ga0068857_100077977
432 Ga0068856_100213885
433 Ga0068859_100874431
434 Ga0068866_10011825
435 Ga0068861_100737645
436 Ga0068860_100071174
437 Ga0081455_10000068
438 Ga0081538_10026682
439 Ga0081540_1008844
440 Ga0081540_1023945
441 Ga0081539_10181103
442 Ga0075365_10135513
443 Ga0075368_10022503
444 Ga0075368_10084441
445 Ga0075363_100002559
446 Ga0075364_10017793
447 Ga0075364_10027084
448 Ga0075364_10135480
449 Ga0070716_100062639
450 Ga0075369_10102138
451 Ga0075366_10023895
452 Ga0075366_10205089
453 Ga0075370_10009206
454 Ga0075428_100061951
455 Ga0075428_100070758
456 Ga0075428_100352035
457 Ga0075428_100359881
458 Ga0075428_100564327
459 Ga0075430_100044206
460 Ga0075431_100011460
461 Ga0075431_100129028
462 Ga0075431_100682532
463 Ga0075434_100003399
464 Ga0075434_100155294
465 Ga0075429_100194056
466 Ga0075429_100364577
467 Ga0068865_100124631
468 Ga0075436_100018205
469 Ga0075436_100307082
470 Ga0097620_100874509
471 Ga0075435_100100852
472 Ga0111539_10018626
473 Ga0111539_10025942
474 Ga0111539_10029059
475 Ga0111539_10038968
476 Ga0111539_10724951
477 Ga0114129_10519632
478 Ga0114129_10608569
479 Ga0114129_10617911
480 Ga0114129_10728154
481 Ga0114129_10842622
482 Ga0114129_11025864
483 Ga0105243_10484101
484 Ga0105243_10597312
485 Ga0105242_10055444
486 Ga0105242_10174573
487 Ga0105242_10624176
488 Ga0105248_10006080
489 Ga0105239_10060402
490 Ga0157369_10023662
491 Ga0157374_10069643
492 Ga0157378_10141746
493 Ga0163162_10533751
494 Ga0163162_10647768
495 Ga0157372_10193175
496 Ga0157375_10379372
497 Ga0157380_10193167
498 Ga0157379_10836153
499 Ga0163161_10176300
500 Ga0213873_10000006
501 Ga0213872_10174884
502 Ga0213874_10045420
503 Ga0213876_10000004
504 Ga0213876_10078333
505 Ga0213875_10080013
506 Ga0224712_10020096
507 Ga0209455_1003960
508 Ga0207699_10016047
509 Ga0207645_10291768
510 Ga0207705_10142378
511 Ga0207684_10074739
512 Ga0207707_10072755
513 Ga0207646_10029792
514 Ga0207646_10034224
515 Ga0207646_10355121
516 Ga0207681_10560457
517 Ga0207659_10186322
518 Ga0207700_10125509
519 Ga0207644_10522674
520 Ga0207670_10056402
521 Ga0207670_10230068
522 Ga0207669_10033327
523 Ga0207669_10097684
524 Ga0207665_10120131
525 Ga0207691_10272708
526 Ga0207691_10279914
527 Ga0207711_10010289
528 Ga0207689_10064747
529 Ga0207689_10071735
530 Ga0207679_10018708
531 Ga0207651_10509884
532 Ga0207658_10003890
533 Ga0207639_10432862
534 Ga0207708_10213795
535 Ga0207648_10004672
536 Ga0207648_10041026
537 Ga0207648_10218646
538 Ga0207674_10062057
539 Ga0207674_10291418
540 Ga0207674_10833712
541 Ga0207675_100463676
542 Ga0207683_10087063
543 Ga0207428_10034870
544 Ga0207428_10058752
545 Ga0207428_10113883
546 Ga0207428_10195612
547 Ga0268264_10057818
548 Ga0307515_10271157
549 Ga0265325_10013096
550 Ga0307408_100165815
551 Ga0316575_10127323
552 Ga0316579_10089113
553 Ga0307405_10249007
554 Ga0307413_10063697
555 Ga0307410_10132621
556 Ga0307412_10038262
557 Ga0307409_100053434
558 Ga0307409_100752918
559 Ga0307416_100007821
560 Ga0307415_100027545
561 Ga0307415_100163063
562 Ga0307510_10000156
563 Ga0373930_0039981
564 Ga0373958_0007065
565 Ga0373958_0015103
566 Ga0373940_0004728
567 Ga0373944_0030481
568 Ga0373951_0014388
569 Ga0373932_0011829
570 Ga0373939_0032022
571 Ga0373960_0018646
572 Ga0373961_0098510
573 Ga0373962_0000810
574 Ga0373962_0006534
575 Ga0316574_0009564
576 Ga0373931_0000396
577 Ga0373931_0000718
578 Ga0373931_0069298
579 Ga0373935_0421601
580 Ga0316582_0041298
581 Ga0395900_0518971
582 Ga0436364_0768897
583 Ga0436364_1189901
584 Ga0395901_0120364
585 Ga0436365_0470587
586 Ga0436365_0643552
587 Ga0436360_0201345
588 Ga0436360_0620466
589 Ga0436361_0285592
590 Ga0436361_0487874
591 Ga0436361_0803641
592 Ga0436363_1447961
593 Ga0436362_0949954
594 Ga0439439_0033536
595 Ga0439453_0000491
596 Ga0451853_4099449
