F428408

General Info

Members Datasets Scaffolds Average Seq Length
379 217 758 284

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0102041|Ga0373923_0102041_205_1065
Length 286
Sequence MPLSSVSRRTFLTYSAILPWALKAHAASSIPVGLELYSVRDELNKDPQGTVRAVAKMGYQGVEFYAPYFEWTESQTKGMKKLLDDMGIRCFSTHNDSAYFSKENLAKARDYNLILGSKYVVMASAQPKPGIDGWKEVTDALNSAAEQLAPAGLKLGYHNHQLEFTPSADLPMKARPIEFIAKNTKPTVMLQLDVGTCIEAGSDPTAWIRANPGRIRSLHCKDWSPDASKGYKVLFGEGVADWESIFAAAESVGGVEYYLVEQEGSRFSELETAQKCLAEFRAKHLA

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.17
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 21.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0102041 3300035111 Bacteria 1266
2 Ga0065715_10258102 3300005293 Unclassified 1146
3 Ga0065707_10016457 3300005295 Unclassified 1638
4 Ga0070658_10177223 3300005327 Unclassified 1793
5 Ga0070676_10018432 3300005328 Unclassified 3869
6 Ga0070683_100001100 3300005329 Bacteria 20362
7 Ga0070683_100245255 3300005329 Bacteria 1704
8 Ga0070690_100240434 3300005330 Bacteria 1276
9 Ga0068869_100050859 3300005334 Bacteria 3005
10 Ga0070666_10024852 3300005335 Unclassified 3904
11 Ga0070666_10256735 3300005335 Bacteria 1238
12 Ga0070682_100045098 3300005337 Bacteria 2731
13 Ga0068868_100001598 3300005338 Bacteria 15453
14 Ga0070660_100083188 3300005339 Unclassified 2514
15 Ga0070660_100116091 3300005339 Bacteria 2134
16 Ga0070687_100180469 3300005343 Bacteria 1264
17 Ga0070661_100236348 3300005344 Unclassified 1406
18 Ga0070661_100457380 3300005344 Bacteria 1016
19 Ga0070661_100500851 3300005344 Unclassified 972
20 Ga0070668_100014267 3300005347 Bacteria 5937
21 Ga0070669_100319713 3300005353 Unclassified 1253
22 Ga0070669_100398853 3300005353 Bacteria 1125
23 Ga0070675_100320415 3300005354 Bacteria 1369
24 Ga0070671_100570491 3300005355 Bacteria 977
25 Ga0070659_100030418 3300005366 Bacteria 4179
26 Ga0070659_100475815 3300005366 Unclassified 1062
27 Ga0070667_100127759 3300005367 Bacteria 2217
28 Ga0070709_10034560 3300005434 Bacteria 3066
29 Ga0070709_10046407 3300005434 Unclassified 2701
30 Ga0070714_100016874 3300005435 Bacteria 5906
31 Ga0070714_100021945 3300005435 Bacteria 5229
32 Ga0070713_100003252 3300005436 Bacteria 10717
33 Ga0070713_100195031 3300005436 Bacteria 1826
34 Ga0070713_100207543 3300005436 Bacteria 1772
35 Ga0070710_10027742 3300005437 Unclassified 3023
36 Ga0070701_10215101 3300005438 Bacteria 1143
37 Ga0070711_100000184 3300005439 Bacteria 33160
38 Ga0070711_100001678 3300005439 Bacteria 12267
39 Ga0070711_100031845 3300005439 Unclassified 3504
40 Ga0070705_100071202 3300005440 Bacteria 2102
41 Ga0070705_100095722 3300005440 Bacteria 1862
42 Ga0070694_100006224 3300005444 Unclassified 7245
43 Ga0070694_100108681 3300005444 Unclassified 1973
44 Ga0070694_100172362 3300005444 Bacteria 1595
45 Ga0070708_100000679 3300005445 Bacteria 25845
46 Ga0070708_100008937 3300005445 Bacteria 8069
47 Ga0070708_100042355 3300005445 Unclassified 3996
