F428347

General Info

Members Datasets Scaffolds Average Seq Length
379 245 758 360

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10270871|Ga0105248_102708712
Length 401
Sequence LAPLVEEINSGAVRRDLVRRSQAGIGRLGPAGILAGWDRVKVMATPNLLTPGRIDGFETRNRLMMAPMTRSRALAGGVPSDLAIEYYAQRASAGIIVTEGVAPTAVGLGYARTPAIESREQIAVWKKITAAVKARGGHIFIQFMHVGRIGHSANRYTSDPLVAPSAVRANAQIWTDAHGLQDMDAPRALETSEIPGIIDGFAQATRNALEAGFDGVELHAASGYLPMQFLSTGTNQRTDGYGGSVQNRLRFVVDTLQAMIAAAGEPGKVGMKISPAIPFNDIHDDDPIETYTALVKAVAPMGLGYLHVLRTPPLPNIFEVLRPLYPGTFAVGGAFDFDSGNAAIASGLADFVVFGKPFTSNPDLAERFAGGLELTPFDATTFYTPGPKGYVDYLPAAAQSA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
137 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
229 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
230 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
231 2643221615 Nocardioides sp. Root224 Isolate Unclassified
232 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
233 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
234 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
235 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
236 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
237 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
238 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
239 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
240 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
241 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
242 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
243 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
244 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
245 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 0.79
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 9.5
Nodule 0.26
Rhizoplane 2.37
Rhizosphere 73.09
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10270871 3300009177 Bacteria 1912
2 Ga0055526_1016633 3300003771 Bacteria 2862
3 Ga0055537_1000171 3300003773 Bacteria 48534
4 Ga0055536_1005885 3300003781 Bacteria 5878
5 Ga0055536_1005907 3300003781 Bacteria 5863
6 Ga0055534_1000114 3300003784 Bacteria 59511
7 Ga0055528_1002993 3300003790 Bacteria 8747
8 Ga0055530_10000021 3300003791 Bacteria 139383
9 Ga0055530_10000071 3300003791 Bacteria 86290
10 Ga0055531_10007595 3300003794 Bacteria 5878
11 Ga0055531_10008873 3300003794 Bacteria 5224
12 Ga0055531_10016111 3300003794 Bacteria 3246
13 Ga0058692_1000231 3300003856 Bacteria 32264
14 Ga0065707_10005529 3300005295 Bacteria 5886
15 Ga0070670_100000520 3300005331 Bacteria 30844
16 Ga0070670_100217678 3300005331 Bacteria 1661
17 Ga0070677_10004592 3300005333 Bacteria 4516
18 Ga0068869_100020058 3300005334 Bacteria 4578
19 Ga0068869_100094763 3300005334 Bacteria 2251
20 Ga0070666_10000395 3300005335 Bacteria 27401
21 Ga0070666_10083864 3300005335 Bacteria 2180
22 Ga0070682_100186524 3300005337 Unclassified 1453
23 Ga0068868_100020706 3300005338 Bacteria 4947
24 Ga0068868_100316049 3300005338 Bacteria 1329
25 Ga0070661_100005136 3300005344 Bacteria 9015
26 Ga0070661_100332773 3300005344 Bacteria 1188
27 Ga0070669_100031013 3300005353 Bacteria 3859
28 Ga0070675_100003435 3300005354 Bacteria 12002
29 Ga0070675_100006494 3300005354 Bacteria 8979
30 Ga0070675_100006599 3300005354 Bacteria 8917
31 Ga0070675_100216190 3300005354 Bacteria 1668
32 Ga0070671_100175339 3300005355 Bacteria 1814
33 Ga0070674_100000462 3300005356 Bacteria 20520
34 Ga0070674_100056889 3300005356 Bacteria 2713
35 Ga0070674_100067389 3300005356 Bacteria 2517
36 Ga0070673_100007462 3300005364 Bacteria 7213
37 Ga0070688_100008268 3300005365 Bacteria 5642
38 Ga0070667_100015021 3300005367 Bacteria 6398
39 Ga0070667_100148636 3300005367 Bacteria 2056
40 Ga0070667_100260292 3300005367 Bacteria 1553
