F428381

General Info

Members Datasets Scaffolds Average Seq Length
379 216 758 205

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10532473|Ga0207689_105324731
Length 236
Sequence VSTSIFSSAAPVRRSVAKVTDARNAMRTLRHLFDNNRAWSERIRRQDPDFFAKLSGQQAPAFLWIGCSDSRVPANEIVGLLPGELFVHRNVANLVVHTDLNCLSVMQFAMDILKVRHIIVCGHYGCSGVHAALRGDRLGLSDNWLRHVDDVRQKHRDRLATAADAADRLCELNVIEQVANVCQTTIARDAWQRGQELSVHGWIYSLRDGLLRDLGTTVDGIGETEAVHRAALDALR

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.22
Rhizosphere 94.72
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10532473 3300025942 Bacteria 986
2 rootH1_10039719 3300003323 Bacteria 2738
3 rootH1_10142386 3300003323 Bacteria 1192
4 JGI25405J52794_10008000 3300003911 Bacteria 1963
5 Ga0065704_10241232 3300005289 Bacteria 1014
6 Ga0065712_10176552 3300005290 Bacteria 1215
7 Ga0065715_10135522 3300005293 Bacteria 1921
8 Ga0070658_10008286 3300005327 Bacteria 8361
9 Ga0070658_10174398 3300005327 Bacteria 1808
10 Ga0070676_10039843 3300005328 Bacteria 2718
11 Ga0070676_10077459 3300005328 Bacteria 2009
12 Ga0070683_100036504 3300005329 Bacteria 4497
13 Ga0070690_100083500 3300005330 Bacteria 2093
14 Ga0070690_100203468 3300005330 Bacteria 1379
15 Ga0070670_100072875 3300005331 Unclassified 2949
16 Ga0070670_100391578 3300005331 Bacteria 1225
17 Ga0070670_100419123 3300005331 Bacteria 1183
18 Ga0068869_100001912 3300005334 Bacteria 12509
19 Ga0068869_100477148 3300005334 Bacteria 1038
20 Ga0070666_10001015 3300005335 Bacteria 17202
21 Ga0070666_10011348 3300005335 Bacteria 5590
22 Ga0070680_100026750 3300005336 Bacteria 4614
23 Ga0070682_100015579 3300005337 Bacteria 4408
24 Ga0068868_100006765 3300005338 Bacteria 8144
25 Ga0070660_100000593 3300005339 Bacteria 24281
26 Ga0070660_100351810 3300005339 Bacteria 1213
27 Ga0070661_100012677 3300005344 Bacteria 5897
28 Ga0070661_100016867 3300005344 Bacteria 5170
29 Ga0070692_10109786 3300005345 Bacteria 1524
30 Ga0070668_100006675 3300005347 Bacteria 8553
31 Ga0070669_100023948 3300005353 Bacteria 4374
32 Ga0070669_100085123 3300005353 Bacteria 2361
33 Ga0070669_100085774 3300005353 Bacteria 2352
34 Ga0070675_100003595 3300005354 Bacteria 11797
35 Ga0070675_100136208 3300005354 Bacteria 2096
36 Ga0070671_100008109 3300005355 Bacteria 8412
37 Ga0070671_100035542 3300005355 Bacteria 4127
38 Ga0070674_100371124 3300005356 Bacteria 1161
39 Ga0070673_100005414 3300005364 Bacteria 8167
40 Ga0070673_100054170 3300005364 Bacteria 3154
41 Ga0070688_100144037 3300005365 Bacteria 1622
42 Ga0070659_100003519 3300005366 Bacteria 11153
43 Ga0070659_100026477 3300005366 Bacteria 4463
44 Ga0070659_100067116 3300005366 Bacteria 2844
45 Ga0070659_100250007 3300005366 Bacteria 1469
46 Ga0070667_100002995 3300005367 Bacteria 14512
47 Ga0070667_100003021 3300005367 Bacteria 14456
48 Ga0070709_10074198 3300005434 Bacteria 2204
49 Ga0070714_100016552 3300005435 Bacteria 5958
50 Ga0070714_100105899 3300005435 Bacteria 2484
51 Ga0070694_100228875 3300005444 Bacteria 1398
52 Ga0070694_100366726 3300005444 Bacteria 1120
53 Ga0070708_100170955 3300005445 Bacteria 2029
54 Ga0070663_100004443 3300005455 Bacteria 8245
55 Ga0070678_100001133 3300005456 Bacteria 14054
56 Ga0070678_100038223 3300005456 Bacteria 3377
57 Ga0070662_100000141 3300005457 Bacteria 40768
58 Ga0070662_100177633 3300005457 Bacteria 1676
59 Ga0070681_10006435 3300005458 Bacteria 11432
60 Ga0070681_10045174 3300005458 Bacteria 4408
61 Ga0070681_10150881 3300005458 Bacteria 2250
62 Ga0068867_100007981 3300005459 Bacteria 7478
63 Ga0070698_100423068 3300005471 Bacteria 1267
64 Ga0070679_100081066 3300005530 Bacteria 3234
65 Ga0070679_100118040 3300005530 Bacteria 2637
