F428357

General Info

Members Datasets Scaffolds Average Seq Length
379 175 758 258

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10101982|Ga0157378_101019822
Length 292
Sequence MWEVMFWPIVACVLLPWLLVYLGLHVVRRGIIFIDIAMAQMASLGICVAVLLHLNLEGWPAFFIALGFTLLGAAIFSVTGKRSSQVPQEAVIGIGYVVAAATAILLLSRAAEGDEEIKNMLVGNILLVSPLDVWKCFALFVLVGAIHFALRHSFLLVSFERDLAYQRGLRVRWWDFLFYALFGLVVTSFVRIAGVLLVFSYLIVPAVCGINLAQSLGKRLLIGWLIALIGGIAGLFLSFECDLPSGAAIVCTFGILLVVIAIAASLRTKPNRSLPDAANATVQFRNARSSQE

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.65
Rhizosphere 92.35
Stem 0
Stem Tuber 0
Unclassified 20.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10101982 3300013297 Bacteria 2621
2 CNXas_1000096 3300000545 Bacteria 16119
3 JGI25406J46586_10000036 3300003203 Bacteria 61720
4 Ga0065712_10001259 3300005290 Bacteria 9087
5 Ga0065712_10086355 3300005290 Bacteria 2640
6 Ga0065715_10001918 3300005293 Bacteria 10389
7 Ga0065715_10115045 3300005293 Bacteria 2402
8 Ga0065707_10035378 3300005295 Bacteria 1976
9 Ga0065707_10235216 3300005295 Unclassified 1174
10 Ga0070676_10005553 3300005328 Bacteria 6713
11 Ga0070676_10021541 3300005328 Bacteria 3609
12 Ga0070676_10031051 3300005328 Bacteria 3050
13 Ga0070676_10052772 3300005328 Bacteria 2392
14 Ga0070683_100007946 3300005329 Bacteria 8997
15 Ga0070690_100006847 3300005330 Bacteria 6486
16 Ga0070690_100157007 3300005330 Bacteria 1556
17 Ga0070670_100003655 3300005331 Bacteria 12816
18 Ga0070670_100673083 3300005331 Unclassified 929
19 Ga0068869_100041317 3300005334 Bacteria 3302
20 Ga0070666_10056268 3300005335 Bacteria 2656
21 Ga0070666_10100709 3300005335 Bacteria 1991
22 Ga0068868_100025868 3300005338 Bacteria 4468
23 Ga0068868_100031529 3300005338 Bacteria 4073
24 Ga0068868_100056697 3300005338 Bacteria 3094
25 Ga0070660_100080577 3300005339 Bacteria 2555
26 Ga0070689_100037363 3300005340 Unclassified 3713
27 Ga0070687_100052541 3300005343 Bacteria 2115
28 Ga0070661_100008829 3300005344 Bacteria 6975
29 Ga0070661_100057237 3300005344 Bacteria 2857
30 Ga0070668_100004068 3300005347 Bacteria 10833
31 Ga0070668_100066173 3300005347 Unclassified 2803
32 Ga0070668_100133868 3300005347 Unclassified 1991
33 Ga0070669_100004940 3300005353 Bacteria 9633
34 Ga0070669_100017840 3300005353 Bacteria 5066
35 Ga0070669_100120840 3300005353 Unclassified 1998
36 Ga0070669_100315600 3300005353 Unclassified 1261
37 Ga0070675_100002009 3300005354 Bacteria 15081
38 Ga0070675_100008471 3300005354 Bacteria 7981
39 Ga0070675_100027779 3300005354 Bacteria 4549
40 Ga0070675_100037590 3300005354 Unclassified 3944
41 Ga0070675_100061874 3300005354 Bacteria 3092
42 Ga0070675_100118695 3300005354 Bacteria 2246
43 Ga0070671_100009641 3300005355 Bacteria 7757
44 Ga0070671_100078561 3300005355 Bacteria 2758
45 Ga0070671_100202257 3300005355 Bacteria 1684
46 Ga0070671_100243818 3300005355 Bacteria 1526
47 Ga0070671_100337405 3300005355 Bacteria 1285
48 Ga0070674_100010304 3300005356 Bacteria 5645
49 Ga0070674_100015647 3300005356 Unclassified 4741
50 Ga0070673_100002715 3300005364 Bacteria 10853
51 Ga0070673_100210379 3300005364 Bacteria 1679
52 Ga0070688_100007229 3300005365 Bacteria 5980
53 Ga0070688_100115272 3300005365 Bacteria 1793
54 Ga0070688_100311560 3300005365 Bacteria 1141
55 Ga0070659_100076459 3300005366 Unclassified 2669
56 Ga0070659_100544362 3300005366 Unclassified 993
57 Ga0070667_100007672 3300005367 Bacteria 8948
58 Ga0070667_100013831 3300005367 Bacteria 6670
59 Ga0070667_100051975 3300005367 Bacteria 3456
60 Ga0070667_100079854 3300005367 Unclassified 2797
61 Ga0070667_100125439 3300005367 Bacteria 2237
62 Ga0070709_10010372 3300005434 Bacteria 5158
63 Ga0070709_10014471 3300005434 Bacteria 4463
64 Ga0070709_10156029 3300005434 Bacteria 1582
65 Ga0070713_100092950 3300005436 Bacteria 2598
66 Ga0070713_100115604 3300005436 Unclassified 2345
67 Ga0070713_100450125 3300005436 Bacteria 1209
68 Ga0070711_100013002 3300005439 Bacteria 5217
69 Ga0070705_100432121 3300005440 Unclassified 983