41 Ga0070709_10092056 3300005434 Bacteria 2002
42 Ga0070700_100008048 3300005441 Bacteria 5731
43 Ga0070663_100010327 3300005455 Bacteria 5820
44 Ga0070663_100043158 3300005455 Bacteria 3172
45 Ga0070678_100055764 3300005456 Bacteria 2887
46 Ga0070662_100295265 3300005457 Bacteria 1315
47 Ga0068867_100034423 3300005459 Bacteria 3671
48 Ga0070685_10023938 3300005466 Bacteria 3349
49 Ga0070698_100213529 3300005471 Bacteria 1864
50 Ga0070679_100200822 3300005530 Bacteria 1960
51 Ga0070672_100003653 3300005543 Bacteria 9992
52 Ga0070686_100012155 3300005544 Bacteria 4898
53 Ga0070686_100046938 3300005544 Bacteria 2728
54 Ga0070665_100129485 3300005548 Bacteria 2526
55 Ga0070664_100018128 3300005564 Bacteria 5778
56 Ga0068854_100043268 3300005578 Bacteria 3191
57 Ga0068854_100158127 3300005578 Bacteria 1753
58 Ga0068856_100013776 3300005614 Bacteria 7815
59 Ga0070702_100060902 3300005615 Bacteria 2196
60 Ga0068852_100053744 3300005616 Bacteria 3469
61 Ga0068859_100010127 3300005617 Bacteria 9496
62 Ga0068859_100101612 3300005617 Bacteria 2932
63 Ga0068859_100579558 3300005617 Bacteria 1216
64 Ga0068864_100032810 3300005618 Bacteria 4413
65 Ga0068866_10050730 3300005718 Bacteria 2108
66 Ga0068866_10072086 3300005718 Bacteria 1829
67 Ga0068851_10138480 3300005834 Bacteria 1322
68 Ga0068863_100000134 3300005841 Bacteria 78372
69 Ga0068863_100019902 3300005841 Bacteria 6419
70 Ga0068863_100135294 3300005841 Bacteria 2354
71 Ga0068858_100015595 3300005842 Bacteria 7147
72 Ga0068858_100087485 3300005842 Bacteria 2897
73 Ga0068860_100006539 3300005843 Bacteria 11698
74 Ga0068860_100187728 3300005843 Bacteria 1999
75 Ga0068860_100414031 3300005843 Bacteria 1335
76 Ga0068862_100420165 3300005844 Bacteria 1254
77 Ga0081455_10022732 3300005937 Bacteria 5851
78 Ga0070717_10185977 3300006028 Bacteria 1813
79 Ga0075365_10003163 3300006038 Bacteria 8401
80 Ga0075364_10034064 3300006051 Bacteria 3283
81 Ga0075364_10217271 3300006051 Bacteria 1297
82 Ga0075369_10014033 3300006186 Bacteria 3193
83 Ga0097621_100000885 3300006237 Bacteria 20990
84 Ga0097621_100281664 3300006237 Bacteria 1463
85 Ga0068871_100007946 3300006358 Bacteria 7606
86 Ga0068871_100041566 3300006358 Bacteria 3687
87 Ga0068871_100379668 3300006358 Bacteria 1255
88 Ga0068865_100126467 3300006881 Bacteria 1908
89 Ga0068865_100215444 3300006881 Bacteria 1499
90 Ga0097620_100010127 3300006931 Bacteria 9496
91 Ga0097620_100101615 3300006931 Bacteria 2932
92 Ga0097620_100579561 3300006931 Bacteria 1216
93 Ga0105251_10012796 3300009011 Bacteria 4728
94 Ga0111539_10103924 3300009094 Bacteria 3333
95 Ga0105245_10557189 3300009098 Bacteria 1169
96 Ga0105247_10062616 3300009101 Bacteria 2308
97 Ga0105243_10008675 3300009148 Bacteria 7794
98 Ga0105242_10011396 3300009176 Bacteria 6834
99 Ga0105242_10066510 3300009176 Bacteria 2977
100 Ga0105242_10094363 3300009176 Bacteria 2524
101 Ga0105248_10037401 3300009177 Bacteria 5430
102 Ga0105248_10111105 3300009177 Bacteria 3091
103 Ga0105248_10183025 3300009177 Bacteria 2361
104 Ga0105248_10317993 3300009177 Bacteria 1753
105 Ga0105238_10008736 3300009551 Bacteria 10134
106 Ga0157371_10000022 3300013102 Bacteria 295029
107 Ga0157371_10055720 3300013102 Bacteria 2805
108 Ga0157370_10000178 3300013104 Bacteria 79566
109 Ga0157370_10355207 3300013104 Bacteria 1351
110 Ga0157369_10065406 3300013105 Bacteria 3913
111 Ga0157369_10203826 3300013105 Bacteria 2075
112 Ga0157374_10236217 3300013296 Bacteria 1796
113 Ga0157374_10261082 3300013296 Bacteria 1706
114 Ga0157378_10219000 3300013297 Bacteria 1809
115 Ga0163162_10034929 3300013306 Bacteria 5005
116 Ga0163162_10115172 3300013306 Bacteria 2788
117 Ga0163162_10327784 3300013306 Bacteria 1664
118 Ga0157375_10092153 3300013308 Bacteria 3093
119 Ga0163163_10012603 3300014325 Bacteria 7710