597 Ga0439445_0024503
598 Ga0439457_041247
599 Ga0451577_0007186
600 Ga0466972_0005916
601 Ga0466963_0059224
602 Ga0453684_0034097
603 Ga0453684_0096284
604 Ga0453684_0553880
605 Ga0466970_0000348
606 Ga0495629_0188522
607 Ga0495638_0054148
608 Ga0495606_0012188
609 Ga0495634_0117444
610 Ga0496101_0459811
611 Ga0496102_0391701
612 Ga0496104_0002518
613 Ga0496104_0099530
614 Ga0496106_0030701
615 Ga0496106_0113380
616 Ga0496108_0023502
617 Ga0496108_0175297
618 Ga0496109_0180248
619 Ga0496109_0302386
620 Ga0496110_0035572
621 Ga0496112_0052798
622 Ga0496112_0170411
623 Ga0496112_0479088
624 Ga0496113_0036433
625 Ga0496114_0217875
626 Ga0496114_0218155
627 Ga0496114_0343283
628 Ga0496115_0009332
629 Ga0501032_0031149
630 Ga0501033_0003698
631 Ga0501033_0031365
632 Ga0501034_0064828
633 Ga0501034_0868952
634 Ga0501036_0027701
635 Ga0501037_0001353
636 Ga0501037_0003538
637 Ga0501038_0002042
638 Ga0501038_0057216
639 Ga0501039_0009794
640 Ga0501039_0106131
641 Ga0501039_0123676
642 Ga0501039_0500640
643 Ga0501040_0057205
644 Ga0501042_0030271
645 Ga0501042_0235870
646 Ga0501043_0014623
647 Ga0501043_0020696
648 Ga0501046_0018218
649 Ga0501046_0123446
650 Ga0501047_0015616
651 Ga0501047_0041018
652 Ga0501048_0042510
653 Ga0501067_0004340
654 Ga0501067_0008090
655 Ga0501067_0044995
656 Ga0501068_0024507
657 Ga0501068_0030220
658 Ga0501069_0001371
659 Ga0501069_0003992
660 Ga0501070_0002946
661 Ga0501070_0259597
662 Ga0501071_0015007
663 Ga0501072_0101203
664 Ga0501073_0000442
665 Ga0501073_0022732
666 Ga0501073_0063679
667 Ga0501074_0000430
668 Ga0501074_0000641
669 Ga0501074_0012959
670 Ga0501075_0098214
671 Ga0501075_0563876
672 Ga0501076_0001576
673 Ga0501076_0430849
674 Ga0501077_0010099
675 Ga0501077_0155854
676 Ga0501201_008941
677 Ga0501223_004331
678 Ga0501235_017504
679 Ga0501225_0014227
680 Ga0501079_0111831
681 Ga0501079_0299861
682 Ga0501080_0005001
683 Ga0501080_0011277
684 Ga0501080_0046640
685 Ga0501081_0023179
686 Ga0501081_0156754
687 Ga0501083_0002509
688 Ga0501083_0019619
689 Ga0501266_013893
690 Ga0501035_0005255
691 Ga0501035_0027722
692 Ga0501044_0161580
693 Ga0501045_0033326
694 Ga0501045_0095142
695 Ga0501045_0199490
696 nmdc:mga00v17_164839_c1
697 nmdc:mga00v17_168458_c1
698 nmdc:mga00v17_25884_c1
699 nmdc:mga00v17_85016_c1
700 nmdc:mga0k408_182516_c1
701 nmdc:mga06z11_195061_c1
702 nmdc:mga06z11_197879_c1
703 nmdc:mga06z11_55650_c1
704 nmdc:mga06z11_68901_c1
705 nmdc:mga04h51_88102_c1
706 nmdc:mga05p37_145027_c1
707 nmdc:mga05p37_487066_c1
708 nmdc:mga05p37_552122_c1
709 nmdc:mga05p37_890403_c1
710 nmdc:mga09592_163549_c1
711 nmdc:mga09592_24142_c1
712 nmdc:mga09592_521258_c1
713 nmdc:mga09592_712108_c1
714 nmdc:mga0qj67_103680_c1
715 nmdc:mga0qj67_505180_c1
716 nmdc:mga0qj67_75833_c1
717 nmdc:mga06r32_511880_c1
718 nmdc:mga06r32_616669_c1
719 nmdc:mga06r32_686237_c1
720 nmdc:mga06r32_74892_c1
721 nmdc:mga06r32_9871_c1
722 nmdc:mga08y16_103163_c1
723 nmdc:mga08y16_132688_c1
724 nmdc:mga08y16_162586_c1
725 nmdc:mga08y16_4100_c1
726 nmdc:mga08y16_43046_c1
727 nmdc:mga08y16_626344_c1
728 nmdc:mga0n895_295191_c1
729 nmdc:mga0n895_511091_c1
730 nmdc:mga0n895_8761_c1
731 nmdc:mga0rr50_8706_c1
732 nmdc:mga0a205_124151_c1
733 nmdc:mga0a205_16437_c1
734 Ga0495601_0040617
735 Ga0495655_0028037
736 Ga0495595_0064455
737 Ga0495595_0064577
738 Ga0495619_0177640
739 Ga0495619_0311311
740 Ga0500641_0038006
741 Ga0500650_0216275
742 Ga0500562_019253
743 Ga0500595_018522
744 Ga0500628_006173
745 Ga0500616_0017829
746 Ga0500611_000001
747 Ga0501084_0003635
748 Ga0501084_0005409
749 Ga0501084_0122725
750 Ga0501084_0146079
751 Ga0590075_057026
752 Ga0501082_0004998
753 Ga0501082_0008026
754 Ga0501082_0030355
755 Ga0501082_0044456
756 Ga0501082_0068352
757 2913295982
758 3003669026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

