F428370

General Info

Members Datasets Scaffolds Average Seq Length
379 234 758 326

Family's Representative Sequence

Representative Sequence 3300025711|Ga0207696_1000174|Ga0207696_100017488
Length 379
Sequence MTATTWYCCQHCIMQKSKVHAVLGHCLICGRPSFHVFCFHRKINEITHKKSINMQPFAQLQRRRDRYWLGTLSLLLLVMLVISLCAGEQWIAPGDWFSARGDLFVWQIRFPRTLAVLLVGAALALSGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWALGLCAIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSFDLRQLMYWMMGGFGGVDWHQAWLMVALIPVLVWICCQSQPMNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGAIVLLLADVVARLVLASAELPIGVVTATMGAPVFIWLLLKAAR

Samples

Sample ID Description Type Environment
1 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
37 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
38 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
39 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
60 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
63 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
66 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
70 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
75 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
80 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
87 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
107 2506520008 Serratia plymuthica AS12 Isolate Unclassified
108 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
109 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
110 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
111 2547132181 Kosakonia sacchari SP1 Isolate Stem
112 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
113 2561511199 Enterobacter sp. R4-368 Isolate Nodule
114 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
115 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
116 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
117 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
118 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
119 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
120 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
121 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
122 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
123 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
124 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
125 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
126 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
127 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
128 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
129 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
130 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
131 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
132 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
133 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
134 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
135 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
136 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
137 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
138 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
139 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
140 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
141 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
142 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
143 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
144 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
145 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
146 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
147 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
148 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
149 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
150 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
151 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
152 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
153 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
154 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
155 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
156 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
157 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
158 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
159 2636415599 Klebsiella variicola DX120E Isolate Unclassified
160 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