120 Ga0163163_10016341 3300014325 Bacteria 6891
121 Ga0163163_10069241 3300014325 Bacteria 3513
122 Ga0163163_10074351 3300014325 Bacteria 3390
123 Ga0157380_10048293 3300014326 Bacteria 3351
124 Ga0157380_10077131 3300014326 Bacteria 2715
125 Ga0182008_10000085 3300014497 Bacteria 72514
126 Ga0182008_10026000 3300014497 Bacteria 2970
127 Ga0157379_10032403 3300014968 Bacteria 4660
128 Ga0157379_10081173 3300014968 Bacteria 2905
129 Ga0157379_10199027 3300014968 Bacteria 1811
130 Ga0157376_10022215 3300014969 Bacteria 4941
131 Ga0157376_10172067 3300014969 Bacteria 1973
132 Ga0182007_10000004 3300015262 Bacteria 485875
133 Ga0182005_1000004 3300015265 Bacteria 609645
134 Ga0182005_1000105 3300015265 Bacteria 63475
135 Ga0163161_10000802 3300017792 Bacteria 24592
136 Ga0163161_10056648 3300017792 Bacteria 2847
137 Ga0163161_10085322 3300017792 Bacteria 2329
138 Ga0209565_1000024 3300025263 Bacteria 379907
139 Ga0209673_1000087 3300025273 Bacteria 205213
140 Ga0209130_1020197 3300025284 Bacteria 1529
141 Ga0209675_1000039 3300025291 Bacteria 247966
142 Ga0209676_1000011 3300025292 Bacteria 860463
143 Ga0209676_1000075 3300025292 Bacteria 303609
144 Ga0209676_1000536 3300025292 Bacteria 58911
145 Ga0209564_1000188 3300025295 Bacteria 144251
146 Ga0209050_1000032 3300025298 Bacteria 456335
147 Ga0209050_1000069 3300025298 Bacteria 297615
148 Ga0209050_1003970 3300025298 Bacteria 10435
149 Ga0209256_1002367 3300025299 Bacteria 15612
150 Ga0209051_1003627 3300025303 Bacteria 10009
151 Ga0209257_1000014 3300025304 Bacteria 946850
152 Ga0209257_1000571 3300025304 Bacteria 61995
153 Ga0209257_1001102 3300025304 Bacteria 35143
154 Ga0209257_1001364 3300025304 Bacteria 29523
155 Ga0207682_10019414 3300025893 Bacteria 2660
156 Ga0207682_10055586 3300025893 Bacteria 1646
157 Ga0207642_10003234 3300025899 Bacteria 5113
158 Ga0207688_10008792 3300025901 Bacteria 5494
159 Ga0207680_10000715 3300025903 Bacteria 15556
160 Ga0207699_10092327 3300025906 Bacteria 1903
161 Ga0207645_10006130 3300025907 Bacteria 8638
162 Ga0207643_10002904 3300025908 Bacteria 9258
163 Ga0207695_10129960 3300025913 Bacteria 2477
164 Ga0207671_10080966 3300025914 Bacteria 2435
165 Ga0207662_10073508 3300025918 Bacteria 2074
166 Ga0207652_10306754 3300025921 Bacteria 1433
167 Ga0207681_10023269 3300025923 Bacteria 3960
168 Ga0207681_10170524 3300025923 Bacteria 1649
169 Ga0207694_10004631 3300025924 Bacteria 10712
170 Ga0207694_10097847 3300025924 Bacteria 2322
171 Ga0207650_10028433 3300025925 Bacteria 4009
172 Ga0207659_10001962 3300025926 Bacteria 12220
173 Ga0207659_10009050 3300025926 Bacteria 6211
174 Ga0207659_10055616 3300025926 Bacteria 2831
175 Ga0207644_10017562 3300025931 Bacteria 4835
176 Ga0207644_10098795 3300025931 Bacteria 2189
177 Ga0207644_10152193 3300025931 Bacteria 1791
178 Ga0207706_10050074 3300025933 Bacteria 3692
179 Ga0207706_10071973 3300025933 Bacteria 3041
180 Ga0207686_10027966 3300025934 Bacteria 3308
181 Ga0207709_10013092 3300025935 Bacteria 4573
182 Ga0207670_10011752 3300025936 Bacteria 5095
183 Ga0207669_10004908 3300025937 Bacteria 5945
184 Ga0207669_10044079 3300025937 Bacteria 2618
185 Ga0207711_10022987 3300025941 Bacteria 5219
186 Ga0207689_10018862 3300025942 Bacteria 5817
187 Ga0207679_10073258 3300025945 Bacteria 2590
188 Ga0207667_10145531 3300025949 Bacteria 2439
189 Ga0207651_10006434 3300025960 Bacteria 6146
190 Ga0207651_10015433 3300025960 Bacteria 4438
191 Ga0207712_10116468 3300025961 Bacteria 2014
192 Ga0207640_10031438 3300025981 Unclassified 3280
193 Ga0207640_10038049 3300025981 Bacteria 3033
194 Ga0207658_10158629 3300025986 Bacteria 1852
195 Ga0207677_10022093 3300026023 Bacteria 3903
196 Ga0207677_10166155 3300026023 Bacteria 1720