66 Ga0070679_100167354 3300005530 Bacteria 2171
67 Ga0070679_100167715 3300005530 Bacteria 2169
68 Ga0070679_100240273 3300005530 Bacteria 1769
69 Ga0070684_100006557 3300005535 Bacteria 9012
70 Ga0068853_100002953 3300005539 Bacteria 12945
71 Ga0068853_100167877 3300005539 Bacteria 1984
72 Ga0070672_100011789 3300005543 Bacteria 6107
73 Ga0070686_100398064 3300005544 Bacteria 1046
74 Ga0070696_100345645 3300005546 Bacteria 1151
75 Ga0070696_100872833 3300005546 Bacteria 745
76 Ga0070693_100360076 3300005547 Bacteria 998
77 Ga0070665_100006592 3300005548 Bacteria 11801
78 Ga0070665_100186070 3300005548 Bacteria 2077
79 Ga0070665_100694681 3300005548 Bacteria 1030
80 Ga0068855_100002176 3300005563 Bacteria 24227
81 Ga0068855_100097216 3300005563 Bacteria 3392
82 Ga0068855_100213141 3300005563 Bacteria 2169
83 Ga0070664_100001635 3300005564 Bacteria 17926
84 Ga0070664_100020102 3300005564 Bacteria 5498
85 Ga0070664_100035355 3300005564 Bacteria 4194
86 Ga0070664_100200543 3300005564 Bacteria 1780
87 Ga0068857_100215796 3300005577 Bacteria 1751
88 Ga0068857_100638961 3300005577 Bacteria 1008
89 Ga0068854_100122660 3300005578 Bacteria 1975
90 Ga0068854_100224908 3300005578 Bacteria 1486
91 Ga0068856_100000335 3300005614 Bacteria 51588
92 Ga0068856_100045567 3300005614 Bacteria 4318
93 Ga0068856_100054323 3300005614 Bacteria 3950
94 Ga0068856_100335747 3300005614 Bacteria 1529
95 Ga0068852_100065419 3300005616 Bacteria 3172
96 Ga0068852_100875574 3300005616 Bacteria 914
97 Ga0068859_100006863 3300005617 Bacteria 11562
98 Ga0068864_100026363 3300005618 Bacteria 4902
99 Ga0068864_100167143 3300005618 Bacteria 2003
100 Ga0068863_100011401 3300005841 Bacteria 8601
101 Ga0068863_100042566 3300005841 Bacteria 4315
102 Ga0068863_100952485 3300005841 Bacteria 860
103 Ga0068863_101172530 3300005841 Bacteria 774
104 Ga0068858_100010577 3300005842 Bacteria 8738
105 Ga0068858_100012168 3300005842 Bacteria 8112
106 Ga0068860_100004196 3300005843 Bacteria 14770
107 Ga0068860_100007841 3300005843 Bacteria 10658
108 Ga0081455_10000163 3300005937 Bacteria 82001
109 Ga0081455_10034216 3300005937 Bacteria 4555
110 Ga0081538_10074788 3300005981 Bacteria 1842
111 Ga0075432_10168370 3300006058 Bacteria 851
112 Ga0070716_100379900 3300006173 Bacteria 1009
113 Ga0097621_100003009 3300006237 Bacteria 11576
114 Ga0068871_100023331 3300006358 Bacteria 4783
115 Ga0068871_100371851 3300006358 Bacteria 1268
116 Ga0075428_100025821 3300006844 Bacteria 6505
117 Ga0075430_100021437 3300006846 Bacteria 5492
118 Ga0075430_100369445 3300006846 Bacteria 1184
119 Ga0075431_100165479 3300006847 Unclassified 2273
120 Ga0075431_100750731 3300006847 Bacteria 951
121 Ga0075433_10024561 3300006852 Bacteria 5088
122 Ga0075433_10075703 3300006852 Unclassified 2962
123 Ga0075433_10140289 3300006852 Unclassified 2148
124 Ga0075433_10282305 3300006852 Bacteria 1471
125 Ga0075433_10713546 3300006852 Bacteria 878
126 Ga0075434_100167610 3300006871 Bacteria 2216
127 Ga0075434_101256518 3300006871 Bacteria 752
128 Ga0075429_100166269 3300006880 Unclassified 1932
129 Ga0068865_100014520 3300006881 Bacteria 5006
130 Ga0075436_100087037 3300006914 Bacteria 2170
131 Ga0075436_100214823 3300006914 Bacteria 1364
132 Ga0097620_100006863 3300006931 Bacteria 11562
133 Ga0075435_100197346 3300007076 Bacteria 1704
134 Ga0075435_100460945 3300007076 Unclassified 1096
135 Ga0075435_100637252 3300007076 Bacteria 925
136 Ga0105240_10177153 3300009093 Bacteria 2520
137 Ga0105240_10230345 3300009093 Bacteria 2154
138 Ga0111539_10309234 3300009094 Bacteria 1839
139 Ga0111539_10867038 3300009094 Unclassified 1050
140 Ga0105245_10448141 3300009098 Bacteria 1299