161 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
162 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
163 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
164 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
165 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
166 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
167 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
168 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
169 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
170 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
171 2751185917 Enterobacter sp. HK169 Isolate Unclassified
172 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
173 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
174 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
175 2775507074 Klebsiella sp. D5A Isolate Unclassified
176 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
177 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
178 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
179 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
180 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
181 2821118458 Enterobacter asburiae 609 Isolate Unclassified
182 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
183 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
184 2847085930 Erwinia persicina B64 Isolate Bulb
185 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
186 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
187 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
188 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
189 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
190 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
191 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
192 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
193 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
194 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
195 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
196 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
197 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
198 2904504865 Serratia marcescens 1822 Isolate Unclassified
199 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
200 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
201 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
202 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
203 2919150387 Rahnella aceris 1817 Isolate Unclassified
204 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
205 2927143783 Rahnella sp. 2050 Isolate Unclassified
206 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
207 2932406140 Serratia sp. 2723 Isolate Rhizosphere
208 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
209 2937539931 Pantoea sp. LS15 Isolate Unclassified
210 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
211 2937967321 Serratia sp. YC16 Isolate Unclassified
212 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
213 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
214 2939577877 Serratia sp. 509 Isolate Rhizosphere
215 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
216 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
217 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
218 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
219 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
220 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
221 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
222 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
223 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
224 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
225 640753048 Serratia proteamaculans 568 Isolate Endosphere
226 8004592986 Serratia sp. S119 Isolate Unclassified
227 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
228 8018221730 Enterobacter sp. CM29 Isolate Unclassified
229 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
230 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
231 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
232 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
233 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
234 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.96
Metatranscriptomes 0
Isolates 34.04

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0.26
Endosphere 6.6
Nodule 4.75
Rhizoplane 14.51
Rhizosphere 43.8
Stem 0.26
Stem Tuber 1.58
