F428347
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 379 | 245 | 758 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10270871|Ga0105248_102708712 |
| Length | 401 |
| Sequence | LAPLVEEINSGAVRRDLVRRSQAGIGRLGPAGILAGWDRVKVMATPNLLTPGRIDGFETRNRLMMAPMTRSRALAGGVPSDLAIEYYAQRASAGIIVTEGVAPTAVGLGYARTPAIESREQIAVWKKITAAVKARGGHIFIQFMHVGRIGHSANRYTSDPLVAPSAVRANAQIWTDAHGLQDMDAPRALETSEIPGIIDGFAQATRNALEAGFDGVELHAASGYLPMQFLSTGTNQRTDGYGGSVQNRLRFVVDTLQAMIAAAGEPGKVGMKISPAIPFNDIHDDDPIETYTALVKAVAPMGLGYLHVLRTPPLPNIFEVLRPLYPGTFAVGGAFDFDSGNAAIASGLADFVVFGKPFTSNPDLAERFAGGLELTPFDATTFYTPGPKGYVDYLPAAAQSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 3 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 137 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 140 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 143 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 146 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 147 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 148 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 149 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 150 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 151 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 192 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 195 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 196 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 197 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 198 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 199 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 200 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 201 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 202 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 203 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 204 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 205 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 224 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 228 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 229 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 230 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 231 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 232 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 233 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 234 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 235 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 236 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 237 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 238 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 239 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 240 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 241 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 242 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 243 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 244 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 245 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.72 |
| Metatranscriptomes | 0.79 |
| Isolates | 4.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 9.5 |
| Nodule | 0.26 |
| Rhizoplane | 2.37 |
| Rhizosphere | 73.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10270871 | 3300009177 | Bacteria | 1912 |
| 2 | Ga0055526_1016633 | 3300003771 | Bacteria | 2862 |
| 3 | Ga0055537_1000171 | 3300003773 | Bacteria | 48534 |
| 4 | Ga0055536_1005885 | 3300003781 | Bacteria | 5878 |
| 5 | Ga0055536_1005907 | 3300003781 | Bacteria | 5863 |
| 6 | Ga0055534_1000114 | 3300003784 | Bacteria | 59511 |
| 7 | Ga0055528_1002993 | 3300003790 | Bacteria | 8747 |
| 8 | Ga0055530_10000021 | 3300003791 | Bacteria | 139383 |
| 9 | Ga0055530_10000071 | 3300003791 | Bacteria | 86290 |
| 10 | Ga0055531_10007595 | 3300003794 | Bacteria | 5878 |
| 11 | Ga0055531_10008873 | 3300003794 | Bacteria | 5224 |
| 12 | Ga0055531_10016111 | 3300003794 | Bacteria | 3246 |
| 13 | Ga0058692_1000231 | 3300003856 | Bacteria | 32264 |
| 14 | Ga0065707_10005529 | 3300005295 | Bacteria | 5886 |
| 15 | Ga0070670_100000520 | 3300005331 | Bacteria | 30844 |
| 16 | Ga0070670_100217678 | 3300005331 | Bacteria | 1661 |
| 17 | Ga0070677_10004592 | 3300005333 | Bacteria | 4516 |
| 18 | Ga0068869_100020058 | 3300005334 | Bacteria | 4578 |
| 19 | Ga0068869_100094763 | 3300005334 | Bacteria | 2251 |
| 20 | Ga0070666_10000395 | 3300005335 | Bacteria | 27401 |
| 21 | Ga0070666_10083864 | 3300005335 | Bacteria | 2180 |
| 22 | Ga0070682_100186524 | 3300005337 | Unclassified | 1453 |
| 23 | Ga0068868_100020706 | 3300005338 | Bacteria | 4947 |
| 24 | Ga0068868_100316049 | 3300005338 | Bacteria | 1329 |
| 25 | Ga0070661_100005136 | 3300005344 | Bacteria | 9015 |
| 26 | Ga0070661_100332773 | 3300005344 | Bacteria | 1188 |
| 27 | Ga0070669_100031013 | 3300005353 | Bacteria | 3859 |
| 28 | Ga0070675_100003435 | 3300005354 | Bacteria | 12002 |
| 29 | Ga0070675_100006494 | 3300005354 | Bacteria | 8979 |
| 30 | Ga0070675_100006599 | 3300005354 | Bacteria | 8917 |