70 Ga0070694_100146559 3300005444 Bacteria 1720
71 Ga0070708_100024283 3300005445 Bacteria 5168
72 Ga0070708_100034879 3300005445 Bacteria 4380
73 Ga0070708_100230684 3300005445 Bacteria 1737
74 Ga0070708_100295976 3300005445 Bacteria 1524
75 Ga0070708_100443799 3300005445 Unclassified 1224
76 Ga0070708_100500921 3300005445 Unclassified 1146
77 Ga0070678_100014858 3300005456 Bacteria 4927
78 Ga0070678_100018189 3300005456 Bacteria 4551
79 Ga0070678_100125421 3300005456 Bacteria 2032
80 Ga0070678_100399785 3300005456 Unclassified 1193
81 Ga0070662_100140843 3300005457 Unclassified 1869
82 Ga0070662_100341226 3300005457 Bacteria 1226
83 Ga0070681_10017516 3300005458 Bacteria 7160
84 Ga0068867_100392764 3300005459 Unclassified 1168
85 Ga0070685_10020541 3300005466 Bacteria 3575
86 Ga0070706_100000871 3300005467 Bacteria 33201
87 Ga0070706_100038780 3300005467 Bacteria 4397
88 Ga0070706_100140202 3300005467 Bacteria 2257
89 Ga0070706_100276348 3300005467 Bacteria 1567
90 Ga0070707_100000712 3300005468 Bacteria 33201
91 Ga0070707_100026031 3300005468 Bacteria 5552
92 Ga0070707_100051635 3300005468 Bacteria 3941
93 Ga0070707_100062849 3300005468 Bacteria 3562
94 Ga0070707_100063224 3300005468 Unclassified 3552
95 Ga0070707_100118162 3300005468 Bacteria 2574
96 Ga0070707_100230976 3300005468 Bacteria 1801
97 Ga0070698_100001500 3300005471 Bacteria 25924
98 Ga0070698_100180914 3300005471 Bacteria 2047
99 Ga0070698_100531456 3300005471 Bacteria 1115
100 Ga0070698_100586154 3300005471 Unclassified 1055
101 Ga0070699_100115099 3300005518 Unclassified 2363
102 Ga0070699_100131315 3300005518 Bacteria 2208
103 Ga0070699_100172871 3300005518 Bacteria 1915
104 Ga0070699_100190441 3300005518 Bacteria 1822
105 Ga0070679_100006987 3300005530 Bacteria 10536
106 Ga0070684_100004482 3300005535 Bacteria 10634
107 Ga0070697_100001516 3300005536 Bacteria 17645
108 Ga0070697_100014436 3300005536 Bacteria 6203
109 Ga0070697_100432560 3300005536 Bacteria 1145
110 Ga0068853_100000043 3300005539 Bacteria 102800
111 Ga0070672_100001080 3300005543 Bacteria 16605
112 Ga0070672_100209395 3300005543 Unclassified 1633
113 Ga0070672_100255946 3300005543 Bacteria 1475
114 Ga0070695_100225662 3300005545 Bacteria 1352
115 Ga0070665_100013342 3300005548 Bacteria 8269
116 Ga0070665_100154613 3300005548 Bacteria 2296
117 Ga0070665_100515911 3300005548 Bacteria 1207
118 Ga0070704_100072183 3300005549 Bacteria 2510
119 Ga0070704_100212543 3300005549 Bacteria 1568
120 Ga0068855_100293306 3300005563 Bacteria 1803
121 Ga0070664_100145900 3300005564 Unclassified 2087
122 Ga0068856_100078746 3300005614 Bacteria 3268
123 Ga0068860_100038008 3300005843 Bacteria 4606
124 Ga0068862_100142070 3300005844 Bacteria 2131
125 Ga0068862_100187382 3300005844 Unclassified 1860
126 Ga0081540_1029237 3300005983 Bacteria 3075
127 Ga0081539_10000403 3300005985 Bacteria 92820
128 Ga0081539_10001550 3300005985 Bacteria 38292
129 Ga0081539_10018172 3300005985 Bacteria 4893
130 Ga0081539_10045964 3300005985 Bacteria 2505
131 Ga0081539_10073265 3300005985 Unclassified 1827
132 Ga0081539_10108943 3300005985 Bacteria 1398
133 Ga0070717_10004711 3300006028 Bacteria 9908
134 Ga0070717_10030927 3300006028 Bacteria 4303
135 Ga0070717_10130128 3300006028 Bacteria 2164
136 Ga0070717_10186728 3300006028 Bacteria 1809
137 Ga0070712_100019491 3300006175 Bacteria 4425
138 Ga0070712_100069896 3300006175 Bacteria 2506
139 Ga0070712_100088386 3300006175 Bacteria 2264
140 Ga0070712_100098378 3300006175 Bacteria 2158
141 Ga0070712_100110976 3300006175 Bacteria 2046
142 Ga0070712_100260143 3300006175 Unclassified 1390
143 Ga0097621_100013280 3300006237 Bacteria 6133
144 Ga0068871_100026139 3300006358 Bacteria 4552
145 Ga0068865_100352226 3300006881 Unclassified 1193
146 Ga0111539_10082843 3300009094 Bacteria 3773
147 Ga0111539_10092621 3300009094 Bacteria 3551
148 Ga0105245_10024303 3300009098 Bacteria 5319
149 Ga0105245_10186680 3300009098 Bacteria 1984
150 Ga0105245_10226517 3300009098 Bacteria 1806