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207696_1000174 3300025711 Bacteria 102229
2 SwRhRL2b_contig_189349 2162886007 Bacteria 1587
3 SwRhRL2b_contig_1916863 2162886007 Bacteria 1513
4 SwRhRL2b_contig_2178407 2162886007 Bacteria 7337
5 SwRhRL2b_contig_2767777 2162886007 Bacteria 1846
6 JGI25162J39368_1000112 3300002737 Bacteria 89231
7 JGI25163J39215_1000031 3300002771 Bacteria 65095
8 JGI25163J39215_1000055 3300002771 Bacteria 51174
9 JGI25164J39214_1000094 3300002772 Bacteria 89231
10 JGI25152J39213_1000184 3300002773 Bacteria 41863
11 Ga0055538_1000076 3300003751 Bacteria 89231
12 Ga0055539_1000115 3300003752 Bacteria 89231
13 Ga0055533_1000121 3300003756 Bacteria 89231
14 Ga0055525_1000159 3300003759 Bacteria 89231
15 Ga0055526_1001308 3300003771 Bacteria 17845
16 Ga0055536_1000293 3300003781 Bacteria 37589
17 Ga0055541_1000077 3300003841 Bacteria 89231
18 Ga0058692_1001697 3300003856 Bacteria 7892
19 Ga0058692_1001833 3300003856 Bacteria 7476
20 Ga0058692_1016082 3300003856 Bacteria 1672
21 Ga0058692_1017727 3300003856 Bacteria 1556
22 Ga0065704_10000270 3300005289 Bacteria 61602
23 Ga0065704_10070699 3300005289 Bacteria 17430
24 Ga0070658_10206388 3300005327 Bacteria 1659
25 Ga0070687_100000792 3300005343 Bacteria 10508
26 Ga0070685_10009845 3300005466 Bacteria 4957
27 Ga0070665_100000406 3300005548 Bacteria 63162
28 Ga0068857_100009182 3300005577 Bacteria 8584
29 Ga0081455_10236258 3300005937 Bacteria 1346
30 Ga0079104_1000236 3300006946 Bacteria 73974
31 Ga0079104_1000535 3300006946 Bacteria 40052
32 Ga0079104_1000611 3300006946 Bacteria 35208
33 Ga0079104_1000934 3300006946 Bacteria 23291
34 Ga0079104_1001318 3300006946 Bacteria 17033
35 Ga0079104_1001694 3300006946 Bacteria 14105
36 Ga0079104_1002218 3300006946 Bacteria 10904
37 Ga0079104_1006731 3300006946 Bacteria 4283
38 Ga0105251_10000752 3300009011 Bacteria 29611
39 Ga0105251_10000949 3300009011 Bacteria 25869
40 Ga0105251_10003041 3300009011 Bacteria 12492
41 Ga0105251_10003377 3300009011 Bacteria 11615
42 Ga0105251_10072016 3300009011 Bacteria 1607
43 Ga0105244_10000104 3300009036 Bacteria 86815
44 Ga0105244_10000222 3300009036 Bacteria 58959
45 Ga0105244_10000330 3300009036 Bacteria 44986
46 Ga0105244_10000354 3300009036 Bacteria 42971
47 Ga0105244_10000586 3300009036 Bacteria 32689
48 Ga0105244_10006208 3300009036 Bacteria 7793
49 Ga0105244_10024671 3300009036 Bacteria 3279
50 Ga0105250_10000001 3300009092 Bacteria 617357
51 Ga0105250_10000195 3300009092 Bacteria 51515
52 Ga0105250_10000253 3300009092 Bacteria 44276
53 Ga0105250_10000448 3300009092 Bacteria 29733
54 Ga0105250_10001017 3300009092 Bacteria 16213
55 Ga0105250_10069458 3300009092 Bacteria 1422
56 Ga0105240_10659519 3300009093 Bacteria 1146
57 Ga0105247_10000138 3300009101 Bacteria 70791
58 Ga0105241_10000002 3300009174 Bacteria 869480
59 Ga0157373_10129033 3300013100 Bacteria 1778
60 Ga0157371_10000099 3300013102 Bacteria 133829
61 Ga0157370_10000234 3300013104 Bacteria 70723
62 Ga0157370_10004253 3300013104 Bacteria 16534
63 Ga0157369_10001590 3300013105 Bacteria 27841
64 Ga0163162_10028448 3300013306 Bacteria 5531
65 Ga0182008_10000780 3300014497 Bacteria 22286
66 Ga0182006_1000047 3300015261 Bacteria 187006
67 Ga0183366_1001 3300015679 Bacteria 2743932
68 Ga0183370_1001 3300015680 Bacteria 2743932
69 Ga0183369_1001 3300015685 Bacteria 2743932
70 Ga0183368_1001 3300015687 Bacteria 2743932
71 Ga0163161_10000001 3300017792 Bacteria 2041488
72 Ga0213876_10000478 3300021384 Bacteria 31715
73 Ga0209760_100104 3300025207 Bacteria 65129
74 Ga0209784_100001 3300025224 Bacteria 3600592
75 Ga0209566_100001 3300025225 Bacteria 3600765
76 Ga0209674_100002 3300025226 Bacteria 3600592
77 Ga0209563_100008 3300025230 Bacteria 1554545
78 Ga0207427_100135 3300025231 Bacteria 89851
79 Ga0209437_100007 3300025233 Bacteria 938377
80 Ga0209677_100004 3300025253 Bacteria 1554545
81 Ga0209129_1000004 3300025258 Bacteria 884499
82 Ga0209233_1001611 3300025261 Bacteria 8795
83 Ga0209257_1010543 3300025304 Bacteria 4651
84 Ga0207696_1000001 3300025711 Bacteria 2579611
85 Ga0207696_1000028 3300025711 Bacteria 400424
86 Ga0207696_1000116 3300025711 Bacteria 148125
87 Ga0207696_1000235 3300025711 Bacteria 77526
88 Ga0207696_1003897 3300025711 Bacteria 6592
89 Ga0207696_1007225 3300025711 Bacteria 4368
90 Ga0207696_1012343 3300025711 Bacteria 3025
91 Ga0207655_1000001 3300025728 Bacteria 1866413
92 Ga0207655_1000004 3300025728 Bacteria 1021221