| 31 | Ga0070675_100216190 | 3300005354 | Bacteria | 1668 |
| 32 | Ga0070671_100175339 | 3300005355 | Bacteria | 1814 |
| 33 | Ga0070674_100000462 | 3300005356 | Bacteria | 20520 |
| 34 | Ga0070674_100056889 | 3300005356 | Bacteria | 2713 |
| 35 | Ga0070674_100067389 | 3300005356 | Bacteria | 2517 |
| 36 | Ga0070673_100007462 | 3300005364 | Bacteria | 7213 |
| 37 | Ga0070688_100008268 | 3300005365 | Bacteria | 5642 |
| 38 | Ga0070667_100015021 | 3300005367 | Bacteria | 6398 |
| 39 | Ga0070667_100148636 | 3300005367 | Bacteria | 2056 |
| 40 | Ga0070667_100260292 | 3300005367 | Bacteria | 1553 |
| 41 | Ga0070709_10092056 | 3300005434 | Bacteria | 2002 |
| 42 | Ga0070700_100008048 | 3300005441 | Bacteria | 5731 |
| 43 | Ga0070663_100010327 | 3300005455 | Bacteria | 5820 |
| 44 | Ga0070663_100043158 | 3300005455 | Bacteria | 3172 |
| 45 | Ga0070678_100055764 | 3300005456 | Bacteria | 2887 |
| 46 | Ga0070662_100295265 | 3300005457 | Bacteria | 1315 |
| 47 | Ga0068867_100034423 | 3300005459 | Bacteria | 3671 |
| 48 | Ga0070685_10023938 | 3300005466 | Bacteria | 3349 |
| 49 | Ga0070698_100213529 | 3300005471 | Bacteria | 1864 |
| 50 | Ga0070679_100200822 | 3300005530 | Bacteria | 1960 |
| 51 | Ga0070672_100003653 | 3300005543 | Bacteria | 9992 |
| 52 | Ga0070686_100012155 | 3300005544 | Bacteria | 4898 |
| 53 | Ga0070686_100046938 | 3300005544 | Bacteria | 2728 |
| 54 | Ga0070665_100129485 | 3300005548 | Bacteria | 2526 |
| 55 | Ga0070664_100018128 | 3300005564 | Bacteria | 5778 |
| 56 | Ga0068854_100043268 | 3300005578 | Bacteria | 3191 |
| 57 | Ga0068854_100158127 | 3300005578 | Bacteria | 1753 |
| 58 | Ga0068856_100013776 | 3300005614 | Bacteria | 7815 |
| 59 | Ga0070702_100060902 | 3300005615 | Bacteria | 2196 |
| 60 | Ga0068852_100053744 | 3300005616 | Bacteria | 3469 |
| 61 | Ga0068859_100010127 | 3300005617 | Bacteria | 9496 |
| 62 | Ga0068859_100101612 | 3300005617 | Bacteria | 2932 |
| 63 | Ga0068859_100579558 | 3300005617 | Bacteria | 1216 |
| 64 | Ga0068864_100032810 | 3300005618 | Bacteria | 4413 |
| 65 | Ga0068866_10050730 | 3300005718 | Bacteria | 2108 |
| 66 | Ga0068866_10072086 | 3300005718 | Bacteria | 1829 |
| 67 | Ga0068851_10138480 | 3300005834 | Bacteria | 1322 |
| 68 | Ga0068863_100000134 | 3300005841 | Bacteria | 78372 |
| 69 | Ga0068863_100019902 | 3300005841 | Bacteria | 6419 |
| 70 | Ga0068863_100135294 | 3300005841 | Bacteria | 2354 |
| 71 | Ga0068858_100015595 | 3300005842 | Bacteria | 7147 |
| 72 | Ga0068858_100087485 | 3300005842 | Bacteria | 2897 |
| 73 | Ga0068860_100006539 | 3300005843 | Bacteria | 11698 |
| 74 | Ga0068860_100187728 | 3300005843 | Bacteria | 1999 |
| 75 | Ga0068860_100414031 | 3300005843 | Bacteria | 1335 |
| 76 | Ga0068862_100420165 | 3300005844 | Bacteria | 1254 |
| 77 | Ga0081455_10022732 | 3300005937 | Bacteria | 5851 |
| 78 | Ga0070717_10185977 | 3300006028 | Bacteria | 1813 |
| 79 | Ga0075365_10003163 | 3300006038 | Bacteria | 8401 |
| 80 | Ga0075364_10034064 | 3300006051 | Bacteria | 3283 |
| 81 | Ga0075364_10217271 | 3300006051 | Bacteria | 1297 |
| 82 | Ga0075369_10014033 | 3300006186 | Bacteria | 3193 |
| 83 | Ga0097621_100000885 | 3300006237 | Bacteria | 20990 |
| 84 | Ga0097621_100281664 | 3300006237 | Bacteria | 1463 |
| 85 | Ga0068871_100007946 | 3300006358 | Bacteria | 7606 |
| 86 | Ga0068871_100041566 | 3300006358 | Bacteria | 3687 |
| 87 | Ga0068871_100379668 | 3300006358 | Bacteria | 1255 |
| 88 | Ga0068865_100126467 | 3300006881 | Bacteria | 1908 |
| 89 | Ga0068865_100215444 | 3300006881 | Bacteria | 1499 |
| 90 | Ga0097620_100010127 | 3300006931 | Bacteria | 9496 |
| 91 | Ga0097620_100101615 | 3300006931 | Bacteria | 2932 |
| 92 | Ga0097620_100579561 | 3300006931 | Bacteria | 1216 |
| 93 | Ga0105251_10012796 | 3300009011 | Bacteria | 4728 |
| 94 | Ga0111539_10103924 | 3300009094 | Bacteria | 3333 |
| 95 | Ga0105245_10557189 | 3300009098 | Bacteria | 1169 |
| 96 | Ga0105247_10062616 | 3300009101 | Bacteria | 2308 |
| 97 | Ga0105243_10008675 | 3300009148 | Bacteria | 7794 |
| 98 | Ga0105242_10011396 | 3300009176 | Bacteria | 6834 |
| 99 | Ga0105242_10066510 | 3300009176 | Bacteria | 2977 |
| 100 | Ga0105242_10094363 | 3300009176 | Bacteria | 2524 |
| 101 | Ga0105248_10037401 | 3300009177 | Bacteria | 5430 |
| 102 | Ga0105248_10111105 | 3300009177 | Bacteria | 3091 |
| 103 | Ga0105248_10183025 | 3300009177 | Bacteria | 2361 |
| 104 | Ga0105248_10317993 | 3300009177 | Bacteria | 1753 |
| 105 | Ga0105238_10008736 | 3300009551 | Bacteria | 10134 |
| 106 | Ga0157371_10000022 | 3300013102 | Bacteria | 295029 |
| 107 | Ga0157371_10055720 | 3300013102 | Bacteria | 2805 |
| 108 | Ga0157370_10000178 | 3300013104 | Bacteria | 79566 |
| 109 | Ga0157370_10355207 | 3300013104 | Bacteria | 1351 |
| 110 | Ga0157369_10065406 | 3300013105 | Bacteria | 3913 |
| 111 | Ga0157369_10203826 | 3300013105 | Bacteria | 2075 |
| 112 | Ga0157374_10236217 | 3300013296 | Bacteria | 1796 |
| 113 | Ga0157374_10261082 | 3300013296 | Bacteria | 1706 |