151 Ga0105241_10051681 3300009174 Bacteria 3135
152 Ga0105242_10004121 3300009176 Bacteria 11310
153 Ga0105242_10290648 3300009176 Bacteria 1488
154 Ga0105237_10155933 3300009545 Bacteria 2280
155 Ga0105237_10359077 3300009545 Bacteria 1461
156 Ga0105249_10181155 3300009553 Bacteria 2050
157 Ga0105249_10555018 3300009553 Bacteria 1200
158 Ga0099796_10006066 3300010159 Bacteria 3071
159 Ga0099796_10028151 3300010159 Bacteria 1801
160 Ga0105246_10717787 3300011119 Unclassified 878
161 Ga0157373_10218666 3300013100 Bacteria 1344
162 Ga0157370_10111992 3300013104 Bacteria 2551
163 Ga0157369_10399384 3300013105 Bacteria 1426
164 Ga0157374_10015646 3300013296 Bacteria 6659
165 Ga0157374_10025209 3300013296 Bacteria 5336
166 Ga0157374_10032184 3300013296 Bacteria 4773
167 Ga0157374_10075312 3300013296 Bacteria 3189
168 Ga0157374_10106214 3300013296 Bacteria 2697
169 Ga0157374_10545155 3300013296 Bacteria 1167
170 Ga0157374_10686120 3300013296 Archaea 1037
171 Ga0157374_10694155 3300013296 Unclassified 1031
172 Ga0157378_10078349 3300013297 Bacteria 2981
173 Ga0157378_10095855 3300013297 Bacteria 2703
174 Ga0157378_10144113 3300013297 Bacteria 2214
175 Ga0157378_10146502 3300013297 Bacteria 2197
176 Ga0157378_10173598 3300013297 Unclassified 2023
177 Ga0157378_10191927 3300013297 Unclassified 1927
178 Ga0157378_10210547 3300013297 Unclassified 1843
179 Ga0157378_10228880 3300013297 Bacteria 1771
180 Ga0157378_10406628 3300013297 Bacteria 1342
181 Ga0157378_10737073 3300013297 Unclassified 1007
182 Ga0163162_10035029 3300013306 Bacteria 4998
183 Ga0163162_10100119 3300013306 Bacteria 2989
184 Ga0163162_10150370 3300013306 Bacteria 2446
185 Ga0163162_10251977 3300013306 Unclassified 1897
186 Ga0163162_10578891 3300013306 Unclassified 1250
187 Ga0157372_10016963 3300013307 Bacteria 7819
188 Ga0157372_10137509 3300013307 Bacteria 2814
189 Ga0157372_10142794 3300013307 Bacteria 2760
190 Ga0157375_10012164 3300013308 Bacteria 7627
191 Ga0157375_10019130 3300013308 Bacteria 6220
192 Ga0157376_10024466 3300014969 Bacteria 4742
193 Ga0157376_10063079 3300014969 Bacteria 3120
194 Ga0157376_10140996 3300014969 Bacteria 2162
195 Ga0157376_10197189 3300014969 Bacteria 1850
196 Ga0182005_1010001 3300015265 Bacteria 2738
197 Ga0163161_10112816 3300017792 Bacteria 2034
198 Ga0207666_1015777 3300025271 Unclassified 1078
199 Ga0207697_10000446 3300025315 Bacteria 23241
200 Ga0207697_10000467 3300025315 Bacteria 22830
201 Ga0207697_10000768 3300025315 Bacteria 18195
202 Ga0207697_10000934 3300025315 Bacteria 16485
203 Ga0207697_10104010 3300025315 Bacteria 1212
204 Ga0207692_10061142 3300025898 Bacteria 1951
205 Ga0207688_10005816 3300025901 Bacteria 6711
206 Ga0207688_10009234 3300025901 Bacteria 5373
207 Ga0207680_10048767 3300025903 Bacteria 2517
208 Ga0207680_10124091 3300025903 Unclassified 1693
209 Ga0207645_10002279 3300025907 Bacteria 15219
210 Ga0207645_10003894 3300025907 Bacteria 11158
211 Ga0207645_10014765 3300025907 Bacteria 5215
212 Ga0207645_10016529 3300025907 Unclassified 4882
213 Ga0207645_10084118 3300025907 Unclassified 2042
214 Ga0207645_10119429 3300025907 Bacteria 1711
215 Ga0207684_10000126 3300025910 Bacteria 140178
216 Ga0207684_10012151 3300025910 Bacteria 7495
217 Ga0207684_10014804 3300025910 Bacteria 6717
218 Ga0207684_10225408 3300025910 Bacteria 1618
219 Ga0207684_10352526 3300025910 Bacteria 1267
220 Ga0207684_10417945 3300025910 Bacteria 1152
221 Ga0207693_10002859 3300025915 Bacteria 14956
222 Ga0207693_10025981 3300025915 Bacteria 4638
223 Ga0207693_10046175 3300025915 Bacteria 3422
224 Ga0207693_10094990 3300025915 Bacteria 2337
225 Ga0207693_10111155 3300025915 Bacteria 2149
226 Ga0207663_10003768 3300025916 Bacteria 7477
227 Ga0207663_10029538 3300025916 Bacteria 3221
228 Ga0207660_10117385 3300025917 Bacteria 2011
229 Ga0207662_10042001 3300025918 Bacteria 2694
230 Ga0207657_10161960 3300025919 Unclassified 1816
231 Ga0207649_10037014 3300025920 Bacteria 2944
232 Ga0207652_10030507 3300025921 Bacteria 4516