93 Ga0207655_1000037 3300025728 Bacteria 354473
94 Ga0207655_1000158 3300025728 Bacteria 124597
95 Ga0207655_1000227 3300025728 Bacteria 94083
96 Ga0207655_1000426 3300025728 Bacteria 56714
97 Ga0207655_1000647 3300025728 Bacteria 41615
98 Ga0207655_1057677 3300025728 Bacteria 1523
99 Ga0207713_1000003 3300025735 Bacteria 860698
100 Ga0207713_1000099 3300025735 Bacteria 141843
101 Ga0207713_1000944 3300025735 Bacteria 26119
102 Ga0207713_1014116 3300025735 Bacteria 4169
103 Ga0207713_1029251 3300025735 Bacteria 2471
104 Ga0207713_1072864 3300025735 Bacteria 1263
105 Ga0207710_10000052 3300025900 Bacteria 181113
106 Ga0207654_10000005 3300025911 Bacteria 869492
107 Ga0207662_10089398 3300025918 Bacteria 1892
108 Ga0207709_10012478 3300025935 Bacteria 4679
109 Ga0209281_1000001 3300027111 Bacteria 1933496
110 Ga0209281_1000003 3300027111 Bacteria 1260089
111 Ga0209281_1000130 3300027111 Bacteria 191756
112 Ga0209281_1000274 3300027111 Bacteria 98823
113 Ga0209281_1000428 3300027111 Bacteria 62540
114 Ga0209281_1000984 3300027111 Bacteria 22723
115 Ga0209281_1001331 3300027111 Bacteria 15554
116 Ga0209281_1001414 3300027111 Bacteria 14415
117 Ga0209281_1001710 3300027111 Bacteria 11356
118 Ga0209371_1000002 3300027312 Bacteria 1551985
119 Ga0209371_1000041 3300027312 Bacteria 340377
120 Ga0209371_1001119 3300027312 Bacteria 19769
121 Ga0209371_1004054 3300027312 Bacteria 6619
122 Ga0209371_1006331 3300027312 Bacteria 4410
123 Ga0209371_1007954 3300027312 Bacteria 3598
124 Ga0209371_1012525 3300027312 Bacteria 2445
125 Ga0209371_1014234 3300027312 Bacteria 2190
126 Ga0209371_1023710 3300027312 Bacteria 1441
127 Ga0268266_10000435 3300028379 Bacteria 62710
128 Ga0268256_1000002 3300030500 Bacteria 1535763
129 Ga0268256_1000003 3300030500 Bacteria 1289401
130 Ga0268256_1000951 3300030500 Bacteria 19769
131 Ga0268256_1002114 3300030500 Bacteria 10625
132 Ga0268256_1006365 3300030500 Bacteria 4410
133 Ga0268256_1006724 3300030500 Bacteria 4225
134 Ga0268256_1008244 3300030500 Bacteria 3598
135 Ga0268256_1013670 3300030500 Bacteria 2445
136 Ga0268256_1015431 3300030500 Bacteria 2229
137 Ga0268256_1026717 3300030500 Bacteria 1447
138 Ga0316583_10010908 3300032133 Bacteria 3273
139 Ga0436365_0971002 3300039437 Bacteria 167792
140 Ga0439466_0042730 3300041411 Bacteria 1508
141 Ga0439452_000002 3300042010 Bacteria 1377577
142 Ga0439452_000008 3300042010 Bacteria 569877
143 Ga0439452_000747 3300042010 Bacteria 15584
144 Ga0466969_0009969 3300044656 Bacteria 5038
145 Ga0466972_0005265 3300044658 Bacteria 6477
146 Ga0466977_0001934 3300044666 Bacteria 9092
147 Ga0466981_0000002 3300044669 Bacteria 313036
148 Ga0466970_0003758 3300044765 Bacteria 7426
149 Ga0466960_0000278 3300044901 Bacteria 17801
150 Ga0466967_0392910 3300045976 Bacteria 1348
151 Ga0495627_000288 3300046453 Bacteria 50656
152 Ga0495627_025793 3300046453 Bacteria 1903
153 Ga0495591_000252 3300046458 Bacteria 51368
154 Ga0495591_004005 3300046458 Bacteria 7371
155 Ga0495638_0002306 3300046460 Bacteria 15715
156 Ga0495650_0000090 3300046471 Bacteria 232897
157 Ga0495650_0004919 3300046471 Bacteria 8923
158 Ga0495620_0000156 3300046515 Bacteria 55826
159 Ga0495654_0000921 3300046530 Bacteria 21862
160 Ga0495654_0016335 3300046530 Bacteria 3927
161 Ga0495654_0026610 3300046530 Bacteria 2972
162 Ga0495597_0000173 3300046542 Bacteria 57481
163 Ga0495625_0009054 3300046660 Bacteria 8404
164 Ga0495649_0014063 3300046694 Bacteria 4597
165 Ga0495589_0000004 3300046794 Bacteria 439891
166 Ga0495660_0000028 3300046810 Bacteria 244534
167 Ga0495672_0000020 3300047320 Bacteria 432845
168 Ga0495679_000282 3300047446 Bacteria 42194
169 Ga0495673_0000065 3300047469 Bacteria 222481
170 Ga0496100_0197032 3300048903 Bacteria 1465
171 Ga0496104_0000449 3300048907 Bacteria 35646
172 Ga0496104_0016270 3300048907 Bacteria 6752
173 Ga0496104_0016572 3300048907 Bacteria 6696
174 Ga0496104_0442527 3300048907 Bacteria 1211
175 Ga0496105_0242989 3300048908 Bacteria 1460
176 Ga0496116_0000001 3300048919 Bacteria 1501681
177 Ga0496116_0000277 3300048919 Bacteria 89271
178 Ga0496116_0027716 3300048919 Bacteria 4117
179 Ga0496116_0033550 3300048919 Bacteria 3642
180 Ga0496116_0053499 3300048919 Bacteria 2665
181 Ga0496116_0060050 3300048919 Bacteria 2468
182 Ga0496116_0076527 3300048919 Bacteria 2095
183 Ga0496117_0000399 3300048920 Bacteria 74064
184 Ga0496117_0001622 3300048920 Bacteria 31785
185 Ga0496117_0001848 3300048920 Bacteria 28561