| 114 | Ga0157378_10219000 | 3300013297 | Bacteria | 1809 |
| 115 | Ga0163162_10034929 | 3300013306 | Bacteria | 5005 |
| 116 | Ga0163162_10115172 | 3300013306 | Bacteria | 2788 |
| 117 | Ga0163162_10327784 | 3300013306 | Bacteria | 1664 |
| 118 | Ga0157375_10092153 | 3300013308 | Bacteria | 3093 |
| 119 | Ga0163163_10012603 | 3300014325 | Bacteria | 7710 |
| 120 | Ga0163163_10016341 | 3300014325 | Bacteria | 6891 |
| 121 | Ga0163163_10069241 | 3300014325 | Bacteria | 3513 |
| 122 | Ga0163163_10074351 | 3300014325 | Bacteria | 3390 |
| 123 | Ga0157380_10048293 | 3300014326 | Bacteria | 3351 |
| 124 | Ga0157380_10077131 | 3300014326 | Bacteria | 2715 |
| 125 | Ga0182008_10000085 | 3300014497 | Bacteria | 72514 |
| 126 | Ga0182008_10026000 | 3300014497 | Bacteria | 2970 |
| 127 | Ga0157379_10032403 | 3300014968 | Bacteria | 4660 |
| 128 | Ga0157379_10081173 | 3300014968 | Bacteria | 2905 |
| 129 | Ga0157379_10199027 | 3300014968 | Bacteria | 1811 |
| 130 | Ga0157376_10022215 | 3300014969 | Bacteria | 4941 |
| 131 | Ga0157376_10172067 | 3300014969 | Bacteria | 1973 |
| 132 | Ga0182007_10000004 | 3300015262 | Bacteria | 485875 |
| 133 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 134 | Ga0182005_1000105 | 3300015265 | Bacteria | 63475 |
| 135 | Ga0163161_10000802 | 3300017792 | Bacteria | 24592 |
| 136 | Ga0163161_10056648 | 3300017792 | Bacteria | 2847 |
| 137 | Ga0163161_10085322 | 3300017792 | Bacteria | 2329 |
| 138 | Ga0209565_1000024 | 3300025263 | Bacteria | 379907 |
| 139 | Ga0209673_1000087 | 3300025273 | Bacteria | 205213 |
| 140 | Ga0209130_1020197 | 3300025284 | Bacteria | 1529 |
| 141 | Ga0209675_1000039 | 3300025291 | Bacteria | 247966 |
| 142 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 143 | Ga0209676_1000075 | 3300025292 | Bacteria | 303609 |
| 144 | Ga0209676_1000536 | 3300025292 | Bacteria | 58911 |
| 145 | Ga0209564_1000188 | 3300025295 | Bacteria | 144251 |
| 146 | Ga0209050_1000032 | 3300025298 | Bacteria | 456335 |
| 147 | Ga0209050_1000069 | 3300025298 | Bacteria | 297615 |
| 148 | Ga0209050_1003970 | 3300025298 | Bacteria | 10435 |
| 149 | Ga0209256_1002367 | 3300025299 | Bacteria | 15612 |
| 150 | Ga0209051_1003627 | 3300025303 | Bacteria | 10009 |
| 151 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 152 | Ga0209257_1000571 | 3300025304 | Bacteria | 61995 |
| 153 | Ga0209257_1001102 | 3300025304 | Bacteria | 35143 |
| 154 | Ga0209257_1001364 | 3300025304 | Bacteria | 29523 |
| 155 | Ga0207682_10019414 | 3300025893 | Bacteria | 2660 |
| 156 | Ga0207682_10055586 | 3300025893 | Bacteria | 1646 |
| 157 | Ga0207642_10003234 | 3300025899 | Bacteria | 5113 |
| 158 | Ga0207688_10008792 | 3300025901 | Bacteria | 5494 |
| 159 | Ga0207680_10000715 | 3300025903 | Bacteria | 15556 |
| 160 | Ga0207699_10092327 | 3300025906 | Bacteria | 1903 |
| 161 | Ga0207645_10006130 | 3300025907 | Bacteria | 8638 |
| 162 | Ga0207643_10002904 | 3300025908 | Bacteria | 9258 |
| 163 | Ga0207695_10129960 | 3300025913 | Bacteria | 2477 |
| 164 | Ga0207671_10080966 | 3300025914 | Bacteria | 2435 |
| 165 | Ga0207662_10073508 | 3300025918 | Bacteria | 2074 |
| 166 | Ga0207652_10306754 | 3300025921 | Bacteria | 1433 |
| 167 | Ga0207681_10023269 | 3300025923 | Bacteria | 3960 |
| 168 | Ga0207681_10170524 | 3300025923 | Bacteria | 1649 |
| 169 | Ga0207694_10004631 | 3300025924 | Bacteria | 10712 |
| 170 | Ga0207694_10097847 | 3300025924 | Bacteria | 2322 |
| 171 | Ga0207650_10028433 | 3300025925 | Bacteria | 4009 |
| 172 | Ga0207659_10001962 | 3300025926 | Bacteria | 12220 |
| 173 | Ga0207659_10009050 | 3300025926 | Bacteria | 6211 |
| 174 | Ga0207659_10055616 | 3300025926 | Bacteria | 2831 |
| 175 | Ga0207644_10017562 | 3300025931 | Bacteria | 4835 |
| 176 | Ga0207644_10098795 | 3300025931 | Bacteria | 2189 |
| 177 | Ga0207644_10152193 | 3300025931 | Bacteria | 1791 |
| 178 | Ga0207706_10050074 | 3300025933 | Bacteria | 3692 |
| 179 | Ga0207706_10071973 | 3300025933 | Bacteria | 3041 |
| 180 | Ga0207686_10027966 | 3300025934 | Bacteria | 3308 |
| 181 | Ga0207709_10013092 | 3300025935 | Bacteria | 4573 |
| 182 | Ga0207670_10011752 | 3300025936 | Bacteria | 5095 |
| 183 | Ga0207669_10004908 | 3300025937 | Bacteria | 5945 |
| 184 | Ga0207669_10044079 | 3300025937 | Bacteria | 2618 |
| 185 | Ga0207711_10022987 | 3300025941 | Bacteria | 5219 |
| 186 | Ga0207689_10018862 | 3300025942 | Bacteria | 5817 |
| 187 | Ga0207679_10073258 | 3300025945 | Bacteria | 2590 |
| 188 | Ga0207667_10145531 | 3300025949 | Bacteria | 2439 |
| 189 | Ga0207651_10006434 | 3300025960 | Bacteria | 6146 |
| 190 | Ga0207651_10015433 | 3300025960 | Bacteria | 4438 |
| 191 | Ga0207712_10116468 | 3300025961 | Bacteria | 2014 |
| 192 | Ga0207640_10031438 | 3300025981 | Unclassified | 3280 |
| 193 | Ga0207640_10038049 | 3300025981 | Bacteria | 3033 |
| 194 | Ga0207658_10158629 | 3300025986 | Bacteria | 1852 |
| 195 | Ga0207677_10022093 | 3300026023 | Bacteria | 3903 |
| 196 | Ga0207677_10166155 | 3300026023 | Bacteria | 1720 |