141 Ga0105247_10030720 3300009101 Bacteria 3258
142 Ga0114129_10016072 3300009147 Bacteria 10647
143 Ga0114129_10020770 3300009147 Bacteria 9332
144 Ga0114129_10026470 3300009147 Bacteria 8212
145 Ga0114129_10192286 3300009147 Bacteria 2770
146 Ga0114129_10334169 3300009147 Bacteria 2011
147 Ga0114129_10394171 3300009147 Bacteria 1826
148 Ga0114129_10627756 3300009147 Bacteria 1389
149 Ga0114129_11684306 3300009147 Bacteria 774
150 Ga0105243_10379813 3300009148 Bacteria 1306
151 Ga0105241_10469041 3300009174 Bacteria 1117
152 Ga0105242_10029944 3300009176 Bacteria 4345
153 Ga0105242_10398568 3300009176 Bacteria 1284
154 Ga0105242_11139925 3300009176 Bacteria 796
155 Ga0105248_10004820 3300009177 Bacteria 14933
156 Ga0105248_10125381 3300009177 Bacteria 2897
157 Ga0105237_10022358 3300009545 Bacteria 6489
158 Ga0105237_10049514 3300009545 Bacteria 4223
159 Ga0105238_10002927 3300009551 Bacteria 17042
160 Ga0105238_10081463 3300009551 Bacteria 3226
161 Ga0105238_10382831 3300009551 Bacteria 1398
162 Ga0105249_10121642 3300009553 Bacteria 2481
163 Ga0105249_10425355 3300009553 Bacteria 1363
164 Ga0105239_10765621 3300010375 Bacteria 1105
165 Ga0157373_10002649 3300013100 Bacteria 13577
166 Ga0157373_10158073 3300013100 Bacteria 1595
167 Ga0157371_10000388 3300013102 Bacteria 55329
168 Ga0157371_10022531 3300013102 Bacteria 4613
169 Ga0157370_10047510 3300013104 Bacteria 4114
170 Ga0157370_10121035 3300013104 Bacteria 2443
171 Ga0157370_10462727 3300013104 Bacteria 1166
172 Ga0157369_10161613 3300013105 Bacteria 2364
173 Ga0157374_10086471 3300013296 Bacteria 2983
174 Ga0157378_10424072 3300013297 Bacteria 1315
175 Ga0157378_10597306 3300013297 Bacteria 1115
176 Ga0157372_10000214 3300013307 Bacteria 64524
177 Ga0157372_10049793 3300013307 Bacteria 4660
178 Ga0157372_10060711 3300013307 Bacteria 4230
179 Ga0157372_10145687 3300013307 Bacteria 2731
180 Ga0157372_10157100 3300013307 Bacteria 2627
181 Ga0163163_10025005 3300014325 Bacteria 5688
182 Ga0163163_10203212 3300014325 Bacteria 2030
183 Ga0157379_10009851 3300014968 Bacteria 8327
184 Ga0157379_10041317 3300014968 Bacteria 4117
185 Ga0157376_10300491 3300014969 Bacteria 1519
186 Ga0213872_10002666 3300021361 Bacteria 10333
187 Ga0207680_10068819 3300025903 Bacteria 2185
188 Ga0207699_10078289 3300025906 Bacteria 2042
189 Ga0207645_10016685 3300025907 Bacteria 4856
190 Ga0207645_10037550 3300025907 Bacteria 3108
191 Ga0207707_10002986 3300025912 Bacteria 15042
192 Ga0207707_10150522 3300025912 Bacteria 2035
193 Ga0207695_10016896 3300025913 Bacteria 8516
194 Ga0207695_10167089 3300025913 Bacteria 2127
195 Ga0207695_10205431 3300025913 Bacteria 1883
196 Ga0207671_10091990 3300025914 Bacteria 2286
197 Ga0207660_10024725 3300025917 Bacteria 4069
198 Ga0207657_10000127 3300025919 Bacteria 76293
199 Ga0207657_10001196 3300025919 Bacteria 27576
200 Ga0207657_10058547 3300025919 Bacteria 3315
201 Ga0207649_10003774 3300025920 Bacteria 8263
202 Ga0207649_10111689 3300025920 Bacteria 1827
203 Ga0207652_10168724 3300025921 Bacteria 1963
204 Ga0207652_10295084 3300025921 Bacteria 1463
205 Ga0207652_10637567 3300025921 Bacteria 953
206 Ga0207646_10243903 3300025922 Bacteria 1623
207 Ga0207681_10011180 3300025923 Bacteria 5512
208 Ga0207681_10141476 3300025923 Bacteria 1792
209 Ga0207694_10000216 3300025924 Bacteria 56407
210 Ga0207694_10175631 3300025924 Bacteria 1736
211 Ga0207694_10224957 3300025924 Bacteria 1531
212 Ga0207650_10037339 3300025925 Bacteria 3540
213 Ga0207650_10065092 3300025925 Unclassified 2730
214 Ga0207659_10208345 3300025926 Bacteria 1565
215 Ga0207664_10007212 3300025929 Bacteria 7698