233 Ga0207646_10000951 3300025922 Bacteria 37284
234 Ga0207646_10007442 3300025922 Bacteria 11130
235 Ga0207646_10031326 3300025922 Bacteria 4814
236 Ga0207646_10032695 3300025922 Bacteria 4707
237 Ga0207646_10113202 3300025922 Bacteria 2436
238 Ga0207646_10168584 3300025922 Bacteria 1977
239 Ga0207646_10222649 3300025922 Bacteria 1704
240 Ga0207646_10545719 3300025922 Bacteria 1042
241 Ga0207681_10015169 3300025923 Bacteria 4804
242 Ga0207681_10023248 3300025923 Unclassified 3962
243 Ga0207681_10052620 3300025923 Bacteria 2761
244 Ga0207681_10127479 3300025923 Unclassified 1876
245 Ga0207650_10060243 3300025925 Unclassified 2832
246 Ga0207650_10088778 3300025925 Unclassified 2358
247 Ga0207659_10032764 3300025926 Unclassified 3570
248 Ga0207659_10039042 3300025926 Unclassified 3307
249 Ga0207659_10048933 3300025926 Bacteria 2997
250 Ga0207700_10093784 3300025928 Bacteria 2377
251 Ga0207700_10346143 3300025928 Bacteria 1293
252 Ga0207700_10393406 3300025928 Bacteria 1214
253 Ga0207700_10612171 3300025928 Unclassified 970
254 Ga0207664_10070446 3300025929 Bacteria 2814
255 Ga0207644_10010719 3300025931 Bacteria 6044
256 Ga0207644_10028063 3300025931 Bacteria 3892
257 Ga0207644_10279558 3300025931 Bacteria 1340
258 Ga0207706_10051582 3300025933 Bacteria 3632
259 Ga0207706_10115063 3300025933 Unclassified 2365
260 Ga0207706_10160053 3300025933 Bacteria 1979
261 Ga0207706_10215710 3300025933 Unclassified 1681
262 Ga0207686_10006848 3300025934 Bacteria 6138
263 Ga0207686_10191029 3300025934 Bacteria 1460
264 Ga0207669_10035895 3300025937 Unclassified 2826
265 Ga0207704_10014625 3300025938 Bacteria 3969
266 Ga0207665_10246255 3300025939 Bacteria 1319
267 Ga0207691_10000402 3300025940 Bacteria 43303
268 Ga0207691_10024231 3300025940 Bacteria 5707
269 Ga0207691_10024824 3300025940 Bacteria 5634
270 Ga0207661_10028589 3300025944 Bacteria 4271
271 Ga0207679_10089194 3300025945 Unclassified 2380
272 Ga0207651_10025959 3300025960 Unclassified 3650
273 Ga0207651_10229312 3300025960 Bacteria 1506
274 Ga0207712_10083925 3300025961 Bacteria 2326
275 Ga0207668_10035108 3300025972 Bacteria 3335
276 Ga0207668_10062171 3300025972 Unclassified 2628
277 Ga0207658_10014163 3300025986 Bacteria 5461
278 Ga0207658_10030451 3300025986 Bacteria 3821
279 Ga0207658_10049846 3300025986 Bacteria 3078
280 Ga0207658_10163040 3300025986 Bacteria 1829
281 Ga0207677_10009127 3300026023 Bacteria 5568
282 Ga0207677_10040777 3300026023 Bacteria 3064
283 Ga0207639_10000002 3300026041 Bacteria 903066
284 Ga0207702_10111046 3300026078 Unclassified 2437
285 Ga0207675_100293720 3300026118 Bacteria 1581
286 Ga0207683_10006785 3300026121 Bacteria 9801
287 Ga0207683_10093962 3300026121 Unclassified 2672
288 Ga0268266_10004578 3300028379 Bacteria 13207
289 Ga0268266_10078628 3300028379 Unclassified 2870
290 Ga0268266_10112378 3300028379 Bacteria 2415
291 Ga0268266_10533873 3300028379 Bacteria 1123
292 Ga0268266_10678110 3300028379 Bacteria 993
293 Ga0268265_10116043 3300028380 Unclassified 2196
294 Ga0373945_0025821 3300035116 Bacteria 2044
295 Ga0373953_0131457 3300035117 Bacteria 1068
296 Ga0373954_0013555 3300035118 Bacteria 3635
297 Ga0373943_0039415 3300035170 Bacteria 2276
298 Ga0373946_0128014 3300035171 Bacteria 1166
299 Ga0373955_0130284 3300035172 Bacteria 1468
300 Ga0373955_0187535 3300035172 Unclassified 1229
301 Ga0373931_0040201 3300035691 Bacteria 2453
302 Ga0373931_0069646 3300035691 Bacteria 1917
303 Ga0373927_0138509 3300035695 Bacteria 1591
304 Ga0373947_0008572 3300035725 Bacteria 5888
305 Ga0373947_0031693 3300035725 Bacteria 3113
306 Ga0373947_0037887 3300035725 Bacteria 2862
307 Ga0373947_0236744 3300035725 Unclassified 1204
308 Ga0373947_0264480 3300035725 Bacteria 1140
309 Ga0373947_0370731 3300035725 Unclassified 963
310 Ga0373937_0057389 3300036401 Bacteria 3576
311 Ga0373937_0073181 3300036401 Unclassified 3161
312 Ga0373925_0138730 3300037068 Unclassified 1902
313 Ga0451576_0033800 3300045051 Bacteria 5434
314 Ga0451576_0383156 3300045051 Bacteria 1474