| 197 | Ga0207677_10250577 | 3300026023 | Bacteria | 1438 |
| 198 | Ga0207703_10010878 | 3300026035 | Bacteria | 7095 |
| 199 | Ga0207703_10329405 | 3300026035 | Bacteria | 1400 |
| 200 | Ga0207639_10115147 | 3300026041 | Bacteria | 2198 |
| 201 | Ga0207678_10007147 | 3300026067 | Bacteria | 9908 |
| 202 | Ga0207678_10030373 | 3300026067 | Bacteria | 4718 |
| 203 | Ga0207708_10034970 | 3300026075 | Bacteria | 3823 |
| 204 | Ga0207708_10038977 | 3300026075 | Bacteria | 3620 |
| 205 | Ga0207641_10000076 | 3300026088 | Bacteria | 145031 |
| 206 | Ga0207648_10000429 | 3300026089 | Bacteria | 46380 |
| 207 | Ga0207648_10020571 | 3300026089 | Bacteria | 5941 |
| 208 | Ga0207676_10022401 | 3300026095 | Bacteria | 4646 |
| 209 | Ga0207676_10165992 | 3300026095 | Bacteria | 1918 |
| 210 | Ga0207674_10059630 | 3300026116 | Bacteria | 3860 |
| 211 | Ga0207674_10077746 | 3300026116 | Bacteria | 3324 |
| 212 | Ga0207675_100031820 | 3300026118 | Bacteria | 4915 |
| 213 | Ga0207675_100236072 | 3300026118 | Bacteria | 1765 |
| 214 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 215 | Ga0209974_10035339 | 3300027876 | Bacteria | 1660 |
| 216 | Ga0268266_10022865 | 3300028379 | Bacteria | 5321 |
| 217 | Ga0268266_10031449 | 3300028379 | Bacteria | 4507 |
| 218 | Ga0268266_10331485 | 3300028379 | Bacteria | 1426 |
| 219 | Ga0268265_10139331 | 3300028380 | Bacteria | 2029 |
| 220 | Ga0268265_10385789 | 3300028380 | Bacteria | 1290 |
| 221 | Ga0268264_10000334 | 3300028381 | Bacteria | 72930 |
| 222 | Ga0268264_10352121 | 3300028381 | Bacteria | 1402 |
| 223 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 224 | Ga0316183_1018922 | 3300030742 | Bacteria | 3230 |
| 225 | Ga0316181_1266962 | 3300030744 | Bacteria | 2136 |
| 226 | Ga0307415_100324026 | 3300032126 | Bacteria | 1286 |
| 227 | Ga0373926_0062126 | 3300035083 | Bacteria | 1363 |
| 228 | Ga0373945_0050799 | 3300035116 | Bacteria | 1525 |
| 229 | Ga0373945_0108439 | 3300035116 | Bacteria | 1093 |
| 230 | Ga0373956_0144764 | 3300035119 | Unclassified | 1117 |
| 231 | Ga0373955_0174651 | 3300035172 | Bacteria | 1273 |
| 232 | Ga0373935_0211767 | 3300035692 | Bacteria | 1343 |
| 233 | Ga0373933_0031917 | 3300035724 | Bacteria | 3059 |
| 234 | Ga0373947_0068593 | 3300035725 | Bacteria | 2169 |
| 235 | Ga0395898_0254788 | 3300037466 | Bacteria | 1674 |
| 236 | Ga0237819_01881 | 3300038705 | Bacteria | 4815 |
| 237 | Ga0436361_0664887 | 3300039447 | Bacteria | 6560 |
| 238 | Ga0436361_0873141 | 3300039447 | Bacteria | 19210 |
| 239 | Ga0439453_0011255 | 3300041408 | Bacteria | 1489 |
| 240 | Ga0439432_019851 | 3300042006 | Bacteria | 2236 |
| 241 | Ga0439435_0004690 | 3300042436 | Bacteria | 2961 |
| 242 | Ga0466972_0028892 | 3300044658 | Bacteria | 2732 |
| 243 | Ga0466970_0035757 | 3300044765 | Bacteria | 2631 |
| 244 | Ga0466970_0148934 | 3300044765 | Bacteria | 1292 |
| 245 | Ga0466967_0024714 | 3300045976 | Bacteria | 4944 |
| 246 | Ga0495627_008190 | 3300046453 | Bacteria | 3933 |
| 247 | Ga0495638_0000550 | 3300046460 | Bacteria | 42869 |
| 248 | Ga0495638_0022101 | 3300046460 | Bacteria | 4178 |
| 249 | Ga0495580_0000112 | 3300046472 | Bacteria | 55094 |
| 250 | Ga0495580_0001160 | 3300046472 | Bacteria | 23154 |
| 251 | Ga0495664_0048998 | 3300046477 | Bacteria | 2508 |
| 252 | Ga0495607_0005989 | 3300046501 | Bacteria | 8619 |
| 253 | Ga0495608_0010671 | 3300046511 | Bacteria | 6408 |
| 254 | Ga0495610_0000321 | 3300046512 | Bacteria | 51039 |
| 255 | Ga0495610_0013886 | 3300046512 | Bacteria | 4760 |
| 256 | Ga0495628_0019043 | 3300046516 | Bacteria | 5679 |
| 257 | Ga0495628_0111619 | 3300046516 | Bacteria | 2102 |
| 258 | Ga0495630_0070928 | 3300046517 | Bacteria | 2621 |
| 259 | Ga0495631_0003054 | 3300046518 | Bacteria | 9243 |
| 260 | Ga0495643_0000307 | 3300046522 | Bacteria | 67608 |
| 261 | Ga0495663_0000277 | 3300046525 | Bacteria | 19707 |
| 262 | Ga0495663_0002533 | 3300046525 | Bacteria | 5472 |
| 263 | Ga0495666_0017195 | 3300046526 | Bacteria | 3602 |
| 264 | Ga0495652_0077235 | 3300046529 | Bacteria | 2761 |
| 265 | Ga0495665_0093223 | 3300046531 | Bacteria | 1583 |
| 266 | Ga0495586_0036684 | 3300046535 | Bacteria | 2632 |
| 267 | Ga0495633_0000854 | 3300046558 | Bacteria | 26659 |
| 268 | Ga0495625_0015780 | 3300046660 | Bacteria | 5963 |
| 269 | Ga0495625_0016158 | 3300046660 | Bacteria | 5880 |
| 270 | Ga0495599_0013360 | 3300046678 | Bacteria | 5074 |
| 271 | Ga0495646_0108133 | 3300046680 | Bacteria | 1586 |
| 272 | Ga0495658_0147325 | 3300046683 | Bacteria | 1444 |
| 273 | Ga0495613_0001124 | 3300046689 | Bacteria | 20369 |
| 274 | Ga0495624_0000022 | 3300046690 | Bacteria | 99926 |
| 275 | Ga0495660_0037571 | 3300046810 | Bacteria | 2696 |
| 276 | Ga0495581_0095646 | 3300047315 | Bacteria | 1725 |
| 277 | Ga0495604_0009598 | 3300047317 | Bacteria | 7654 |
| 278 | Ga0495604_0062802 | 3300047317 | Bacteria | 2836 |
| 279 | Ga0495674_0018946 | 3300047319 | Bacteria | 6402 |