197 Ga0207677_10250577 3300026023 Bacteria 1438
198 Ga0207703_10010878 3300026035 Bacteria 7095
199 Ga0207703_10329405 3300026035 Bacteria 1400
200 Ga0207639_10115147 3300026041 Bacteria 2198
201 Ga0207678_10007147 3300026067 Bacteria 9908
202 Ga0207678_10030373 3300026067 Bacteria 4718
203 Ga0207708_10034970 3300026075 Bacteria 3823
204 Ga0207708_10038977 3300026075 Bacteria 3620
205 Ga0207641_10000076 3300026088 Bacteria 145031
206 Ga0207648_10000429 3300026089 Bacteria 46380
207 Ga0207648_10020571 3300026089 Bacteria 5941
208 Ga0207676_10022401 3300026095 Bacteria 4646
209 Ga0207676_10165992 3300026095 Bacteria 1918
210 Ga0207674_10059630 3300026116 Bacteria 3860
211 Ga0207674_10077746 3300026116 Bacteria 3324
212 Ga0207675_100031820 3300026118 Bacteria 4915
213 Ga0207675_100236072 3300026118 Bacteria 1765
214 Ga0209371_1000007 3300027312 Bacteria 1050654
215 Ga0209974_10035339 3300027876 Bacteria 1660
216 Ga0268266_10022865 3300028379 Bacteria 5321
217 Ga0268266_10031449 3300028379 Bacteria 4507
218 Ga0268266_10331485 3300028379 Bacteria 1426
219 Ga0268265_10139331 3300028380 Bacteria 2029
220 Ga0268265_10385789 3300028380 Bacteria 1290
221 Ga0268264_10000334 3300028381 Bacteria 72930
222 Ga0268264_10352121 3300028381 Bacteria 1402
223 Ga0268256_1000008 3300030500 Bacteria 1050654
224 Ga0316183_1018922 3300030742 Bacteria 3230
225 Ga0316181_1266962 3300030744 Bacteria 2136
226 Ga0307415_100324026 3300032126 Bacteria 1286
227 Ga0373926_0062126 3300035083 Bacteria 1363
228 Ga0373945_0050799 3300035116 Bacteria 1525
229 Ga0373945_0108439 3300035116 Bacteria 1093
230 Ga0373956_0144764 3300035119 Unclassified 1117
231 Ga0373955_0174651 3300035172 Bacteria 1273
232 Ga0373935_0211767 3300035692 Bacteria 1343
233 Ga0373933_0031917 3300035724 Bacteria 3059
234 Ga0373947_0068593 3300035725 Bacteria 2169
235 Ga0395898_0254788 3300037466 Bacteria 1674
236 Ga0237819_01881 3300038705 Bacteria 4815
237 Ga0436361_0664887 3300039447 Bacteria 6560
238 Ga0436361_0873141 3300039447 Bacteria 19210
239 Ga0439453_0011255 3300041408 Bacteria 1489
240 Ga0439432_019851 3300042006 Bacteria 2236
241 Ga0439435_0004690 3300042436 Bacteria 2961
242 Ga0466972_0028892 3300044658 Bacteria 2732
243 Ga0466970_0035757 3300044765 Bacteria 2631
244 Ga0466970_0148934 3300044765 Bacteria 1292
245 Ga0466967_0024714 3300045976 Bacteria 4944
246 Ga0495627_008190 3300046453 Bacteria 3933
247 Ga0495638_0000550 3300046460 Bacteria 42869
248 Ga0495638_0022101 3300046460 Bacteria 4178
249 Ga0495580_0000112 3300046472 Bacteria 55094
250 Ga0495580_0001160 3300046472 Bacteria 23154
251 Ga0495664_0048998 3300046477 Bacteria 2508
252 Ga0495607_0005989 3300046501 Bacteria 8619
253 Ga0495608_0010671 3300046511 Bacteria 6408
254 Ga0495610_0000321 3300046512 Bacteria 51039
255 Ga0495610_0013886 3300046512 Bacteria 4760
256 Ga0495628_0019043 3300046516 Bacteria 5679
257 Ga0495628_0111619 3300046516 Bacteria 2102
258 Ga0495630_0070928 3300046517 Bacteria 2621
259 Ga0495631_0003054 3300046518 Bacteria 9243
260 Ga0495643_0000307 3300046522 Bacteria 67608
261 Ga0495663_0000277 3300046525 Bacteria 19707
262 Ga0495663_0002533 3300046525 Bacteria 5472
263 Ga0495666_0017195 3300046526 Bacteria 3602
264 Ga0495652_0077235 3300046529 Bacteria 2761
265 Ga0495665_0093223 3300046531 Bacteria 1583
266 Ga0495586_0036684 3300046535 Bacteria 2632
267 Ga0495633_0000854 3300046558 Bacteria 26659
268 Ga0495625_0015780 3300046660 Bacteria 5963
269 Ga0495625_0016158 3300046660 Bacteria 5880
270 Ga0495599_0013360 3300046678 Bacteria 5074
271 Ga0495646_0108133 3300046680 Bacteria 1586
272 Ga0495658_0147325 3300046683 Bacteria 1444
273 Ga0495613_0001124 3300046689 Bacteria 20369
274 Ga0495624_0000022 3300046690 Bacteria 99926
275 Ga0495660_0037571 3300046810 Bacteria 2696