216 Ga0207664_10015148 3300025929 Bacteria 5588
217 Ga0207664_10032329 3300025929 Bacteria 4009
218 Ga0207644_10000809 3300025931 Bacteria 19868
219 Ga0207644_10040323 3300025931 Bacteria 3300
220 Ga0207690_10000243 3300025932 Bacteria 39574
221 Ga0207690_10202757 3300025932 Bacteria 1507
222 Ga0207690_10215570 3300025932 Bacteria 1466
223 Ga0207690_10578367 3300025932 Bacteria 915
224 Ga0207706_10000052 3300025933 Bacteria 115553
225 Ga0207706_10485651 3300025933 Bacteria 1067
226 Ga0207706_10560884 3300025933 Bacteria 983
227 Ga0207670_10236213 3300025936 Bacteria 1406
228 Ga0207670_10520465 3300025936 Bacteria 968
229 Ga0207669_10355209 3300025937 Bacteria 1134
230 Ga0207665_10374488 3300025939 Bacteria 1079
231 Ga0207691_10000337 3300025940 Bacteria 47130
232 Ga0207711_10010034 3300025941 Bacteria 7872
233 Ga0207711_10012370 3300025941 Bacteria 7092
234 Ga0207689_10002386 3300025942 Bacteria 17534
235 Ga0207661_10058073 3300025944 Bacteria 3113
236 Ga0207679_10001130 3300025945 Bacteria 17014
237 Ga0207679_10048547 3300025945 Bacteria 3091
238 Ga0207679_10227814 3300025945 Bacteria 1571
239 Ga0207679_10514889 3300025945 Bacteria 1069
240 Ga0207667_10000257 3300025949 Bacteria 74952
241 Ga0207667_10000531 3300025949 Bacteria 50233
242 Ga0207667_10034889 3300025949 Bacteria 5399
243 Ga0207667_10437406 3300025949 Bacteria 1330
244 Ga0207667_10722078 3300025949 Bacteria 997
245 Ga0207651_10061689 3300025960 Bacteria 2609
246 Ga0207668_10034481 3300025972 Bacteria 3362
247 Ga0207668_10463696 3300025972 Bacteria 1084
248 Ga0207640_10005012 3300025981 Bacteria 7200
249 Ga0207640_10018422 3300025981 Bacteria 4104
250 Ga0207640_10062160 3300025981 Bacteria 2476
251 Ga0207658_10015483 3300025986 Bacteria 5231
252 Ga0207658_10688274 3300025986 Bacteria 923
253 Ga0207677_10019248 3300026023 Bacteria 4119
254 Ga0207677_10067461 3300026023 Bacteria 2507
255 Ga0207677_10212651 3300026023 Bacteria 1545
256 Ga0207703_10013397 3300026035 Bacteria 6391
257 Ga0207639_10001942 3300026041 Bacteria 13885
258 Ga0207639_10239071 3300026041 Bacteria 1578
259 Ga0207678_10016583 3300026067 Bacteria 6470
260 Ga0207678_10076397 3300026067 Bacteria 2869
261 Ga0207678_10133631 3300026067 Bacteria 2117
262 Ga0207702_10000434 3300026078 Bacteria 47612
263 Ga0207702_10088997 3300026078 Bacteria 2699
264 Ga0207702_10097573 3300026078 Bacteria 2586
265 Ga0207702_10658415 3300026078 Bacteria 1030
266 Ga0207702_11007535 3300026078 Bacteria 826
267 Ga0207641_10002473 3300026088 Bacteria 17063
268 Ga0207641_10010458 3300026088 Bacteria 7625
269 Ga0207648_10000714 3300026089 Bacteria 37228
270 Ga0207648_10155502 3300026089 Bacteria 2019
271 Ga0207676_10039653 3300026095 Bacteria 3604
272 Ga0207676_10057075 3300026095 Bacteria 3073
273 Ga0207674_10000522 3300026116 Bacteria 50469
274 Ga0207683_10002108 3300026121 Bacteria 17499
275 Ga0207683_10017578 3300026121 Bacteria 6098
276 Ga0207698_10001076 3300026142 Bacteria 15879
277 Ga0207698_10163880 3300026142 Bacteria 1948
278 Ga0209971_1015974 3300027682 Bacteria 1780
279 Ga0209974_10005052 3300027876 Bacteria 4664
280 Ga0268266_10027802 3300028379 Bacteria 4809
281 Ga0268266_10503538 3300028379 Bacteria 1156
282 Ga0268266_10818754 3300028379 Bacteria 899
283 Ga0268264_10178763 3300028381 Bacteria 1925
284 Ga0265337_1014547 3300028556 Bacteria 2607
285 Ga0307408_100038407 3300031548 Bacteria 3378
286 Ga0307405_10010570 3300031731 Bacteria 4794
287 Ga0307410_10191794 3300031852 Bacteria 1554
288 Ga0307406_10054542 3300031901 Bacteria 2551
289 Ga0307407_10029093 3300031903 Bacteria 2963
290 Ga0307409_100008957 3300031995 Bacteria 6114
291 Ga0307416_100064693 3300032002 Bacteria 3001