186 Ga0496117_0015764 3300048920 Bacteria 6417
187 Ga0496117_0062126 3300048920 Bacteria 2561
188 Ga0496117_0092910 3300048920 Bacteria 1936
189 Ga0496118_0000015 3300048921 Bacteria 551359
190 Ga0496118_0001126 3300048921 Bacteria 41304
191 Ga0496118_0002147 3300048921 Bacteria 27516
192 Ga0496118_0011055 3300048921 Bacteria 8859
193 Ga0496118_0015410 3300048921 Bacteria 7077
194 Ga0496118_0119961 3300048921 Bacteria 1717
195 Ga0496119_0000066 3300048922 Bacteria 162680
196 Ga0496119_0000841 3300048922 Bacteria 40637
197 Ga0496119_0001692 3300048922 Bacteria 25772
198 Ga0496119_0002928 3300048922 Bacteria 18183
199 Ga0496119_0003785 3300048922 Bacteria 15466
200 Ga0496119_0010583 3300048922 Bacteria 7739
201 Ga0496119_0024633 3300048922 Bacteria 4227
202 Ga0496119_0036768 3300048922 Bacteria 3190
203 Ga0496119_0040220 3300048922 Bacteria 2993
204 Ga0496120_0002001 3300048923 Bacteria 22163
205 Ga0496120_0002009 3300048923 Bacteria 22127
206 Ga0496120_0003248 3300048923 Bacteria 15042
207 Ga0496120_0004555 3300048923 Bacteria 11550
208 Ga0496120_0009799 3300048923 Bacteria 6753
209 Ga0496120_0028808 3300048923 Bacteria 3398
210 Ga0496120_0037754 3300048923 Bacteria 2864
211 Ga0496120_0041324 3300048923 Bacteria 2703
212 Ga0496120_0111642 3300048923 Bacteria 1427
213 Ga0496121_0004213 3300048924 Bacteria 19602
214 Ga0496121_0004271 3300048924 Bacteria 19402
215 Ga0496121_0055778 3300048924 Bacteria 3288
216 Ga0496121_0140521 3300048924 Bacteria 1792
217 Ga0496122_0000058 3300048925 Bacteria 248805
218 Ga0496122_0000738 3300048925 Bacteria 63772
219 Ga0496122_0001008 3300048925 Bacteria 49888
220 Ga0496122_0012260 3300048925 Bacteria 8567
221 Ga0496122_0056121 3300048925 Bacteria 2939
222 Ga0496123_0000044 3300048926 Bacteria 253396
223 Ga0496123_0000821 3300048926 Bacteria 49888
224 Ga0496123_0001322 3300048926 Bacteria 35015
225 Ga0496123_0002646 3300048926 Bacteria 21667
226 Ga0496123_0006680 3300048926 Bacteria 11118
227 Ga0496123_0019875 3300048926 Bacteria 5272
228 Ga0496123_0074374 3300048926 Bacteria 2103
229 Ga0496123_0127129 3300048926 Bacteria 1420
230 Ga0496124_0000105 3300048927 Bacteria 176783
231 Ga0496124_0000196 3300048927 Bacteria 119375
232 Ga0496124_0000564 3300048927 Bacteria 62677
233 Ga0496124_0001459 3300048927 Bacteria 34893
234 Ga0496124_0065373 3300048927 Bacteria 3033
235 Ga0496124_0101594 3300048927 Bacteria 2329
236 Ga0496125_0000009 3300048928 Bacteria 677678
237 Ga0496125_0000103 3300048928 Bacteria 201675
238 Ga0496125_0218703 3300048928 Bacteria 1229
239 Ga0496125_0232319 3300048928 Bacteria 1178
240 Ga0496126_0000399 3300048929 Bacteria 89026
241 Ga0496126_0003414 3300048929 Bacteria 20080
242 Ga0496126_0010320 3300048929 Bacteria 9804
243 Ga0496126_0029469 3300048929 Bacteria 5214
244 Ga0496126_0075270 3300048929 Bacteria 2996
245 Ga0496126_0138637 3300048929 Bacteria 2095
246 Ga0496126_0366584 3300048929 Bacteria 1175
247 Ga0501037_0193200 3300049573 Bacteria 1441
248 Ga0501043_0027014 3300049579 Bacteria 4505
249 Ga0501035_0144716 3300049822 Bacteria 2065
250 nmdc:mga00v17_763_c1 3300050491 Bacteria 17475
251 2506578160 2506520007 Bacteria 5442880
252 2506583298 2506520008 Bacteria 5443009
253 2508852174 2508501071 Bacteria 5454741
254 2526062403 2524614857 Bacteria 4146328
255 2538425798 2537561728 Bacteria 5149301
256 2547695147 2547132181 Bacteria 4945084
257 2555257402 2554235234 Bacteria 5762085
258 2562462989 2561511199 Bacteria 5155034
259 2585825418 2585427591 Bacteria 5482980
260 2585832100 2585427592 Bacteria 5370892
261 2599408890 2599185169 Bacteria 5441380
262 2601522594 2600255254 Bacteria 5281859
263 2601527621 2600255255 Bacteria 5282785
264 2601535241 2600255256 Bacteria 5597742
265 2601540804 2600255257 Bacteria 5597196
266 2601614452 2600255280 Bacteria 5292309
267 2601619172 2600255281 Bacteria 5288753
268 2601642215 2600255287 Bacteria 5210468
269 2601647070 2600255288 Bacteria 5282738
270 2601652599 2600255289 Bacteria 5281907
271 2601657925 2600255290 Bacteria 5282218
272 2601662038 2600255291 Bacteria 5217298
273 2601694996 2600255298 Bacteria 5215185
274 2601699668 2600255299 Bacteria 5218662
275 2601706444 2600255300 Bacteria 5287774
276 2601710750 2600255301 Bacteria 5280532
277 2601715764 2600255302 Bacteria 5288235
278 2601720019 2600255303 Bacteria 5219315
279 2601726170 2600255304 Bacteria 5283973
280 2601730711 2600255305 Bacteria 5282329
281 2601735727 2600255306 Bacteria 5281613