276 Ga0495581_0095646 3300047315 Bacteria 1725
277 Ga0495604_0009598 3300047317 Bacteria 7654
278 Ga0495604_0062802 3300047317 Bacteria 2836
279 Ga0495674_0018946 3300047319 Bacteria 6402
280 Ga0495672_0000006 3300047320 Bacteria 589807
281 Ga0495684_0000864 3300047471 Bacteria 24618
282 Ga0495686_0005964 3300047472 Bacteria 9484
283 Ga0495686_0016803 3300047472 Bacteria 4949
284 Ga0496100_0007817 3300048903 Bacteria 5932
285 Ga0496101_0004193 3300048904 Bacteria 9034
286 Ga0496102_0082335 3300048905 Bacteria 2968
287 Ga0496103_0019271 3300048906 Bacteria 4097
288 Ga0496104_0110773 3300048907 Bacteria 2632
289 Ga0496106_0011864 3300048909 Bacteria 6433
290 Ga0496111_0067986 3300048914 Bacteria 2589
291 Ga0496112_0059027 3300048915 Bacteria 3780
292 Ga0496114_0016022 3300048917 Bacteria 6031
293 Ga0496116_0016686 3300048919 Bacteria 5736
294 Ga0496116_0017290 3300048919 Bacteria 5606
295 Ga0496117_0000227 3300048920 Bacteria 106119
296 Ga0496117_0000645 3300048920 Bacteria 56167
297 Ga0496117_0007547 3300048920 Bacteria 10596
298 Ga0496117_0152691 3300048920 Bacteria 1364
299 Ga0496118_0000338 3300048921 Bacteria 80086
300 Ga0496118_0001455 3300048921 Bacteria 35628
301 Ga0496118_0001881 3300048921 Bacteria 29958
302 Ga0496118_0008550 3300048921 Bacteria 10553
303 Ga0496118_0010547 3300048921 Bacteria 9136
304 Ga0496118_0022997 3300048921 Bacteria 5428
305 Ga0496118_0034027 3300048921 Bacteria 4168
306 Ga0496118_0082821 3300048921 Bacteria 2246
307 Ga0496118_0103481 3300048921 Bacteria 1915
308 Ga0496119_0000047 3300048922 Bacteria 188401
309 Ga0496119_0026382 3300048922 Bacteria 4030
310 Ga0496120_0000041 3300048923 Bacteria 200518
311 Ga0496120_0066642 3300048923 Bacteria 1991
312 Ga0496121_0010452 3300048924 Bacteria 10470
313 Ga0496121_0024019 3300048924 Bacteria 5843
314 Ga0496121_0139071 3300048924 Bacteria 1804
315 Ga0496122_0004491 3300048925 Bacteria 17255
316 Ga0496122_0007599 3300048925 Bacteria 11981
317 Ga0496122_0010540 3300048925 Bacteria 9500
318 Ga0496122_0031502 3300048925 Bacteria 4411
319 Ga0496123_0008919 3300048926 Bacteria 9117
320 Ga0496123_0017407 3300048926 Bacteria 5784
321 Ga0496123_0033573 3300048926 Bacteria 3691
322 Ga0496123_0048323 3300048926 Bacteria 2863
323 Ga0496124_0000009 3300048927 Bacteria 734820
324 Ga0496124_0000056 3300048927 Bacteria 250907
325 Ga0496124_0004171 3300048927 Bacteria 17039
326 Ga0496124_0007217 3300048927 Bacteria 11872
327 Ga0496124_0008201 3300048927 Bacteria 10958
328 Ga0496124_0012855 3300048927 Bacteria 8223
329 Ga0496124_0026530 3300048927 Bacteria 5220
330 Ga0496124_0304293 3300048927 Bacteria 1150
331 Ga0496125_0000197 3300048928 Bacteria 129154
332 Ga0496125_0000656 3300048928 Bacteria 57618
333 Ga0496125_0045168 3300048928 Bacteria 3712
334 Ga0496126_0000238 3300048929 Bacteria 118994
335 Ga0496126_0001426 3300048929 Bacteria 37638
336 Ga0496126_0021070 3300048929 Bacteria 6376
337 Ga0501317_007961 3300049533 Bacteria 1210
338 Ga0501318_001448 3300049534 Bacteria 1868
339 Ga0501321_002003 3300049537 Bacteria 1711
340 Ga0501036_0393054 3300049572 Bacteria 1157
341 Ga0501037_0134308 3300049573 Bacteria 1773
342 Ga0501039_0193721 3300049575 Bacteria 1598
343 Ga0501040_0118522 3300049576 Bacteria 1856
344 Ga0501046_0042799 3300049580 Bacteria 3610
345 Ga0501067_0036021 3300049583 Bacteria 2748
346 Ga0501068_0131502 3300049584 Bacteria 1565
347 Ga0501071_0171891 3300049587 Bacteria 1622
348 Ga0501072_0125842 3300049588 Bacteria 2042
349 Ga0501075_0015155 3300049591 Bacteria 5529
350 Ga0501081_0065758 3300049743 Bacteria 2521
351 Ga0501035_0152256 3300049822 Bacteria 2006
352 nmdc:mga00v17_862_c2 3300050491 Bacteria 15867
353 nmdc:mga09592_45526_c1 3300050508 Bacteria 3696
354 nmdc:mga08y16_88254_c1 3300050511 Bacteria 3232