292 Ga0307416_100157389 3300032002 Bacteria 2094
293 Ga0307415_100115364 3300032126 Bacteria 2002
294 Ga0373944_0050715 3300035089 Bacteria 1307
295 Ga0373945_0014599 3300035116 Bacteria 2635
296 Ga0373931_0044327 3300035691 Bacteria 2345
297 Ga0373935_0603884 3300035692 Bacteria 802
298 Ga0373925_0927543 3300037068 Bacteria 717
299 Ga0395899_0090807 3300037312 Bacteria 2214
300 Ga0395899_0158725 3300037312 Bacteria 1599
301 Ga0395900_0118589 3300037418 Bacteria 2716
302 Ga0395900_0207797 3300037418 Bacteria 1978
303 Ga0395905_0093973 3300037471 Bacteria 2813
304 Ga0436361_0188555 3300039447 Bacteria 2269
305 Ga0436361_0272642 3300039447 Bacteria 823
306 Ga0436361_1056069 3300039447 Bacteria 2945
307 Ga0436362_0027691 3300039453 Bacteria 3034
308 Ga0451807_0872593 3300041486 Bacteria 2891
309 Ga0439449_0003943 3300042007 Bacteria 5747
310 Ga0450890_017812 3300042127 Bacteria 947
311 Ga0451577_0200693 3300042876 Bacteria 1800
312 Ga0453684_0180721 3300044712 Bacteria 2477
313 Ga0453684_0289546 3300044712 Bacteria 1865
314 Ga0451576_1190671 3300045051 Bacteria 796
315 Ga0495592_0000054 3300046454 Bacteria 107373
316 Ga0495639_0292266 3300046475 Bacteria 811
317 Ga0495662_0036383 3300046476 Bacteria 2376
318 Ga0495664_0009320 3300046477 Bacteria 5490
319 Ga0495594_0452720 3300046499 Bacteria 730
320 Ga0495618_0032784 3300046514 Bacteria 3254
321 Ga0495628_0043434 3300046516 Bacteria 3580
322 Ga0495630_0089799 3300046517 Bacteria 2321
323 Ga0495652_0018833 3300046529 Bacteria 6152
324 Ga0495640_0023249 3300046533 Bacteria 4522
325 Ga0495586_0002198 3300046535 Bacteria 10594
326 Ga0495645_0051957 3300046543 Bacteria 2982
327 Ga0495656_0433833 3300046615 Bacteria 691
328 Ga0495634_0241707 3300046642 Bacteria 1107
329 Ga0495646_0155047 3300046680 Bacteria 1271
330 Ga0495658_0023664 3300046683 Bacteria 3263
331 Ga0495658_0513905 3300046683 Bacteria 767
332 Ga0495581_0268556 3300047315 Bacteria 997
333 Ga0495674_0148403 3300047319 Bacteria 1967
334 Ga0496100_0118885 3300048903 Bacteria 1846
335 Ga0496101_0040733 3300048904 Bacteria 3309
336 Ga0496102_0202050 3300048905 Bacteria 1873
337 Ga0496103_0115223 3300048906 Bacteria 1709
338 Ga0496104_0007070 3300048907 Bacteria 9899
339 Ga0496106_0000198 3300048909 Bacteria 42449
340 Ga0496106_0218857 3300048909 Bacteria 1518
341 Ga0496107_0012312 3300048910 Bacteria 5970
342 Ga0496107_0202497 3300048910 Bacteria 1475
343 Ga0496108_0037208 3300048911 Bacteria 4053
344 Ga0496108_0635186 3300048911 Bacteria 929
345 Ga0496109_0006467 3300048912 Bacteria 9867
346 Ga0496110_0016249 3300048913 Bacteria 6210
347 Ga0496110_0296129 3300048913 Bacteria 1474
348 Ga0496114_0239079 3300048917 Bacteria 1597
349 Ga0496121_0633947 3300048924 Bacteria 654
350 Ga0501036_0163200 3300049572 Bacteria 1878
351 Ga0501037_0053729 3300049573 Bacteria 2947
352 Ga0501038_0188514 3300049574 Bacteria 1660
353 Ga0501047_0224879 3300049581 Bacteria 1732
354 Ga0501068_0193233 3300049584 Bacteria 1290
355 Ga0501070_0099290 3300049586 Bacteria 2408
356 Ga0501070_0130076 3300049586 Bacteria 2080
357 Ga0501073_0038300 3300049589 Bacteria 3402
358 Ga0501074_0028886 3300049590 Bacteria 4017
359 nmdc:mga05p37_1317372_c1 3300050507 Bacteria 735
360 nmdc:mga05p37_15712_c1 3300050507 Bacteria 9100
361 nmdc:mga05p37_176237_c1 3300050507 Bacteria 2605
362 nmdc:mga05p37_704880_c1 3300050507 Bacteria 1121
363 nmdc:mga05p37_858584_c1 3300050507 Bacteria 985
364 nmdc:mga05p37_87910_c1 3300050507 Bacteria 3831
365 nmdc:mga0qj67_172346_c1 3300050509 Unclassified 1757
366 nmdc:mga0qj67_537725_c1 3300050509 Bacteria 938
367 nmdc:mga0qj67_894397_c1 3300050509 Bacteria 700