315 Ga0495629_0209034 3300046459 Unclassified 1348
316 Ga0495651_0004482 3300046462 Bacteria 10694
317 Ga0495580_0302078 3300046472 Bacteria 1090
318 Ga0495662_0141649 3300046476 Bacteria 1184
319 Ga0495628_0022532 3300046516 Bacteria 5174
320 Ga0495628_0147530 3300046516 Unclassified 1793
321 Ga0495630_0271170 3300046517 Unclassified 1296
322 Ga0495630_0334971 3300046517 Bacteria 1157
323 Ga0495586_0116967 3300046535 Bacteria 1487
324 Ga0495645_0078296 3300046543 Bacteria 2376
325 Ga0495667_0095683 3300046559 Bacteria 1923
326 Ga0495634_0073148 3300046642 Bacteria 2254
327 Ga0495634_0329850 3300046642 Unclassified 917
328 Ga0495635_0061559 3300046663 Bacteria 2578
329 Ga0495659_0054445 3300046664 Bacteria 1464
330 Ga0495599_0002870 3300046678 Bacteria 10040
331 Ga0495623_0007096 3300046679 Bacteria 7282
332 Ga0495646_0031965 3300046680 Bacteria 3277
333 Ga0495647_0175659 3300046681 Unclassified 930
334 Ga0495669_0017960 3300046684 Unclassified 3037
335 Ga0495624_0303242 3300046690 Bacteria 963
336 Ga0495671_0116263 3300046692 Bacteria 1306
337 Ga0495600_0322314 3300046809 Bacteria 972
338 Ga0495581_0049480 3300047315 Bacteria 2427
339 Ga0495604_0185677 3300047317 Unclassified 1452
340 Ga0495676_0253435 3300047321 Unclassified 1200
341 Ga0495675_0066137 3300047444 Bacteria 2285
342 Ga0495675_0103197 3300047444 Bacteria 1783
343 Ga0495684_0056284 3300047471 Unclassified 2998
344 Ga0495684_0115605 3300047471 Unclassified 2023
345 Ga0495602_0102303 3300048088 Bacteria 2348
346 Ga0496100_0014505 3300048903 Bacteria 4576
347 Ga0496100_0139793 3300048903 Unclassified 1715
348 Ga0496101_0019080 3300048904 Bacteria 4674
349 Ga0496101_0328709 3300048904 Bacteria 1200
350 Ga0496102_0095215 3300048905 Bacteria 2759
351 Ga0496102_0115824 3300048905 Bacteria 2501
352 Ga0496103_0046633 3300048906 Bacteria 2676
353 Ga0496106_0018959 3300048909 Bacteria 5097
354 Ga0496107_0004779 3300048910 Bacteria 9203
355 Ga0496107_0302128 3300048910 Unclassified 1191
356 Ga0496108_0093491 3300048911 Bacteria 2558
357 Ga0496108_0242917 3300048911 Bacteria 1566
358 Ga0496109_0061290 3300048912 Bacteria 3439
359 Ga0496109_0078714 3300048912 Unclassified 3036
360 Ga0496110_0410672 3300048913 Bacteria 1234
361 Ga0496112_0008040 3300048915 Bacteria 9412
362 Ga0496112_0061088 3300048915 Unclassified 3714
363 Ga0496112_0101307 3300048915 Bacteria 2850
364 Ga0496112_0421787 3300048915 Unclassified 1273
365 Ga0496112_0641339 3300048915 Bacteria 992
366 Ga0496113_0067176 3300048916 Bacteria 2718
367 Ga0496113_0143967 3300048916 Bacteria 1877
368 Ga0496114_0010253 3300048917 Bacteria 7457
369 Ga0496114_0020891 3300048917 Bacteria 5317
370 Ga0496114_0313554 3300048917 Bacteria 1386
371 Ga0496115_0004168 3300048918 Bacteria 10438
372 Ga0496115_0016393 3300048918 Bacteria 5643
373 Ga0496115_0038806 3300048918 Bacteria 3781
374 Ga0496115_0040800 3300048918 Bacteria 3691
375 nmdc:mga0n895_102019_c1 3300050512 Bacteria 2879
376 nmdc:mga0rr50_383464_c1 3300050513 Bacteria 1185
377 nmdc:mga08x19_7318_c1 3300050514 Bacteria 6557
378 Ga0495601_0002194 3300053077 Bacteria 10989
379 Ga0495619_0150199 3300053085 Unclassified 1607
380 Ga0157378_10101982
381 CNXas_1000096
382 JGI25406J46586_10000036
383 Ga0065712_10001259
384 Ga0065712_10086355
385 Ga0065715_10001918
386 Ga0065715_10115045
387 Ga0065707_10035378
388 Ga0065707_10235216
389 Ga0070676_10005553
390 Ga0070676_10021541
391 Ga0070676_10031051
392 Ga0070676_10052772
393 Ga0070683_100007946
394 Ga0070690_100006847
395 Ga0070690_100157007
396 Ga0070670_100003655
397 Ga0070670_100673083
398 Ga0068869_100041317
399 Ga0070666_10056268
400 Ga0070666_10100709
401 Ga0068868_100025868
402 Ga0068868_100031529
403 Ga0068868_100056697
404 Ga0070660_100080577
405 Ga0070689_100037363
406 Ga0070687_100052541
407 Ga0070661_100008829
408 Ga0070661_100057237
409 Ga0070668_100004068
410 Ga0070668_100066173
411 Ga0070668_100133868
412 Ga0070669_100004940
413 Ga0070669_100017840
414 Ga0070669_100120840
415 Ga0070669_100315600