282 2601740994 2600255307 Bacteria 5439064
283 2601750924 2600255309 Bacteria 5431045
284 2601758423 2600255310 Bacteria 5600903
285 2601764532 2600255311 Bacteria 5598766
286 2602018178 2600255392 Bacteria 5437392
287 2603638218 2602042046 Bacteria 5483348
288 2603659400 2602042052 Bacteria 5215873
289 2603664675 2602042053 Bacteria 5214361
290 2603698223 2602042066 Bacteria 4423871
291 2603703339 2602042067 Bacteria 4863713
292 2603838104 2602042103 Bacteria 5284714
293 2603843182 2602042104 Bacteria 5281639
294 2603848255 2602042105 Bacteria 5282303
295 2603853330 2602042106 Bacteria 5282744
296 2603867256 2602042109 Bacteria 5152801
297 2603871381 2602042110 Bacteria 5283285
298 2603876304 2602042111 Bacteria 5212080
299 2606048573 2603880178 Bacteria 5283018
300 2606069102 2603880184 Bacteria 5217896
301 2606144916 2603880202 Bacteria 5284684
302 2606175975 2603880211 Bacteria 5284226
303 2609913501 2609459761 Bacteria 5513740
304 2637224697 2636415599 Bacteria 5718434
305 2656277524 2654587920 Bacteria 5475511
306 2671109795 2667528173 Bacteria 5375747
307 2671588285 2671180115 Bacteria 5353919
308 2676406030 2675903046 Bacteria 5451247
309 2681997597 2681812866 Bacteria 4552357
310 2682006891 2681812869 Bacteria 5014465
311 2689444694 2687453601 Bacteria 5546041
312 2707098540 2706794495 Bacteria 4536932
313 2712469841 2711768156 Bacteria 4471618
314 2739206358 2738543005 Bacteria 5278128
315 2740063751 2739367875 Bacteria 4157290
316 2753855676 2751185917 Bacteria 4551186
317 2765588660 2765235842 Bacteria 4799256
318 2772438763 2772190666 Bacteria 5117644
319 2775538664 2775506706 Bacteria 4873073
320 2777022209 2775507074 Bacteria 5532402
321 2792311346 2791355010 Bacteria 4864581
322 2793405769 2791355275 Bacteria 4429597
323 2807179412 2806310673 Bacteria 4801221
324 2813729252 2811995292 Bacteria 5303342
325 2814696761 2814123068 Bacteria 5687681
326 2821119479 2821118458 Bacteria 4714306
327 2823374447 2823373977 Bacteria 4779415
328 2846544362 2846540461 Bacteria 5471451
329 2847087832 2847085930 Bacteria 5070450
330 2852107806 2852103415 Bacteria 5193810
331 2854604425 2854601825 Bacteria 4797592
332 2855198101 2855195626 Bacteria 4927512
333 2858468968 2858466076 Bacteria 4722413
334 2869554090 2869551831 Bacteria 5474685
335 2871272778 2871272651 Bacteria 5042015
336 2871286351 2871282230 Bacteria 4917173
337 2884088609 2884086401 Bacteria 5005459
338 2888368784 2888366609 Bacteria 5155009
339 2888378546 2888373701 Bacteria 5098052
340 2891672888 2891670763 Bacteria 4967099
341 2900052720 2900051742 Bacteria 4985156
342 2904478208 2904474040 Bacteria 5504324
343 2904505016 2904504865 Bacteria 5152820
344 2904514345 2904513164 Bacteria 5476410
345 2915361899 2915358134 Bacteria 6050864
346 2916179515 2916178963 Bacteria 5265078
347 2919108598 2919108558 Bacteria 5897419
348 2919155274 2919150387 Bacteria 5500879
349 2923634540 2923634449 Bacteria 4753480
350 2927147952 2927143783 Bacteria 5504251
351 2927834403 2927833300 Bacteria 4923934
352 2932408232 2932406140 Bacteria 5134491
353 2935626922 2935625433 Bacteria 5042964
354 2937540252 2937539931 Bacteria 4639830
355 2937844415 2937843397 Bacteria 5256375
356 2937967376 2937967321 Bacteria 5094075
357 2939568877 2939568625 Bacteria 4542555
358 2939573875 2939573065 Bacteria 4926053
359 2939578689 2939577877 Bacteria 5132791
360 2939619334 2939617950 Bacteria 4820956
361 2939644077 2939642701 Bacteria 4475280
362 2945877438 2945874760 Bacteria 5527237
363 2969081747 2969079654 Bacteria 5439582
364 2971823166 2971820967 Bacteria 5823634
365 2974312423 2974310843 Bacteria 4947816
366 2974438211 2974435778 Bacteria 4876478
367 2984564172 2984559226 Bacteria 5683096
368 2984596907 2984595703 Bacteria 5682994
369 3000378706 3000376612 Bacteria 4705565
370 640937687 640753048 Bacteria 5495657
371 8004595671 8004592986 Bacteria 5122074
372 8015396331 8015394850 Bacteria 5064660
373 8018222371 8018221730 Bacteria 4616064
374 8019506218 8019504834 Bacteria 4819156
375 8054358243 8054357960 Bacteria 2867777
376 8054477324 8054472261 Bacteria 7464355
377 8054846092 8054844752 Bacteria 4450330
378 8054850660 8054849141 Bacteria 5232694
379 8055696033 8055693939 Bacteria 4772047
380 Ga0207696_1000174
381 SwRhRL2b_contig_189349
382 SwRhRL2b_contig_1916863
383 SwRhRL2b_contig_2178407
384 SwRhRL2b_contig_2767777
385 JGI25162J39368_1000112
386 JGI25163J39215_1000031
387 JGI25163J39215_1000055