368 nmdc:mga06r32_458743_c1 3300050510 Bacteria 1253
369 nmdc:mga08y16_110183_c1 3300050511 Bacteria 2867
370 nmdc:mga08y16_617242_c1 3300050511 Bacteria 1091
371 nmdc:mga0n895_165587_c1 3300050512 Bacteria 2242
372 nmdc:mga0rr50_199002_c1 3300050513 Bacteria 1646
373 nmdc:mga0rr50_633678_c1 3300050513 Bacteria 912
374 nmdc:mga0rr50_663860_c1 3300050513 Bacteria 890
375 nmdc:mga08x19_29506_c1 3300050514 Bacteria 3440
376 nmdc:mga0a205_345134_c1 3300050515 Bacteria 1357
377 nmdc:mga0a205_34667_c1 3300050515 Bacteria 4843
378 Ga0500622_0004408 3300053156 Bacteria 8851
379 Ga0466962_0022787 3300061719 Bacteria 3010
380 Ga0207689_10532473
381 rootH1_10039719
382 rootH1_10142386
383 JGI25405J52794_10008000
384 Ga0065704_10241232
385 Ga0065712_10176552
386 Ga0065715_10135522
387 Ga0070658_10008286
388 Ga0070658_10174398
389 Ga0070676_10039843
390 Ga0070676_10077459
391 Ga0070683_100036504
392 Ga0070690_100083500
393 Ga0070690_100203468
394 Ga0070670_100072875
395 Ga0070670_100391578
396 Ga0070670_100419123
397 Ga0068869_100001912
398 Ga0068869_100477148
399 Ga0070666_10001015
400 Ga0070666_10011348
401 Ga0070680_100026750
402 Ga0070682_100015579
403 Ga0068868_100006765
404 Ga0070660_100000593
405 Ga0070660_100351810
406 Ga0070661_100012677
407 Ga0070661_100016867
408 Ga0070692_10109786
409 Ga0070668_100006675
410 Ga0070669_100023948
411 Ga0070669_100085123
412 Ga0070669_100085774
413 Ga0070675_100003595
414 Ga0070675_100136208
415 Ga0070671_100008109
416 Ga0070671_100035542
417 Ga0070674_100371124
418 Ga0070673_100005414
419 Ga0070673_100054170
420 Ga0070688_100144037
421 Ga0070659_100003519
422 Ga0070659_100026477
423 Ga0070659_100067116
424 Ga0070659_100250007
425 Ga0070667_100002995
426 Ga0070667_100003021
427 Ga0070709_10074198
428 Ga0070714_100016552
429 Ga0070714_100105899
430 Ga0070694_100228875
431 Ga0070694_100366726
432 Ga0070708_100170955
433 Ga0070663_100004443
434 Ga0070678_100001133
435 Ga0070678_100038223
436 Ga0070662_100000141
437 Ga0070662_100177633
438 Ga0070681_10006435
439 Ga0070681_10045174
440 Ga0070681_10150881
441 Ga0068867_100007981
442 Ga0070698_100423068
443 Ga0070679_100081066
444 Ga0070679_100118040
445 Ga0070679_100167354
446 Ga0070679_100167715
447 Ga0070679_100240273
448 Ga0070684_100006557
449 Ga0068853_100002953
450 Ga0068853_100167877
451 Ga0070672_100011789
452 Ga0070686_100398064
453 Ga0070696_100345645
454 Ga0070696_100872833
455 Ga0070693_100360076
456 Ga0070665_100006592
457 Ga0070665_100186070
458 Ga0070665_100694681
459 Ga0068855_100002176
460 Ga0068855_100097216
461 Ga0068855_100213141
462 Ga0070664_100001635
463 Ga0070664_100020102
464 Ga0070664_100035355
465 Ga0070664_100200543
466 Ga0068857_100215796
467 Ga0068857_100638961
468 Ga0068854_100122660
469 Ga0068854_100224908
470 Ga0068856_100000335
471 Ga0068856_100045567
472 Ga0068856_100054323
473 Ga0068856_100335747
474 Ga0068852_100065419
475 Ga0068852_100875574
476 Ga0068859_100006863
477 Ga0068864_100026363
478 Ga0068864_100167143
479 Ga0068863_100011401
480 Ga0068863_100042566
481 Ga0068863_100952485
482 Ga0068863_101172530
483 Ga0068858_100010577
484 Ga0068858_100012168
485 Ga0068860_100004196
486 Ga0068860_100007841
487 Ga0081455_10000163
488 Ga0081455_10034216
489 Ga0081538_10074788
490 Ga0075432_10168370
491 Ga0070716_100379900
492 Ga0097621_100003009
493 Ga0068871_100023331
494 Ga0068871_100371851
495 Ga0075428_100025821
496 Ga0075430_100021437
497 Ga0075430_100369445
498 Ga0075431_100165479
499 Ga0075431_100750731
500 Ga0075433_10024561
501 Ga0075433_10075703
502 Ga0075433_10140289
503 Ga0075433_10282305
504 Ga0075433_10713546
505 Ga0075434_100167610
506 Ga0075434_101256518