355 nmdc:mga0sz30_13500_c1 3300050516 Bacteria 3200
356 Ga0495601_0011449 3300053077 Bacteria 5306
357 Ga0495601_0018657 3300053077 Unclassified 4224
358 Ga0495595_0123509 3300053084 Bacteria 1262
359 Ga0495619_0009486 3300053085 Bacteria 6138
360 Ga0495619_0122969 3300053085 Bacteria 1780
361 Ga0500556_0001677 3300053104 Bacteria 8570
362 Ga0500593_000867 3300053117 Bacteria 11248
363 2524469219 2524023210 Bacteria 9029266
364 2578458093 2576861471 Bacteria 4648976
365 2644091661 2643221615 Bacteria 5487866
366 2644321464 2643221657 Bacteria 5490246
367 2747950488 2747842428 Bacteria 4689383
368 2765579451 2765235840 Bacteria 4663337
369 2842758146 2842757796 Bacteria 3981385
370 2842781018 2842780639 Bacteria 4337790
371 2852650552 2852649853 Bacteria 4036942
372 2857446063 2857442823 Bacteria 4562550
373 2857482743 2857481737 Bacteria 4761446
374 2939593258 2939589442 Bacteria 4214238
375 2939624117 2939622612 Bacteria 4698046
376 2941476081 2941475908 Bacteria 4145589
377 2974308635 2974307012 Bacteria 4172388
378 2977249376 2977247770 Bacteria 4160543
379 2984516155 2984514374 Bacteria 4172479
380 Ga0105248_10270871
381 Ga0055526_1016633
382 Ga0055537_1000171
383 Ga0055536_1005885
384 Ga0055536_1005907
385 Ga0055534_1000114
386 Ga0055528_1002993
387 Ga0055530_10000021
388 Ga0055530_10000071
389 Ga0055531_10007595
390 Ga0055531_10008873
391 Ga0055531_10016111
392 Ga0058692_1000231
393 Ga0065707_10005529
394 Ga0070670_100000520
395 Ga0070670_100217678
396 Ga0070677_10004592
397 Ga0068869_100020058
398 Ga0068869_100094763
399 Ga0070666_10000395
400 Ga0070666_10083864
401 Ga0070682_100186524
402 Ga0068868_100020706
403 Ga0068868_100316049
404 Ga0070661_100005136
405 Ga0070661_100332773
406 Ga0070669_100031013
407 Ga0070675_100003435
408 Ga0070675_100006494
409 Ga0070675_100006599
410 Ga0070675_100216190
411 Ga0070671_100175339
412 Ga0070674_100000462
413 Ga0070674_100056889
414 Ga0070674_100067389
415 Ga0070673_100007462
416 Ga0070688_100008268
417 Ga0070667_100015021
418 Ga0070667_100148636
419 Ga0070667_100260292
420 Ga0070709_10092056
421 Ga0070700_100008048
422 Ga0070663_100010327
423 Ga0070663_100043158
424 Ga0070678_100055764
425 Ga0070662_100295265
426 Ga0068867_100034423
427 Ga0070685_10023938
428 Ga0070698_100213529
429 Ga0070679_100200822
430 Ga0070672_100003653
431 Ga0070686_100012155
432 Ga0070686_100046938
433 Ga0070665_100129485
434 Ga0070664_100018128
435 Ga0068854_100043268
436 Ga0068854_100158127
437 Ga0068856_100013776
438 Ga0070702_100060902
439 Ga0068852_100053744
440 Ga0068859_100010127
441 Ga0068859_100101612
442 Ga0068859_100579558
443 Ga0068864_100032810
444 Ga0068866_10050730
445 Ga0068866_10072086
446 Ga0068851_10138480
447 Ga0068863_100000134
448 Ga0068863_100019902
449 Ga0068863_100135294
450 Ga0068858_100015595
451 Ga0068858_100087485
452 Ga0068860_100006539
453 Ga0068860_100187728
454 Ga0068860_100414031
455 Ga0068862_100420165
456 Ga0081455_10022732
457 Ga0070717_10185977
458 Ga0075365_10003163
459 Ga0075364_10034064
460 Ga0075364_10217271
461 Ga0075369_10014033
462 Ga0097621_100000885
463 Ga0097621_100281664
464 Ga0068871_100007946
465 Ga0068871_100041566
466 Ga0068871_100379668
467 Ga0068865_100126467
468 Ga0068865_100215444
469 Ga0097620_100010127
470 Ga0097620_100101615
471 Ga0097620_100579561
472 Ga0105251_10012796
473 Ga0111539_10103924
474 Ga0105245_10557189
475 Ga0105247_10062616
476 Ga0105243_10008675
477 Ga0105242_10011396
478 Ga0105242_10066510
479 Ga0105242_10094363
480 Ga0105248_10037401
481 Ga0105248_10111105
482 Ga0105248_10183025
483 Ga0105248_10317993
484 Ga0105238_10008736
485 Ga0157371_10000022
486 Ga0157371_10055720
487 Ga0157370_10000178
488 Ga0157370_10355207
489 Ga0157369_10065406
490 Ga0157369_10203826
491 Ga0157374_10236217
492 Ga0157374_10261082