| 280 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 281 | Ga0495684_0000864 | 3300047471 | Bacteria | 24618 |
| 282 | Ga0495686_0005964 | 3300047472 | Bacteria | 9484 |
| 283 | Ga0495686_0016803 | 3300047472 | Bacteria | 4949 |
| 284 | Ga0496100_0007817 | 3300048903 | Bacteria | 5932 |
| 285 | Ga0496101_0004193 | 3300048904 | Bacteria | 9034 |
| 286 | Ga0496102_0082335 | 3300048905 | Bacteria | 2968 |
| 287 | Ga0496103_0019271 | 3300048906 | Bacteria | 4097 |
| 288 | Ga0496104_0110773 | 3300048907 | Bacteria | 2632 |
| 289 | Ga0496106_0011864 | 3300048909 | Bacteria | 6433 |
| 290 | Ga0496111_0067986 | 3300048914 | Bacteria | 2589 |
| 291 | Ga0496112_0059027 | 3300048915 | Bacteria | 3780 |
| 292 | Ga0496114_0016022 | 3300048917 | Bacteria | 6031 |
| 293 | Ga0496116_0016686 | 3300048919 | Bacteria | 5736 |
| 294 | Ga0496116_0017290 | 3300048919 | Bacteria | 5606 |
| 295 | Ga0496117_0000227 | 3300048920 | Bacteria | 106119 |
| 296 | Ga0496117_0000645 | 3300048920 | Bacteria | 56167 |
| 297 | Ga0496117_0007547 | 3300048920 | Bacteria | 10596 |
| 298 | Ga0496117_0152691 | 3300048920 | Bacteria | 1364 |
| 299 | Ga0496118_0000338 | 3300048921 | Bacteria | 80086 |
| 300 | Ga0496118_0001455 | 3300048921 | Bacteria | 35628 |
| 301 | Ga0496118_0001881 | 3300048921 | Bacteria | 29958 |
| 302 | Ga0496118_0008550 | 3300048921 | Bacteria | 10553 |
| 303 | Ga0496118_0010547 | 3300048921 | Bacteria | 9136 |
| 304 | Ga0496118_0022997 | 3300048921 | Bacteria | 5428 |
| 305 | Ga0496118_0034027 | 3300048921 | Bacteria | 4168 |
| 306 | Ga0496118_0082821 | 3300048921 | Bacteria | 2246 |
| 307 | Ga0496118_0103481 | 3300048921 | Bacteria | 1915 |
| 308 | Ga0496119_0000047 | 3300048922 | Bacteria | 188401 |
| 309 | Ga0496119_0026382 | 3300048922 | Bacteria | 4030 |
| 310 | Ga0496120_0000041 | 3300048923 | Bacteria | 200518 |
| 311 | Ga0496120_0066642 | 3300048923 | Bacteria | 1991 |
| 312 | Ga0496121_0010452 | 3300048924 | Bacteria | 10470 |
| 313 | Ga0496121_0024019 | 3300048924 | Bacteria | 5843 |
| 314 | Ga0496121_0139071 | 3300048924 | Bacteria | 1804 |
| 315 | Ga0496122_0004491 | 3300048925 | Bacteria | 17255 |
| 316 | Ga0496122_0007599 | 3300048925 | Bacteria | 11981 |
| 317 | Ga0496122_0010540 | 3300048925 | Bacteria | 9500 |
| 318 | Ga0496122_0031502 | 3300048925 | Bacteria | 4411 |
| 319 | Ga0496123_0008919 | 3300048926 | Bacteria | 9117 |
| 320 | Ga0496123_0017407 | 3300048926 | Bacteria | 5784 |
| 321 | Ga0496123_0033573 | 3300048926 | Bacteria | 3691 |
| 322 | Ga0496123_0048323 | 3300048926 | Bacteria | 2863 |
| 323 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 324 | Ga0496124_0000056 | 3300048927 | Bacteria | 250907 |
| 325 | Ga0496124_0004171 | 3300048927 | Bacteria | 17039 |
| 326 | Ga0496124_0007217 | 3300048927 | Bacteria | 11872 |
| 327 | Ga0496124_0008201 | 3300048927 | Bacteria | 10958 |
| 328 | Ga0496124_0012855 | 3300048927 | Bacteria | 8223 |
| 329 | Ga0496124_0026530 | 3300048927 | Bacteria | 5220 |
| 330 | Ga0496124_0304293 | 3300048927 | Bacteria | 1150 |
| 331 | Ga0496125_0000197 | 3300048928 | Bacteria | 129154 |
| 332 | Ga0496125_0000656 | 3300048928 | Bacteria | 57618 |
| 333 | Ga0496125_0045168 | 3300048928 | Bacteria | 3712 |
| 334 | Ga0496126_0000238 | 3300048929 | Bacteria | 118994 |
| 335 | Ga0496126_0001426 | 3300048929 | Bacteria | 37638 |
| 336 | Ga0496126_0021070 | 3300048929 | Bacteria | 6376 |
| 337 | Ga0501317_007961 | 3300049533 | Bacteria | 1210 |
| 338 | Ga0501318_001448 | 3300049534 | Bacteria | 1868 |
| 339 | Ga0501321_002003 | 3300049537 | Bacteria | 1711 |
| 340 | Ga0501036_0393054 | 3300049572 | Bacteria | 1157 |
| 341 | Ga0501037_0134308 | 3300049573 | Bacteria | 1773 |
| 342 | Ga0501039_0193721 | 3300049575 | Bacteria | 1598 |
| 343 | Ga0501040_0118522 | 3300049576 | Bacteria | 1856 |
| 344 | Ga0501046_0042799 | 3300049580 | Bacteria | 3610 |
| 345 | Ga0501067_0036021 | 3300049583 | Bacteria | 2748 |
| 346 | Ga0501068_0131502 | 3300049584 | Bacteria | 1565 |
| 347 | Ga0501071_0171891 | 3300049587 | Bacteria | 1622 |
| 348 | Ga0501072_0125842 | 3300049588 | Bacteria | 2042 |
| 349 | Ga0501075_0015155 | 3300049591 | Bacteria | 5529 |
| 350 | Ga0501081_0065758 | 3300049743 | Bacteria | 2521 |
| 351 | Ga0501035_0152256 | 3300049822 | Bacteria | 2006 |
| 352 | nmdc:mga00v17_862_c2 | 3300050491 | Bacteria | 15867 |
| 353 | nmdc:mga09592_45526_c1 | 3300050508 | Bacteria | 3696 |
| 354 | nmdc:mga08y16_88254_c1 | 3300050511 | Bacteria | 3232 |
| 355 | nmdc:mga0sz30_13500_c1 | 3300050516 | Bacteria | 3200 |
| 356 | Ga0495601_0011449 | 3300053077 | Bacteria | 5306 |
| 357 | Ga0495601_0018657 | 3300053077 | Unclassified | 4224 |
| 358 | Ga0495595_0123509 | 3300053084 | Bacteria | 1262 |
| 359 | Ga0495619_0009486 | 3300053085 | Bacteria | 6138 |
| 360 | Ga0495619_0122969 | 3300053085 | Bacteria | 1780 |
| 361 | Ga0500556_0001677 | 3300053104 | Bacteria | 8570 |
| 362 | Ga0500593_000867 | 3300053117 | Bacteria | 11248 |
| 363 | 2524469219 | 2524023210 | Bacteria | 9029266 |