388 JGI25164J39214_1000094
389 JGI25152J39213_1000184
390 Ga0055538_1000076
391 Ga0055539_1000115
392 Ga0055533_1000121
393 Ga0055525_1000159
394 Ga0055526_1001308
395 Ga0055536_1000293
396 Ga0055541_1000077
397 Ga0058692_1001697
398 Ga0058692_1001833
399 Ga0058692_1016082
400 Ga0058692_1017727
401 Ga0065704_10000270
402 Ga0065704_10070699
403 Ga0070658_10206388
404 Ga0070687_100000792
405 Ga0070685_10009845
406 Ga0070665_100000406
407 Ga0068857_100009182
408 Ga0081455_10236258
409 Ga0079104_1000236
410 Ga0079104_1000535
411 Ga0079104_1000611
412 Ga0079104_1000934
413 Ga0079104_1001318
414 Ga0079104_1001694
415 Ga0079104_1002218
416 Ga0079104_1006731
417 Ga0105251_10000752
418 Ga0105251_10000949
419 Ga0105251_10003041
420 Ga0105251_10003377
421 Ga0105251_10072016
422 Ga0105244_10000104
423 Ga0105244_10000222
424 Ga0105244_10000330
425 Ga0105244_10000354
426 Ga0105244_10000586
427 Ga0105244_10006208
428 Ga0105244_10024671
429 Ga0105250_10000001
430 Ga0105250_10000195
431 Ga0105250_10000253
432 Ga0105250_10000448
433 Ga0105250_10001017
434 Ga0105250_10069458
435 Ga0105240_10659519
436 Ga0105247_10000138
437 Ga0105241_10000002
438 Ga0157373_10129033
439 Ga0157371_10000099
440 Ga0157370_10000234
441 Ga0157370_10004253
442 Ga0157369_10001590
443 Ga0163162_10028448
444 Ga0182008_10000780
445 Ga0182006_1000047
446 Ga0183366_1001
447 Ga0183370_1001
448 Ga0183369_1001
449 Ga0183368_1001
450 Ga0163161_10000001
451 Ga0213876_10000478
452 Ga0209760_100104
453 Ga0209784_100001
454 Ga0209566_100001
455 Ga0209674_100002
456 Ga0209563_100008
457 Ga0207427_100135
458 Ga0209437_100007
459 Ga0209677_100004
460 Ga0209129_1000004
461 Ga0209233_1001611
462 Ga0209257_1010543
463 Ga0207696_1000001
464 Ga0207696_1000028
465 Ga0207696_1000116
466 Ga0207696_1000235
467 Ga0207696_1003897
468 Ga0207696_1007225
469 Ga0207696_1012343
470 Ga0207655_1000001
471 Ga0207655_1000004
472 Ga0207655_1000037
473 Ga0207655_1000158
474 Ga0207655_1000227
475 Ga0207655_1000426
476 Ga0207655_1000647
477 Ga0207655_1057677
478 Ga0207713_1000003
479 Ga0207713_1000099
480 Ga0207713_1000944
481 Ga0207713_1014116
482 Ga0207713_1029251
483 Ga0207713_1072864
484 Ga0207710_10000052
485 Ga0207654_10000005
486 Ga0207662_10089398
487 Ga0207709_10012478
488 Ga0209281_1000001
489 Ga0209281_1000003
490 Ga0209281_1000130
491 Ga0209281_1000274
492 Ga0209281_1000428
493 Ga0209281_1000984
494 Ga0209281_1001331
495 Ga0209281_1001414
496 Ga0209281_1001710
497 Ga0209371_1000002
498 Ga0209371_1000041
499 Ga0209371_1001119
500 Ga0209371_1004054
501 Ga0209371_1006331
502 Ga0209371_1007954
503 Ga0209371_1012525
504 Ga0209371_1014234
505 Ga0209371_1023710
506 Ga0268266_10000435
507 Ga0268256_1000002
508 Ga0268256_1000003
509 Ga0268256_1000951
510 Ga0268256_1002114
511 Ga0268256_1006365
512 Ga0268256_1006724
513 Ga0268256_1008244
514 Ga0268256_1013670
515 Ga0268256_1015431
516 Ga0268256_1026717
517 Ga0316583_10010908
518 Ga0436365_0971002
519 Ga0439466_0042730
520 Ga0439452_000002
521 Ga0439452_000008
522 Ga0439452_000747
523 Ga0466969_0009969
524 Ga0466972_0005265
525 Ga0466977_0001934
526 Ga0466981_0000002
527 Ga0466970_0003758
528 Ga0466960_0000278
529 Ga0466967_0392910
530 Ga0495627_000288
531 Ga0495627_025793
532 Ga0495591_000252
533 Ga0495591_004005
534 Ga0495638_0002306
535 Ga0495650_0000090
536 Ga0495650_0004919
537 Ga0495620_0000156
538 Ga0495654_0000921
539 Ga0495654_0016335
540 Ga0495654_0026610
541 Ga0495597_0000173
542 Ga0495625_0009054
543 Ga0495649_0014063
544 Ga0495589_0000004
545 Ga0495660_0000028
546 Ga0495672_0000020
547 Ga0495679_000282
548 Ga0495673_0000065
549 Ga0496100_0197032
550 Ga0496104_0000449
551 Ga0496104_0016270
552 Ga0496104_0016572
553 Ga0496104_0442527
554 Ga0496105_0242989
555 Ga0496116_0000001
556 Ga0496116_0000277
557 Ga0496116_0027716
558 Ga0496116_0033550
559 Ga0496116_0053499
560 Ga0496116_0060050
561 Ga0496116_0076527
562 Ga0496117_0000399
563 Ga0496117_0001622
564 Ga0496117_0001848
565 Ga0496117_0015764
566 Ga0496117_0062126
567 Ga0496117_0092910
568 Ga0496118_0000015
569 Ga0496118_0001126
570 Ga0496118_0002147
571 Ga0496118_0011055
572 Ga0496118_0015410
573 Ga0496118_0119961
574 Ga0496119_0000066
575 Ga0496119_0000841
576 Ga0496119_0001692
577 Ga0496119_0002928
578 Ga0496119_0003785
579 Ga0496119_0010583
580 Ga0496119_0024633
581 Ga0496119_0036768
582 Ga0496119_0040220
583 Ga0496120_0002001
584 Ga0496120_0002009
585 Ga0496120_0003248
586 Ga0496120_0004555
587 Ga0496120_0009799