416 Ga0070675_100002009
417 Ga0070675_100008471
418 Ga0070675_100027779
419 Ga0070675_100037590
420 Ga0070675_100061874
421 Ga0070675_100118695
422 Ga0070671_100009641
423 Ga0070671_100078561
424 Ga0070671_100202257
425 Ga0070671_100243818
426 Ga0070671_100337405
427 Ga0070674_100010304
428 Ga0070674_100015647
429 Ga0070673_100002715
430 Ga0070673_100210379
431 Ga0070688_100007229
432 Ga0070688_100115272
433 Ga0070688_100311560
434 Ga0070659_100076459
435 Ga0070659_100544362
436 Ga0070667_100007672
437 Ga0070667_100013831
438 Ga0070667_100051975
439 Ga0070667_100079854
440 Ga0070667_100125439
441 Ga0070709_10010372
442 Ga0070709_10014471
443 Ga0070709_10156029
444 Ga0070713_100092950
445 Ga0070713_100115604
446 Ga0070713_100450125
447 Ga0070711_100013002
448 Ga0070705_100432121
449 Ga0070694_100146559
450 Ga0070708_100024283
451 Ga0070708_100034879
452 Ga0070708_100230684
453 Ga0070708_100295976
454 Ga0070708_100443799
455 Ga0070708_100500921
456 Ga0070678_100014858
457 Ga0070678_100018189
458 Ga0070678_100125421
459 Ga0070678_100399785
460 Ga0070662_100140843
461 Ga0070662_100341226
462 Ga0070681_10017516
463 Ga0068867_100392764
464 Ga0070685_10020541
465 Ga0070706_100000871
466 Ga0070706_100038780
467 Ga0070706_100140202
468 Ga0070706_100276348
469 Ga0070707_100000712
470 Ga0070707_100026031
471 Ga0070707_100051635
472 Ga0070707_100062849
473 Ga0070707_100063224
474 Ga0070707_100118162
475 Ga0070707_100230976
476 Ga0070698_100001500
477 Ga0070698_100180914
478 Ga0070698_100531456
479 Ga0070698_100586154
480 Ga0070699_100115099
481 Ga0070699_100131315
482 Ga0070699_100172871
483 Ga0070699_100190441
484 Ga0070679_100006987
485 Ga0070684_100004482
486 Ga0070697_100001516
487 Ga0070697_100014436
488 Ga0070697_100432560
489 Ga0068853_100000043
490 Ga0070672_100001080
491 Ga0070672_100209395
492 Ga0070672_100255946
493 Ga0070695_100225662
494 Ga0070665_100013342
495 Ga0070665_100154613
496 Ga0070665_100515911
497 Ga0070704_100072183
498 Ga0070704_100212543
499 Ga0068855_100293306
500 Ga0070664_100145900
501 Ga0068856_100078746
502 Ga0068860_100038008
503 Ga0068862_100142070
504 Ga0068862_100187382
505 Ga0081540_1029237
506 Ga0081539_10000403
507 Ga0081539_10001550
508 Ga0081539_10018172
509 Ga0081539_10045964
510 Ga0081539_10073265
511 Ga0081539_10108943
512 Ga0070717_10004711
513 Ga0070717_10030927
514 Ga0070717_10130128
515 Ga0070717_10186728
516 Ga0070712_100019491
517 Ga0070712_100069896
518 Ga0070712_100088386
519 Ga0070712_100098378
520 Ga0070712_100110976
521 Ga0070712_100260143
522 Ga0097621_100013280
523 Ga0068871_100026139
524 Ga0068865_100352226
525 Ga0111539_10082843
526 Ga0111539_10092621
527 Ga0105245_10024303
528 Ga0105245_10186680
529 Ga0105245_10226517
530 Ga0105241_10051681
531 Ga0105242_10004121
532 Ga0105242_10290648
533 Ga0105237_10155933
534 Ga0105237_10359077
535 Ga0105249_10181155
536 Ga0105249_10555018
537 Ga0099796_10006066
538 Ga0099796_10028151
539 Ga0105246_10717787
540 Ga0157373_10218666
541 Ga0157370_10111992
542 Ga0157369_10399384
543 Ga0157374_10015646
544 Ga0157374_10025209
545 Ga0157374_10032184
546 Ga0157374_10075312
547 Ga0157374_10106214
548 Ga0157374_10545155
549 Ga0157374_10686120
550 Ga0157374_10694155
551 Ga0157378_10078349
552 Ga0157378_10095855
553 Ga0157378_10144113
554 Ga0157378_10146502
555 Ga0157378_10173598
556 Ga0157378_10191927
557 Ga0157378_10210547
558 Ga0157378_10228880
559 Ga0157378_10406628
560 Ga0157378_10737073
561 Ga0163162_10035029
562 Ga0163162_10100119
563 Ga0163162_10150370
564 Ga0163162_10251977
565 Ga0163162_10578891
566 Ga0157372_10016963
567 Ga0157372_10137509
568 Ga0157372_10142794
569 Ga0157375_10012164
570 Ga0157375_10019130
571 Ga0157376_10024466
572 Ga0157376_10063079
573 Ga0157376_10140996
574 Ga0157376_10197189
575 Ga0182005_1010001
576 Ga0163161_10112816
577 Ga0207666_1015777
578 Ga0207697_10000446
579 Ga0207697_10000467
580 Ga0207697_10000768
581 Ga0207697_10000934
582 Ga0207697_10104010
583 Ga0207692_10061142
584 Ga0207688_10005816