| 364 | 2578458093 | 2576861471 | Bacteria | 4648976 |
| 365 | 2644091661 | 2643221615 | Bacteria | 5487866 |
| 366 | 2644321464 | 2643221657 | Bacteria | 5490246 |
| 367 | 2747950488 | 2747842428 | Bacteria | 4689383 |
| 368 | 2765579451 | 2765235840 | Bacteria | 4663337 |
| 369 | 2842758146 | 2842757796 | Bacteria | 3981385 |
| 370 | 2842781018 | 2842780639 | Bacteria | 4337790 |
| 371 | 2852650552 | 2852649853 | Bacteria | 4036942 |
| 372 | 2857446063 | 2857442823 | Bacteria | 4562550 |
| 373 | 2857482743 | 2857481737 | Bacteria | 4761446 |
| 374 | 2939593258 | 2939589442 | Bacteria | 4214238 |
| 375 | 2939624117 | 2939622612 | Bacteria | 4698046 |
| 376 | 2941476081 | 2941475908 | Bacteria | 4145589 |
| 377 | 2974308635 | 2974307012 | Bacteria | 4172388 |
| 378 | 2977249376 | 2977247770 | Bacteria | 4160543 |
| 379 | 2984516155 | 2984514374 | Bacteria | 4172479 |
| 380 | Ga0105248_10270871 | |||
| 381 | Ga0055526_1016633 | |||
| 382 | Ga0055537_1000171 | |||
| 383 | Ga0055536_1005885 | |||
| 384 | Ga0055536_1005907 | |||
| 385 | Ga0055534_1000114 | |||
| 386 | Ga0055528_1002993 | |||
| 387 | Ga0055530_10000021 | |||
| 388 | Ga0055530_10000071 | |||
| 389 | Ga0055531_10007595 | |||
| 390 | Ga0055531_10008873 | |||
| 391 | Ga0055531_10016111 | |||
| 392 | Ga0058692_1000231 | |||
| 393 | Ga0065707_10005529 | |||
| 394 | Ga0070670_100000520 | |||
| 395 | Ga0070670_100217678 | |||
| 396 | Ga0070677_10004592 | |||
| 397 | Ga0068869_100020058 | |||
| 398 | Ga0068869_100094763 | |||
| 399 | Ga0070666_10000395 | |||
| 400 | Ga0070666_10083864 | |||
| 401 | Ga0070682_100186524 | |||
| 402 | Ga0068868_100020706 | |||
| 403 | Ga0068868_100316049 | |||
| 404 | Ga0070661_100005136 | |||
| 405 | Ga0070661_100332773 | |||
| 406 | Ga0070669_100031013 | |||
| 407 | Ga0070675_100003435 | |||
| 408 | Ga0070675_100006494 | |||
| 409 | Ga0070675_100006599 | |||
| 410 | Ga0070675_100216190 | |||
| 411 | Ga0070671_100175339 | |||
| 412 | Ga0070674_100000462 | |||
| 413 | Ga0070674_100056889 | |||
| 414 | Ga0070674_100067389 | |||
| 415 | Ga0070673_100007462 | |||
| 416 | Ga0070688_100008268 | |||
| 417 | Ga0070667_100015021 | |||
| 418 | Ga0070667_100148636 | |||
| 419 | Ga0070667_100260292 | |||
| 420 | Ga0070709_10092056 | |||
| 421 | Ga0070700_100008048 | |||
| 422 | Ga0070663_100010327 | |||
| 423 | Ga0070663_100043158 | |||
| 424 | Ga0070678_100055764 | |||
| 425 | Ga0070662_100295265 | |||
| 426 | Ga0068867_100034423 | |||
| 427 | Ga0070685_10023938 | |||
| 428 | Ga0070698_100213529 | |||
| 429 | Ga0070679_100200822 | |||
| 430 | Ga0070672_100003653 | |||
| 431 | Ga0070686_100012155 | |||
| 432 | Ga0070686_100046938 | |||
| 433 | Ga0070665_100129485 | |||
| 434 | Ga0070664_100018128 | |||
| 435 | Ga0068854_100043268 | |||
| 436 | Ga0068854_100158127 | |||
| 437 | Ga0068856_100013776 | |||
| 438 | Ga0070702_100060902 | |||
| 439 | Ga0068852_100053744 | |||
| 440 | Ga0068859_100010127 | |||
| 441 | Ga0068859_100101612 | |||
| 442 | Ga0068859_100579558 | |||
| 443 | Ga0068864_100032810 | |||
| 444 | Ga0068866_10050730 | |||
| 445 | Ga0068866_10072086 | |||
| 446 | Ga0068851_10138480 | |||
| 447 | Ga0068863_100000134 | |||
| 448 | Ga0068863_100019902 | |||
| 449 | Ga0068863_100135294 | |||
| 450 | Ga0068858_100015595 | |||
| 451 | Ga0068858_100087485 | |||
| 452 | Ga0068860_100006539 | |||
| 453 | Ga0068860_100187728 | |||
| 454 | Ga0068860_100414031 | |||
| 455 | Ga0068862_100420165 | |||
| 456 | Ga0081455_10022732 | |||
| 457 | Ga0070717_10185977 | |||
| 458 | Ga0075365_10003163 | |||
| 459 | Ga0075364_10034064 | |||
| 460 | Ga0075364_10217271 | |||
| 461 | Ga0075369_10014033 | |||
| 462 | Ga0097621_100000885 | |||
| 463 | Ga0097621_100281664 | |||
| 464 | Ga0068871_100007946 | |||
| 465 | Ga0068871_100041566 | |||
| 466 | Ga0068871_100379668 | |||
| 467 | Ga0068865_100126467 | |||
| 468 | Ga0068865_100215444 | |||
| 469 | Ga0097620_100010127 | |||
| 470 | Ga0097620_100101615 | |||
| 471 | Ga0097620_100579561 | |||
| 472 | Ga0105251_10012796 | |||
| 473 | Ga0111539_10103924 | |||
| 474 | Ga0105245_10557189 | |||
| 475 | Ga0105247_10062616 | |||
| 476 | Ga0105243_10008675 | |||
| 477 | Ga0105242_10011396 | |||
| 478 | Ga0105242_10066510 | |||
| 479 | Ga0105242_10094363 | |||
| 480 | Ga0105248_10037401 | |||
| 481 | Ga0105248_10111105 | |||
| 482 | Ga0105248_10183025 | |||
| 483 | Ga0105248_10317993 | |||
| 484 | Ga0105238_10008736 | |||
| 485 | Ga0157371_10000022 | |||
| 486 | Ga0157371_10055720 | |||
| 487 | Ga0157370_10000178 | |||
| 488 | Ga0157370_10355207 | |||
| 489 | Ga0157369_10065406 | |||
| 490 | Ga0157369_10203826 | |||
| 491 | Ga0157374_10236217 | |||
| 492 | Ga0157374_10261082 | |||
| 493 | Ga0157378_10219000 | |||
| 494 | Ga0163162_10034929 | |||
| 495 | Ga0163162_10115172 | |||
| 496 | Ga0163162_10327784 | |||
| 497 | Ga0157375_10092153 | |||
| 498 | Ga0163163_10012603 | |||
| 499 | Ga0163163_10016341 | |||
| 500 | Ga0163163_10069241 | |||
| 501 | Ga0163163_10074351 | |||
| 502 | Ga0157380_10048293 | |||