588 Ga0496120_0028808
589 Ga0496120_0037754
590 Ga0496120_0041324
591 Ga0496120_0111642
592 Ga0496121_0004213
593 Ga0496121_0004271
594 Ga0496121_0055778
595 Ga0496121_0140521
596 Ga0496122_0000058
597 Ga0496122_0000738
598 Ga0496122_0001008
599 Ga0496122_0012260
600 Ga0496122_0056121
601 Ga0496123_0000044
602 Ga0496123_0000821
603 Ga0496123_0001322
604 Ga0496123_0002646
605 Ga0496123_0006680
606 Ga0496123_0019875
607 Ga0496123_0074374
608 Ga0496123_0127129
609 Ga0496124_0000105
610 Ga0496124_0000196
611 Ga0496124_0000564
612 Ga0496124_0001459
613 Ga0496124_0065373
614 Ga0496124_0101594
615 Ga0496125_0000009
616 Ga0496125_0000103
617 Ga0496125_0218703
618 Ga0496125_0232319
619 Ga0496126_0000399
620 Ga0496126_0003414
621 Ga0496126_0010320
622 Ga0496126_0029469
623 Ga0496126_0075270
624 Ga0496126_0138637
625 Ga0496126_0366584
626 Ga0501037_0193200
627 Ga0501043_0027014
628 Ga0501035_0144716
629 nmdc:mga00v17_763_c1
630 2506578160
631 2506583298
632 2508852174
633 2526062403
634 2538425798
635 2547695147
636 2555257402
637 2562462989
638 2585825418
639 2585832100
640 2599408890
641 2601522594
642 2601527621
643 2601535241
644 2601540804
645 2601614452
646 2601619172
647 2601642215
648 2601647070
649 2601652599
650 2601657925
651 2601662038
652 2601694996
653 2601699668
654 2601706444
655 2601710750
656 2601715764
657 2601720019
658 2601726170
659 2601730711
660 2601735727
661 2601740994
662 2601750924
663 2601758423
664 2601764532
665 2602018178
666 2603638218
667 2603659400
668 2603664675
669 2603698223
670 2603703339
671 2603838104
672 2603843182
673 2603848255
674 2603853330
675 2603867256
676 2603871381
677 2603876304
678 2606048573
679 2606069102
680 2606144916
681 2606175975
682 2609913501
683 2637224697
684 2656277524
685 2671109795
686 2671588285
687 2676406030
688 2681997597
689 2682006891
690 2689444694
691 2707098540
692 2712469841
693 2739206358
694 2740063751
695 2753855676
696 2765588660
697 2772438763
698 2775538664
699 2777022209
700 2792311346
701 2793405769
702 2807179412
703 2813729252
704 2814696761
705 2821119479
706 2823374447
707 2846544362
708 2847087832
709 2852107806
710 2854604425
711 2855198101
712 2858468968
713 2869554090
714 2871272778
715 2871286351
716 2884088609
717 2888368784
718 2888378546
719 2891672888
720 2900052720
721 2904478208
722 2904505016
723 2904514345
724 2915361899
725 2916179515
726 2919108598
727 2919155274
728 2923634540
729 2927147952
730 2927834403
731 2932408232
732 2935626922
733 2937540252
734 2937844415
735 2937967376
736 2939568877
737 2939573875
738 2939578689
739 2939619334
740 2939644077
741 2945877438
742 2969081747
743 2971823166
744 2974312423
745 2974438211
746 2984564172
747 2984596907
748 3000378706
749 640937687
750 8004595671
751 8015396331
752 8018222371
753 8019506218
754 8054358243
755 8054477324
756 8054846092
757 8054850660
758 8055696033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01032

FecCD

FecCD transport family

75

376

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.9622 10 330
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.9585 10 330
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.9478 10 330
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.9441 10 330
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.9404 9 329
ID Description Score Start End Superfamily
1l7vB00 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9552 9 330 1.10.3470.10
1l7vB00 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9463 9 330 1.10.3470.10
af_Q57552_11_347_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9453 16 331 1.10.3470.10
4dblA00 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9404 9 329 1.10.3470.10
4g1uB00 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9336 18 328 1.10.3470.10
ID Description Score Start End GO Terms
AF-B6XGN3-F1-model_v4 Iron chelate uptake ABC transporter, FeCT family, permease protein 0.9826 34 329 GO:0005886
GO:0015889
GO:0022857
AF-Q7N3Q3-F1-model_v4 Vitamin B12 import system permease protein BtuC 0.9751 1 330 GO:0005886
GO:0015889
GO:0090482
AF-A0A2X3CVS4-F1-model_v4 Vitamin B12 import system permease protein BtuC 0.9701 5 331 GO:0005886
GO:0015889
GO:0090482
AF-A0A7H5ABJ7-F1-model_v4 Vitamin B12 import system permease protein BtuC 0.97 5 335 GO:0005886
GO:0015889
GO:0090482
AF-B7MVJ0-F1-model_v4 Vitamin B12 import system permease protein BtuC 0.9699 10 332 GO:0005886
GO:0015889
GO:0090482

Map