585 Ga0207688_10009234
586 Ga0207680_10048767
587 Ga0207680_10124091
588 Ga0207645_10002279
589 Ga0207645_10003894
590 Ga0207645_10014765
591 Ga0207645_10016529
592 Ga0207645_10084118
593 Ga0207645_10119429
594 Ga0207684_10000126
595 Ga0207684_10012151
596 Ga0207684_10014804
597 Ga0207684_10225408
598 Ga0207684_10352526
599 Ga0207684_10417945
600 Ga0207693_10002859
601 Ga0207693_10025981
602 Ga0207693_10046175
603 Ga0207693_10094990
604 Ga0207693_10111155
605 Ga0207663_10003768
606 Ga0207663_10029538
607 Ga0207660_10117385
608 Ga0207662_10042001
609 Ga0207657_10161960
610 Ga0207649_10037014
611 Ga0207652_10030507
612 Ga0207646_10000951
613 Ga0207646_10007442
614 Ga0207646_10031326
615 Ga0207646_10032695
616 Ga0207646_10113202
617 Ga0207646_10168584
618 Ga0207646_10222649
619 Ga0207646_10545719
620 Ga0207681_10015169
621 Ga0207681_10023248
622 Ga0207681_10052620
623 Ga0207681_10127479
624 Ga0207650_10060243
625 Ga0207650_10088778
626 Ga0207659_10032764
627 Ga0207659_10039042
628 Ga0207659_10048933
629 Ga0207700_10093784
630 Ga0207700_10346143
631 Ga0207700_10393406
632 Ga0207700_10612171
633 Ga0207664_10070446
634 Ga0207644_10010719
635 Ga0207644_10028063
636 Ga0207644_10279558
637 Ga0207706_10051582
638 Ga0207706_10115063
639 Ga0207706_10160053
640 Ga0207706_10215710
641 Ga0207686_10006848
642 Ga0207686_10191029
643 Ga0207669_10035895
644 Ga0207704_10014625
645 Ga0207665_10246255
646 Ga0207691_10000402
647 Ga0207691_10024231
648 Ga0207691_10024824
649 Ga0207661_10028589
650 Ga0207679_10089194
651 Ga0207651_10025959
652 Ga0207651_10229312
653 Ga0207712_10083925
654 Ga0207668_10035108
655 Ga0207668_10062171
656 Ga0207658_10014163
657 Ga0207658_10030451
658 Ga0207658_10049846
659 Ga0207658_10163040
660 Ga0207677_10009127
661 Ga0207677_10040777
662 Ga0207639_10000002
663 Ga0207702_10111046
664 Ga0207675_100293720
665 Ga0207683_10006785
666 Ga0207683_10093962
667 Ga0268266_10004578
668 Ga0268266_10078628
669 Ga0268266_10112378
670 Ga0268266_10533873
671 Ga0268266_10678110
672 Ga0268265_10116043
673 Ga0373945_0025821
674 Ga0373953_0131457
675 Ga0373954_0013555
676 Ga0373943_0039415
677 Ga0373946_0128014
678 Ga0373955_0130284
679 Ga0373955_0187535
680 Ga0373931_0040201
681 Ga0373931_0069646
682 Ga0373927_0138509
683 Ga0373947_0008572
684 Ga0373947_0031693
685 Ga0373947_0037887
686 Ga0373947_0236744
687 Ga0373947_0264480
688 Ga0373947_0370731
689 Ga0373937_0057389
690 Ga0373937_0073181
691 Ga0373925_0138730
692 Ga0451576_0033800
693 Ga0451576_0383156
694 Ga0495629_0209034
695 Ga0495651_0004482
696 Ga0495580_0302078
697 Ga0495662_0141649
698 Ga0495628_0022532
699 Ga0495628_0147530
700 Ga0495630_0271170
701 Ga0495630_0334971
702 Ga0495586_0116967
703 Ga0495645_0078296
704 Ga0495667_0095683
705 Ga0495634_0073148
706 Ga0495634_0329850
707 Ga0495635_0061559
708 Ga0495659_0054445
709 Ga0495599_0002870
710 Ga0495623_0007096
711 Ga0495646_0031965
712 Ga0495647_0175659
713 Ga0495669_0017960
714 Ga0495624_0303242
715 Ga0495671_0116263
716 Ga0495600_0322314
717 Ga0495581_0049480
718 Ga0495604_0185677
719 Ga0495676_0253435
720 Ga0495675_0066137
721 Ga0495675_0103197
722 Ga0495684_0056284
723 Ga0495684_0115605
724 Ga0495602_0102303
725 Ga0496100_0014505
726 Ga0496100_0139793
727 Ga0496101_0019080
728 Ga0496101_0328709
729 Ga0496102_0095215
730 Ga0496102_0115824
731 Ga0496103_0046633
732 Ga0496106_0018959
733 Ga0496107_0004779
734 Ga0496107_0302128
735 Ga0496108_0093491
736 Ga0496108_0242917
737 Ga0496109_0061290
738 Ga0496109_0078714
739 Ga0496110_0410672
740 Ga0496112_0008040
741 Ga0496112_0061088
742 Ga0496112_0101307
743 Ga0496112_0421787
744 Ga0496112_0641339
745 Ga0496113_0067176
746 Ga0496113_0143967
747 Ga0496114_0010253
748 Ga0496114_0020891
749 Ga0496114_0313554
750 Ga0496115_0004168
751 Ga0496115_0016393
752 Ga0496115_0038806
753 Ga0496115_0040800
754 nmdc:mga0n895_102019_c1
755 nmdc:mga0rr50_383464_c1
756 nmdc:mga08x19_7318_c1
757 Ga0495601_0002194
758 Ga0495619_0150199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00950