| 503 | Ga0157380_10077131 | |||
| 504 | Ga0182008_10000085 | |||
| 505 | Ga0182008_10026000 | |||
| 506 | Ga0157379_10032403 | |||
| 507 | Ga0157379_10081173 | |||
| 508 | Ga0157379_10199027 | |||
| 509 | Ga0157376_10022215 | |||
| 510 | Ga0157376_10172067 | |||
| 511 | Ga0182007_10000004 | |||
| 512 | Ga0182005_1000004 | |||
| 513 | Ga0182005_1000105 | |||
| 514 | Ga0163161_10000802 | |||
| 515 | Ga0163161_10056648 | |||
| 516 | Ga0163161_10085322 | |||
| 517 | Ga0209565_1000024 | |||
| 518 | Ga0209673_1000087 | |||
| 519 | Ga0209130_1020197 | |||
| 520 | Ga0209675_1000039 | |||
| 521 | Ga0209676_1000011 | |||
| 522 | Ga0209676_1000075 | |||
| 523 | Ga0209676_1000536 | |||
| 524 | Ga0209564_1000188 | |||
| 525 | Ga0209050_1000032 | |||
| 526 | Ga0209050_1000069 | |||
| 527 | Ga0209050_1003970 | |||
| 528 | Ga0209256_1002367 | |||
| 529 | Ga0209051_1003627 | |||
| 530 | Ga0209257_1000014 | |||
| 531 | Ga0209257_1000571 | |||
| 532 | Ga0209257_1001102 | |||
| 533 | Ga0209257_1001364 | |||
| 534 | Ga0207682_10019414 | |||
| 535 | Ga0207682_10055586 | |||
| 536 | Ga0207642_10003234 | |||
| 537 | Ga0207688_10008792 | |||
| 538 | Ga0207680_10000715 | |||
| 539 | Ga0207699_10092327 | |||
| 540 | Ga0207645_10006130 | |||
| 541 | Ga0207643_10002904 | |||
| 542 | Ga0207695_10129960 | |||
| 543 | Ga0207671_10080966 | |||
| 544 | Ga0207662_10073508 | |||
| 545 | Ga0207652_10306754 | |||
| 546 | Ga0207681_10023269 | |||
| 547 | Ga0207681_10170524 | |||
| 548 | Ga0207694_10004631 | |||
| 549 | Ga0207694_10097847 | |||
| 550 | Ga0207650_10028433 | |||
| 551 | Ga0207659_10001962 | |||
| 552 | Ga0207659_10009050 | |||
| 553 | Ga0207659_10055616 | |||
| 554 | Ga0207644_10017562 | |||
| 555 | Ga0207644_10098795 | |||
| 556 | Ga0207644_10152193 | |||
| 557 | Ga0207706_10050074 | |||
| 558 | Ga0207706_10071973 | |||
| 559 | Ga0207686_10027966 | |||
| 560 | Ga0207709_10013092 | |||
| 561 | Ga0207670_10011752 | |||
| 562 | Ga0207669_10004908 | |||
| 563 | Ga0207669_10044079 | |||
| 564 | Ga0207711_10022987 | |||
| 565 | Ga0207689_10018862 | |||
| 566 | Ga0207679_10073258 | |||
| 567 | Ga0207667_10145531 | |||
| 568 | Ga0207651_10006434 | |||
| 569 | Ga0207651_10015433 | |||
| 570 | Ga0207712_10116468 | |||
| 571 | Ga0207640_10031438 | |||
| 572 | Ga0207640_10038049 | |||
| 573 | Ga0207658_10158629 | |||
| 574 | Ga0207677_10022093 | |||
| 575 | Ga0207677_10166155 | |||
| 576 | Ga0207677_10250577 | |||
| 577 | Ga0207703_10010878 | |||
| 578 | Ga0207703_10329405 | |||
| 579 | Ga0207639_10115147 | |||
| 580 | Ga0207678_10007147 | |||
| 581 | Ga0207678_10030373 | |||
| 582 | Ga0207708_10034970 | |||
| 583 | Ga0207708_10038977 | |||
| 584 | Ga0207641_10000076 | |||
| 585 | Ga0207648_10000429 | |||
| 586 | Ga0207648_10020571 | |||
| 587 | Ga0207676_10022401 | |||
| 588 | Ga0207676_10165992 | |||
| 589 | Ga0207674_10059630 | |||
| 590 | Ga0207674_10077746 | |||
| 591 | Ga0207675_100031820 | |||
| 592 | Ga0207675_100236072 | |||
| 593 | Ga0209371_1000007 | |||
| 594 | Ga0209974_10035339 | |||
| 595 | Ga0268266_10022865 | |||
| 596 | Ga0268266_10031449 | |||
| 597 | Ga0268266_10331485 | |||
| 598 | Ga0268265_10139331 | |||
| 599 | Ga0268265_10385789 | |||
| 600 | Ga0268264_10000334 | |||
| 601 | Ga0268264_10352121 | |||
| 602 | Ga0268256_1000008 | |||
| 603 | Ga0316183_1018922 | |||
| 604 | Ga0316181_1266962 | |||
| 605 | Ga0307415_100324026 | |||
| 606 | Ga0373926_0062126 | |||
| 607 | Ga0373945_0050799 | |||
| 608 | Ga0373945_0108439 | |||
| 609 | Ga0373956_0144764 | |||
| 610 | Ga0373955_0174651 | |||
| 611 | Ga0373935_0211767 | |||
| 612 | Ga0373933_0031917 | |||
| 613 | Ga0373947_0068593 | |||
| 614 | Ga0395898_0254788 | |||
| 615 | Ga0237819_01881 | |||
| 616 | Ga0436361_0664887 | |||
| 617 | Ga0436361_0873141 | |||
| 618 | Ga0439453_0011255 | |||
| 619 | Ga0439432_019851 | |||
| 620 | Ga0439435_0004690 | |||
| 621 | Ga0466972_0028892 | |||
| 622 | Ga0466970_0035757 | |||
| 623 | Ga0466970_0148934 | |||
| 624 | Ga0466967_0024714 | |||
| 625 | Ga0495627_008190 | |||
| 626 | Ga0495638_0000550 | |||
| 627 | Ga0495638_0022101 | |||
| 628 | Ga0495580_0000112 | |||
| 629 | Ga0495580_0001160 | |||
| 630 | Ga0495664_0048998 | |||
| 631 | Ga0495607_0005989 | |||
| 632 | Ga0495608_0010671 | |||
| 633 | Ga0495610_0000321 | |||
| 634 | Ga0495610_0013886 | |||
| 635 | Ga0495628_0019043 | |||
| 636 | Ga0495628_0111619 | |||
| 637 | Ga0495630_0070928 | |||
| 638 | Ga0495631_0003054 | |||
| 639 | Ga0495643_0000307 | |||
| 640 | Ga0495663_0000277 | |||
| 641 | Ga0495663_0002533 | |||
| 642 | Ga0495666_0017195 | |||
| 643 | Ga0495652_0077235 | |||
| 644 | Ga0495665_0093223 | |||
| 645 | Ga0495586_0036684 | |||
| 646 | Ga0495633_0000854 | |||
| 647 | Ga0495625_0015780 | |||
| 648 | Ga0495625_0016158 | |||
| 649 | Ga0495599_0013360 | |||
| 650 | Ga0495646_0108133 | |||
| 651 | Ga0495658_0147325 | |||
| 652 | Ga0495613_0001124 | |||
| 653 | Ga0495624_0000022 | |||
| 654 | Ga0495660_0037571 | |||
| 655 | Ga0495581_0095646 | |||
| 656 | Ga0495604_0009598 | |||