493 Ga0157378_10219000
494 Ga0163162_10034929
495 Ga0163162_10115172
496 Ga0163162_10327784
497 Ga0157375_10092153
498 Ga0163163_10012603
499 Ga0163163_10016341
500 Ga0163163_10069241
501 Ga0163163_10074351
502 Ga0157380_10048293
503 Ga0157380_10077131
504 Ga0182008_10000085
505 Ga0182008_10026000
506 Ga0157379_10032403
507 Ga0157379_10081173
508 Ga0157379_10199027
509 Ga0157376_10022215
510 Ga0157376_10172067
511 Ga0182007_10000004
512 Ga0182005_1000004
513 Ga0182005_1000105
514 Ga0163161_10000802
515 Ga0163161_10056648
516 Ga0163161_10085322
517 Ga0209565_1000024
518 Ga0209673_1000087
519 Ga0209130_1020197
520 Ga0209675_1000039
521 Ga0209676_1000011
522 Ga0209676_1000075
523 Ga0209676_1000536
524 Ga0209564_1000188
525 Ga0209050_1000032
526 Ga0209050_1000069
527 Ga0209050_1003970
528 Ga0209256_1002367
529 Ga0209051_1003627
530 Ga0209257_1000014
531 Ga0209257_1000571
532 Ga0209257_1001102
533 Ga0209257_1001364
534 Ga0207682_10019414
535 Ga0207682_10055586
536 Ga0207642_10003234
537 Ga0207688_10008792
538 Ga0207680_10000715
539 Ga0207699_10092327
540 Ga0207645_10006130
541 Ga0207643_10002904
542 Ga0207695_10129960
543 Ga0207671_10080966
544 Ga0207662_10073508
545 Ga0207652_10306754
546 Ga0207681_10023269
547 Ga0207681_10170524
548 Ga0207694_10004631
549 Ga0207694_10097847
550 Ga0207650_10028433
551 Ga0207659_10001962
552 Ga0207659_10009050
553 Ga0207659_10055616
554 Ga0207644_10017562
555 Ga0207644_10098795
556 Ga0207644_10152193
557 Ga0207706_10050074
558 Ga0207706_10071973
559 Ga0207686_10027966
560 Ga0207709_10013092
561 Ga0207670_10011752
562 Ga0207669_10004908
563 Ga0207669_10044079
564 Ga0207711_10022987
565 Ga0207689_10018862
566 Ga0207679_10073258
567 Ga0207667_10145531
568 Ga0207651_10006434
569 Ga0207651_10015433
570 Ga0207712_10116468
571 Ga0207640_10031438
572 Ga0207640_10038049
573 Ga0207658_10158629
574 Ga0207677_10022093
575 Ga0207677_10166155
576 Ga0207677_10250577
577 Ga0207703_10010878
578 Ga0207703_10329405
579 Ga0207639_10115147
580 Ga0207678_10007147
581 Ga0207678_10030373
582 Ga0207708_10034970
583 Ga0207708_10038977
584 Ga0207641_10000076
585 Ga0207648_10000429
586 Ga0207648_10020571
587 Ga0207676_10022401
588 Ga0207676_10165992
589 Ga0207674_10059630
590 Ga0207674_10077746
591 Ga0207675_100031820
592 Ga0207675_100236072
593 Ga0209371_1000007
594 Ga0209974_10035339
595 Ga0268266_10022865
596 Ga0268266_10031449
597 Ga0268266_10331485
598 Ga0268265_10139331
599 Ga0268265_10385789
600 Ga0268264_10000334
601 Ga0268264_10352121
602 Ga0268256_1000008
603 Ga0316183_1018922
604 Ga0316181_1266962
605 Ga0307415_100324026
606 Ga0373926_0062126
607 Ga0373945_0050799
608 Ga0373945_0108439
609 Ga0373956_0144764
610 Ga0373955_0174651
611 Ga0373935_0211767
612 Ga0373933_0031917
613 Ga0373947_0068593
614 Ga0395898_0254788
615 Ga0237819_01881
616 Ga0436361_0664887
617 Ga0436361_0873141
618 Ga0439453_0011255
619 Ga0439432_019851
620 Ga0439435_0004690
621 Ga0466972_0028892
622 Ga0466970_0035757
623 Ga0466970_0148934
624 Ga0466967_0024714
625 Ga0495627_008190
626 Ga0495638_0000550
627 Ga0495638_0022101
628 Ga0495580_0000112
629 Ga0495580_0001160
630 Ga0495664_0048998
631 Ga0495607_0005989
632 Ga0495608_0010671
633 Ga0495610_0000321
634 Ga0495610_0013886
635 Ga0495628_0019043
636 Ga0495628_0111619
637 Ga0495630_0070928
638 Ga0495631_0003054
639 Ga0495643_0000307
640 Ga0495663_0000277
641 Ga0495663_0002533
642 Ga0495666_0017195
643 Ga0495652_0077235
644 Ga0495665_0093223
645 Ga0495586_0036684
646 Ga0495633_0000854
647 Ga0495625_0015780
648 Ga0495625_0016158
649 Ga0495599_0013360
650 Ga0495646_0108133
651 Ga0495658_0147325
652 Ga0495613_0001124
653 Ga0495624_0000022
654 Ga0495660_0037571
655 Ga0495581_0095646
656 Ga0495604_0009598
657 Ga0495604_0062802
658 Ga0495674_0018946