50

304

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

55

240

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pzk-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase in apo form 0.9386 14 270
4fzw-assembly1.cif.gz_B crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.934 14 273
3rsi-assembly1.cif.gz_A the structure of a putative enoyl-coa hydratase/isomerase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9327 17 273
3pzk-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase in apo form 0.9312 14 270
4fzw-assembly1.cif.gz_B crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9305 14 273
ID Description Score Start End Superfamily
af_P77467_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9891 222 273 1.10.12.10
4jfcA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9836 216 270 1.10.12.10
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.98 216 273 1.10.12.10
4fzwD02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9754 218 273 1.10.12.10
3hrxE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9688 218 273 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A7V8JYA5-F1-model_v4 Putative enoyl-CoA hydratase echA8 0.9837 14 273
AF-A0A7V8JYA5-F1-model_v4 Putative enoyl-CoA hydratase echA8 0.9762 14 273
AF-A0A1F4CGP6-F1-model_v4 Enoyl-CoA hydratase 0.947 14 273 GO:0003824
GO:0006635
AF-D4YXG2-F1-model_v4 Enoyl-CoA hydratase/carnitine racemase 0.9455 17 270 GO:0016020
AF-A0A031LNY2-F1-model_v4 Crotonase 0.9448 17 273 GO:0006635
GO:0016836

Map