| 657 | Ga0495604_0062802 | |||
| 658 | Ga0495674_0018946 | |||
| 659 | Ga0495672_0000006 | |||
| 660 | Ga0495684_0000864 | |||
| 661 | Ga0495686_0005964 | |||
| 662 | Ga0495686_0016803 | |||
| 663 | Ga0496100_0007817 | |||
| 664 | Ga0496101_0004193 | |||
| 665 | Ga0496102_0082335 | |||
| 666 | Ga0496103_0019271 | |||
| 667 | Ga0496104_0110773 | |||
| 668 | Ga0496106_0011864 | |||
| 669 | Ga0496111_0067986 | |||
| 670 | Ga0496112_0059027 | |||
| 671 | Ga0496114_0016022 | |||
| 672 | Ga0496116_0016686 | |||
| 673 | Ga0496116_0017290 | |||
| 674 | Ga0496117_0000227 | |||
| 675 | Ga0496117_0000645 | |||
| 676 | Ga0496117_0007547 | |||
| 677 | Ga0496117_0152691 | |||
| 678 | Ga0496118_0000338 | |||
| 679 | Ga0496118_0001455 | |||
| 680 | Ga0496118_0001881 | |||
| 681 | Ga0496118_0008550 | |||
| 682 | Ga0496118_0010547 | |||
| 683 | Ga0496118_0022997 | |||
| 684 | Ga0496118_0034027 | |||
| 685 | Ga0496118_0082821 | |||
| 686 | Ga0496118_0103481 | |||
| 687 | Ga0496119_0000047 | |||
| 688 | Ga0496119_0026382 | |||
| 689 | Ga0496120_0000041 | |||
| 690 | Ga0496120_0066642 | |||
| 691 | Ga0496121_0010452 | |||
| 692 | Ga0496121_0024019 | |||
| 693 | Ga0496121_0139071 | |||
| 694 | Ga0496122_0004491 | |||
| 695 | Ga0496122_0007599 | |||
| 696 | Ga0496122_0010540 | |||
| 697 | Ga0496122_0031502 | |||
| 698 | Ga0496123_0008919 | |||
| 699 | Ga0496123_0017407 | |||
| 700 | Ga0496123_0033573 | |||
| 701 | Ga0496123_0048323 | |||
| 702 | Ga0496124_0000009 | |||
| 703 | Ga0496124_0000056 | |||
| 704 | Ga0496124_0004171 | |||
| 705 | Ga0496124_0007217 | |||
| 706 | Ga0496124_0008201 | |||
| 707 | Ga0496124_0012855 | |||
| 708 | Ga0496124_0026530 | |||
| 709 | Ga0496124_0304293 | |||
| 710 | Ga0496125_0000197 | |||
| 711 | Ga0496125_0000656 | |||
| 712 | Ga0496125_0045168 | |||
| 713 | Ga0496126_0000238 | |||
| 714 | Ga0496126_0001426 | |||
| 715 | Ga0496126_0021070 | |||
| 716 | Ga0501317_007961 | |||
| 717 | Ga0501318_001448 | |||
| 718 | Ga0501321_002003 | |||
| 719 | Ga0501036_0393054 | |||
| 720 | Ga0501037_0134308 | |||
| 721 | Ga0501039_0193721 | |||
| 722 | Ga0501040_0118522 | |||
| 723 | Ga0501046_0042799 | |||
| 724 | Ga0501067_0036021 | |||
| 725 | Ga0501068_0131502 | |||
| 726 | Ga0501071_0171891 | |||
| 727 | Ga0501072_0125842 | |||
| 728 | Ga0501075_0015155 | |||
| 729 | Ga0501081_0065758 | |||
| 730 | Ga0501035_0152256 | |||
| 731 | nmdc:mga00v17_862_c2 | |||
| 732 | nmdc:mga09592_45526_c1 | |||
| 733 | nmdc:mga08y16_88254_c1 | |||
| 734 | nmdc:mga0sz30_13500_c1 | |||
| 735 | Ga0495601_0011449 | |||
| 736 | Ga0495601_0018657 | |||
| 737 | Ga0495595_0123509 | |||
| 738 | Ga0495619_0009486 | |||
| 739 | Ga0495619_0122969 | |||
| 740 | Ga0500556_0001677 | |||
| 741 | Ga0500593_000867 | |||
| 742 | 2524469219 | |||
| 743 | 2578458093 | |||
| 744 | 2644091661 | |||
| 745 | 2644321464 | |||
| 746 | 2747950488 | |||
| 747 | 2765579451 | |||
| 748 | 2842758146 | |||
| 749 | 2842781018 | |||
| 750 | 2852650552 | |||
| 751 | 2857446063 | |||
| 752 | 2857482743 | |||
| 753 | 2939593258 | |||
| 754 | 2939624117 | |||
| 755 | 2941476081 | |||
| 756 | 2974308635 | |||
| 757 | 2977249376 | |||
| 758 | 2984516155 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jip-assembly1.cif.gz_A | crystal structure of glycerol trinitrate reductase nera from agrobacterium radiobacter in complex with 4-hydroxybenzaldehyde | 0.9763 | 8 | 358 |
| 5epd-assembly1.cif.gz_A | crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form) | 0.9741 | 8 | 359 |
| 6uff-assembly2.cif.gz_B | structure of ene-reductase 1 nostocer1 from cyanobacteria | 0.9647 | 8 | 358 |
| 4a3u-assembly2.cif.gz_B | x-structure of the old yellow enzyme homologue from zymomonas mobilis (ncr) | 0.9642 | 8 | 356 |
| 6s32-assembly3.cif.gz_C | crystal structure of ene-reductase ctoye from chroococcidiopsis thermalis. | 0.9638 | 8 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jicB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9729 | 8 | 358 | 3.20.20.70 |
| 4a3uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9651 | 8 | 358 | 3.20.20.70 |
| af_E9AGH7_3_365_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9639 | 8 | 358 | 3.20.20.70 |
| 4awuA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9575 | 8 | 358 | 3.20.20.70 |
| af_E9AGH8_6_374_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.956 | 8 | 358 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A164GDP6-F1-model_v4 | NADH-dependent flavin oxidoreductase yqiG-like protein | 1.001 | 158 | 253 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-Q5H1L7-F1-model_v4 | GTN reductase | 0.9944 | 1 | 358 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-G7UWI1-F1-model_v4 | GTN reductase | 0.9901 | 2 | 358 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A0C2C0X1-F1-model_v4 | N-ethylmaleimide reductase | 0.9874 | 10 | 358 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-Q5H1L7-F1-model_v4 | GTN reductase | 0.9862 | 1 | 358 |
GO:0005829
GO:0010181 GO:0016491 |