659 Ga0495672_0000006
660 Ga0495684_0000864
661 Ga0495686_0005964
662 Ga0495686_0016803
663 Ga0496100_0007817
664 Ga0496101_0004193
665 Ga0496102_0082335
666 Ga0496103_0019271
667 Ga0496104_0110773
668 Ga0496106_0011864
669 Ga0496111_0067986
670 Ga0496112_0059027
671 Ga0496114_0016022
672 Ga0496116_0016686
673 Ga0496116_0017290
674 Ga0496117_0000227
675 Ga0496117_0000645
676 Ga0496117_0007547
677 Ga0496117_0152691
678 Ga0496118_0000338
679 Ga0496118_0001455
680 Ga0496118_0001881
681 Ga0496118_0008550
682 Ga0496118_0010547
683 Ga0496118_0022997
684 Ga0496118_0034027
685 Ga0496118_0082821
686 Ga0496118_0103481
687 Ga0496119_0000047
688 Ga0496119_0026382
689 Ga0496120_0000041
690 Ga0496120_0066642
691 Ga0496121_0010452
692 Ga0496121_0024019
693 Ga0496121_0139071
694 Ga0496122_0004491
695 Ga0496122_0007599
696 Ga0496122_0010540
697 Ga0496122_0031502
698 Ga0496123_0008919
699 Ga0496123_0017407
700 Ga0496123_0033573
701 Ga0496123_0048323
702 Ga0496124_0000009
703 Ga0496124_0000056
704 Ga0496124_0004171
705 Ga0496124_0007217
706 Ga0496124_0008201
707 Ga0496124_0012855
708 Ga0496124_0026530
709 Ga0496124_0304293
710 Ga0496125_0000197
711 Ga0496125_0000656
712 Ga0496125_0045168
713 Ga0496126_0000238
714 Ga0496126_0001426
715 Ga0496126_0021070
716 Ga0501317_007961
717 Ga0501318_001448
718 Ga0501321_002003
719 Ga0501036_0393054
720 Ga0501037_0134308
721 Ga0501039_0193721
722 Ga0501040_0118522
723 Ga0501046_0042799
724 Ga0501067_0036021
725 Ga0501068_0131502
726 Ga0501071_0171891
727 Ga0501072_0125842
728 Ga0501075_0015155
729 Ga0501081_0065758
730 Ga0501035_0152256
731 nmdc:mga00v17_862_c2
732 nmdc:mga09592_45526_c1
733 nmdc:mga08y16_88254_c1
734 nmdc:mga0sz30_13500_c1
735 Ga0495601_0011449
736 Ga0495601_0018657
737 Ga0495595_0123509
738 Ga0495619_0009486
739 Ga0495619_0122969
740 Ga0500556_0001677
741 Ga0500593_000867
742 2524469219
743 2578458093
744 2644091661
745 2644321464
746 2747950488
747 2765579451
748 2842758146
749 2842781018
750 2852650552
751 2857446063
752 2857482743
753 2939593258
754 2939624117
755 2941476081
756 2974308635
757 2977249376
758 2984516155

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

47

375

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jip-assembly1.cif.gz_A crystal structure of glycerol trinitrate reductase nera from agrobacterium radiobacter in complex with 4-hydroxybenzaldehyde 0.9763 8 358
5epd-assembly1.cif.gz_A crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form) 0.9741 8 359
6uff-assembly2.cif.gz_B structure of ene-reductase 1 nostocer1 from cyanobacteria 0.9647 8 358
4a3u-assembly2.cif.gz_B x-structure of the old yellow enzyme homologue from zymomonas mobilis (ncr) 0.9642 8 356
6s32-assembly3.cif.gz_C crystal structure of ene-reductase ctoye from chroococcidiopsis thermalis. 0.9638 8 358
ID Description Score Start End Superfamily
4jicB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9729 8 358 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9651 8 358 3.20.20.70
af_E9AGH7_3_365_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9639 8 358 3.20.20.70
4awuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9575 8 358 3.20.20.70
af_E9AGH8_6_374_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.956 8 358 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A164GDP6-F1-model_v4 NADH-dependent flavin oxidoreductase yqiG-like protein 1.001 158 253 GO:0005829
GO:0010181
GO:0016491
AF-Q5H1L7-F1-model_v4 GTN reductase 0.9944 1 358 GO:0005829
GO:0010181
GO:0016491
AF-G7UWI1-F1-model_v4 GTN reductase 0.9901 2 358 GO:0005829
GO:0010181
GO:0016491
AF-A0A0C2C0X1-F1-model_v4 N-ethylmaleimide reductase 0.9874 10 358 GO:0005829
GO:0010181
GO:0016491
AF-Q5H1L7-F1-model_v4 GTN reductase 0.9862 1 358 GO:0005829
GO:0010181
GO:0016491

Map