507 Ga0075429_100166269
508 Ga0068865_100014520
509 Ga0075436_100087037
510 Ga0075436_100214823
511 Ga0097620_100006863
512 Ga0075435_100197346
513 Ga0075435_100460945
514 Ga0075435_100637252
515 Ga0105240_10177153
516 Ga0105240_10230345
517 Ga0111539_10309234
518 Ga0111539_10867038
519 Ga0105245_10448141
520 Ga0105247_10030720
521 Ga0114129_10016072
522 Ga0114129_10020770
523 Ga0114129_10026470
524 Ga0114129_10192286
525 Ga0114129_10334169
526 Ga0114129_10394171
527 Ga0114129_10627756
528 Ga0114129_11684306
529 Ga0105243_10379813
530 Ga0105241_10469041
531 Ga0105242_10029944
532 Ga0105242_10398568
533 Ga0105242_11139925
534 Ga0105248_10004820
535 Ga0105248_10125381
536 Ga0105237_10022358
537 Ga0105237_10049514
538 Ga0105238_10002927
539 Ga0105238_10081463
540 Ga0105238_10382831
541 Ga0105249_10121642
542 Ga0105249_10425355
543 Ga0105239_10765621
544 Ga0157373_10002649
545 Ga0157373_10158073
546 Ga0157371_10000388
547 Ga0157371_10022531
548 Ga0157370_10047510
549 Ga0157370_10121035
550 Ga0157370_10462727
551 Ga0157369_10161613
552 Ga0157374_10086471
553 Ga0157378_10424072
554 Ga0157378_10597306
555 Ga0157372_10000214
556 Ga0157372_10049793
557 Ga0157372_10060711
558 Ga0157372_10145687
559 Ga0157372_10157100
560 Ga0163163_10025005
561 Ga0163163_10203212
562 Ga0157379_10009851
563 Ga0157379_10041317
564 Ga0157376_10300491
565 Ga0213872_10002666
566 Ga0207680_10068819
567 Ga0207699_10078289
568 Ga0207645_10016685
569 Ga0207645_10037550
570 Ga0207707_10002986
571 Ga0207707_10150522
572 Ga0207695_10016896
573 Ga0207695_10167089
574 Ga0207695_10205431
575 Ga0207671_10091990
576 Ga0207660_10024725
577 Ga0207657_10000127
578 Ga0207657_10001196
579 Ga0207657_10058547
580 Ga0207649_10003774
581 Ga0207649_10111689
582 Ga0207652_10168724
583 Ga0207652_10295084
584 Ga0207652_10637567
585 Ga0207646_10243903
586 Ga0207681_10011180
587 Ga0207681_10141476
588 Ga0207694_10000216
589 Ga0207694_10175631
590 Ga0207694_10224957
591 Ga0207650_10037339
592 Ga0207650_10065092
593 Ga0207659_10208345
594 Ga0207664_10007212
595 Ga0207664_10015148
596 Ga0207664_10032329
597 Ga0207644_10000809
598 Ga0207644_10040323
599 Ga0207690_10000243
600 Ga0207690_10202757
601 Ga0207690_10215570
602 Ga0207690_10578367
603 Ga0207706_10000052
604 Ga0207706_10485651
605 Ga0207706_10560884
606 Ga0207670_10236213
607 Ga0207670_10520465
608 Ga0207669_10355209
609 Ga0207665_10374488
610 Ga0207691_10000337
611 Ga0207711_10010034
612 Ga0207711_10012370
613 Ga0207689_10002386
614 Ga0207661_10058073
615 Ga0207679_10001130
616 Ga0207679_10048547
617 Ga0207679_10227814
618 Ga0207679_10514889
619 Ga0207667_10000257
620 Ga0207667_10000531
621 Ga0207667_10034889
622 Ga0207667_10437406
623 Ga0207667_10722078
624 Ga0207651_10061689
625 Ga0207668_10034481
626 Ga0207668_10463696
627 Ga0207640_10005012
628 Ga0207640_10018422
629 Ga0207640_10062160
630 Ga0207658_10015483
631 Ga0207658_10688274
632 Ga0207677_10019248
633 Ga0207677_10067461
634 Ga0207677_10212651
635 Ga0207703_10013397
636 Ga0207639_10001942
637 Ga0207639_10239071
638 Ga0207678_10016583
639 Ga0207678_10076397
640 Ga0207678_10133631
641 Ga0207702_10000434
642 Ga0207702_10088997
643 Ga0207702_10097573
644 Ga0207702_10658415
645 Ga0207702_11007535
646 Ga0207641_10002473
647 Ga0207641_10010458
648 Ga0207648_10000714
649 Ga0207648_10155502
650 Ga0207676_10039653
651 Ga0207676_10057075
652 Ga0207674_10000522
653 Ga0207683_10002108
654 Ga0207683_10017578
655 Ga0207698_10001076
656 Ga0207698_10163880
657 Ga0209971_1015974
658 Ga0209974_10005052
659 Ga0268266_10027802
660 Ga0268266_10503538
661 Ga0268266_10818754
662 Ga0268264_10178763
663 Ga0265337_1014547
664 Ga0307408_100038407