ABC-3

ABC 3 transport family

1

264

0.95

PF01032

FecCD

FecCD transport family

36

263

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5595 3 246
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5565 4 251
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5426 4 251
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5384 3 246
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5048 4 250
ID Description Score Start End Superfamily
af_Q2G2D9_6_271_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5971 3 246 1.10.3470.10
af_P39832_7_260_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5855 4 244 1.10.3470.10
af_Q2G2D9_6_271_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5738 3 246 1.10.3470.10
af_Q2FY18_5_276_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5327 1 249 1.10.3470.10
af_Q2FY18_5_276_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5226 1 249 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2V6GSS5-F1-model_v4 Metal ABC transporter permease 0.6776 1 227 GO:0010043
GO:0043190
GO:0055085
AF-A0A842PWD7-F1-model_v4 deleted 0.6629 1 211
AF-A0A2V6RPT7-F1-model_v4 Sulfite oxidase 0.6478 2 245 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043190
GO:0043546
GO:0055085
AF-A0A2V6DTE5-F1-model_v4 Metal ABC transporter permease 0.6442 1 248 GO:0010043
GO:0043190
GO:0055085
AF-A0A2V7WA12-F1-model_v4 Metal ABC transporter permease 0.6437 2 249 GO:0010043
GO:0043190
GO:0055085

Map