665 Ga0307405_10010570
666 Ga0307410_10191794
667 Ga0307406_10054542
668 Ga0307407_10029093
669 Ga0307409_100008957
670 Ga0307416_100064693
671 Ga0307416_100157389
672 Ga0307415_100115364
673 Ga0373944_0050715
674 Ga0373945_0014599
675 Ga0373931_0044327
676 Ga0373935_0603884
677 Ga0373925_0927543
678 Ga0395899_0090807
679 Ga0395899_0158725
680 Ga0395900_0118589
681 Ga0395900_0207797
682 Ga0395905_0093973
683 Ga0436361_0188555
684 Ga0436361_0272642
685 Ga0436361_1056069
686 Ga0436362_0027691
687 Ga0451807_0872593
688 Ga0439449_0003943
689 Ga0450890_017812
690 Ga0451577_0200693
691 Ga0453684_0180721
692 Ga0453684_0289546
693 Ga0451576_1190671
694 Ga0495592_0000054
695 Ga0495639_0292266
696 Ga0495662_0036383
697 Ga0495664_0009320
698 Ga0495594_0452720
699 Ga0495618_0032784
700 Ga0495628_0043434
701 Ga0495630_0089799
702 Ga0495652_0018833
703 Ga0495640_0023249
704 Ga0495586_0002198
705 Ga0495645_0051957
706 Ga0495656_0433833
707 Ga0495634_0241707
708 Ga0495646_0155047
709 Ga0495658_0023664
710 Ga0495658_0513905
711 Ga0495581_0268556
712 Ga0495674_0148403
713 Ga0496100_0118885
714 Ga0496101_0040733
715 Ga0496102_0202050
716 Ga0496103_0115223
717 Ga0496104_0007070
718 Ga0496106_0000198
719 Ga0496106_0218857
720 Ga0496107_0012312
721 Ga0496107_0202497
722 Ga0496108_0037208
723 Ga0496108_0635186
724 Ga0496109_0006467
725 Ga0496110_0016249
726 Ga0496110_0296129
727 Ga0496114_0239079
728 Ga0496121_0633947
729 Ga0501036_0163200
730 Ga0501037_0053729
731 Ga0501038_0188514
732 Ga0501047_0224879
733 Ga0501068_0193233
734 Ga0501070_0099290
735 Ga0501070_0130076
736 Ga0501073_0038300
737 Ga0501074_0028886
738 nmdc:mga05p37_1317372_c1
739 nmdc:mga05p37_15712_c1
740 nmdc:mga05p37_176237_c1
741 nmdc:mga05p37_704880_c1
742 nmdc:mga05p37_858584_c1
743 nmdc:mga05p37_87910_c1
744 nmdc:mga0qj67_172346_c1
745 nmdc:mga0qj67_537725_c1
746 nmdc:mga0qj67_894397_c1
747 nmdc:mga06r32_458743_c1
748 nmdc:mga08y16_110183_c1
749 nmdc:mga08y16_617242_c1
750 nmdc:mga0n895_165587_c1
751 nmdc:mga0rr50_199002_c1
752 nmdc:mga0rr50_633678_c1
753 nmdc:mga0rr50_663860_c1
754 nmdc:mga08x19_29506_c1
755 nmdc:mga0a205_345134_c1
756 nmdc:mga0a205_34667_c1
757 Ga0500622_0004408
758 Ga0466962_0022787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

62

211

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jj8-assembly1.cif.gz_A crystal structure of the beta carbonic anhydrase psca3 isolated from pseudomonas aeruginosa - alternate crystal packing form 0.9784 1 198
6d2j-assembly1.cif.gz_A beta carbonic anhydrase in complex with thiocyanate 0.978 1 198
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.9777 31 205
4wak-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a 0.9696 32 205
3e2x-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase, variant v47a 0.9659 32 205
ID Description Score Start End Superfamily
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9684 31 196 3.40.1050.10
af_O94255_95_324_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9606 1 190 3.40.1050.10
4o1jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9603 2 195 3.40.1050.10
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9586 32 205 3.40.1050.10
3ucnB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9486 1 203 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A4Q6FS34-F1-model_v4 deleted 0.9975 2 150
AF-A0A656JXK1-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.997 32 196 GO:0004089
GO:0008270
GO:0015976
AF-A0A1Z3LTZ8-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9934 1 198 GO:0004089
GO:0008270
GO:0015976
AF-A0A2G4JT53-F1-model_v4 deleted 0.9933 1 118
AF-A0A1G2X526-F1-model_v4 deleted 0.993 2 184

Map