48 Ga0070708_100095102 3300005445 Bacteria 2719
49 Ga0070708_100461147 3300005445 Archaea 1199
50 Ga0070663_100181222 3300005455 Bacteria 1634
51 Ga0070663_100260481 3300005455 Bacteria 1375
52 Ga0070662_100001344 3300005457 Bacteria 15105
53 Ga0070681_10224687 3300005458 Bacteria 1792
54 Ga0068867_100647805 3300005459 Bacteria 926
55 Ga0070685_10221824 3300005466 Bacteria 1239
56 Ga0070706_100000454 3300005467 Bacteria 48917
57 Ga0070706_100009824 3300005467 Bacteria 8892
58 Ga0070706_100075036 3300005467 Unclassified 3130
59 Ga0070706_100113163 3300005467 Unclassified 2527
60 Ga0070706_100261500 3300005467 Bacteria 1615
61 Ga0070706_100316255 3300005467 Unclassified 1456
62 Ga0070707_100000497 3300005468 Bacteria 39055
63 Ga0070707_100035343 3300005468 Bacteria 4766
64 Ga0070707_100294649 3300005468 Bacteria 1576
65 Ga0070698_100001288 3300005471 Bacteria 27970
66 Ga0070698_100009995 3300005471 Bacteria 10142
67 Ga0070698_100049551 3300005471 Bacteria 4286
68 Ga0070698_100095288 3300005471 Unclassified 2954
69 Ga0070698_100500310 3300005471 Bacteria 1153
70 Ga0070699_100014814 3300005518 Bacteria 6705
71 Ga0070699_100016649 3300005518 Bacteria 6310
72 Ga0070699_100076127 3300005518 Unclassified 2921
73 Ga0070699_100106621 3300005518 Bacteria 2458
74 Ga0070699_100362549 3300005518 Unclassified 1307
75 Ga0070679_100041588 3300005530 Bacteria 4574
76 Ga0070684_100001196 3300005535 Bacteria 18641
77 Ga0070684_100058925 3300005535 Unclassified 3357
78 Ga0070684_100172358 3300005535 Bacteria 1965
79 Ga0070697_100000411 3300005536 Bacteria 32999
80 Ga0070697_100000671 3300005536 Bacteria 25737
81 Ga0070697_100000784 3300005536 Bacteria 23880
82 Ga0070697_100002338 3300005536 Bacteria 14586
83 Ga0070697_100005876 3300005536 Bacteria 9470
84 Ga0070697_100008836 3300005536 Bacteria 7861
85 Ga0070697_100092533 3300005536 Bacteria 2502
86 Ga0070697_100136030 3300005536 Bacteria 2064
87 Ga0070697_100234060 3300005536 Unclassified 1567
88 Ga0068853_100214483 3300005539 Bacteria 1756
89 Ga0070672_100173396 3300005543 Bacteria 1795
90 Ga0070695_100001473 3300005545 Bacteria 13055
91 Ga0070695_100014719 3300005545 Bacteria 4718
92 Ga0070695_100111676 3300005545 Bacteria 1856
93 Ga0070696_100001746 3300005546 Bacteria 14258
94 Ga0070693_100000070 3300005547 Bacteria 42181
95 Ga0070693_100089443 3300005547 Bacteria 1853
96 Ga0070693_100177377 3300005547 Bacteria 1369
97 Ga0070665_100247096 3300005548 Bacteria 1785
98 Ga0070704_100008207 3300005549 Unclassified 6248
99 Ga0070704_100191911 3300005549 Bacteria 1643
100 Ga0070704_100297080 3300005549 Bacteria 1344
101 Ga0068855_100139379 3300005563 Unclassified 2766
102 Ga0070664_100016650 3300005564 Bacteria 6029
103 Ga0068854_100028024 3300005578 Unclassified 3887
104 Ga0068856_100006168 3300005614 Bacteria 11761
105 Ga0070702_100226215 3300005615 Bacteria 1254
106 Ga0068852_100047059 3300005616 Bacteria 3678
107 Ga0068859_100041061 3300005617 Bacteria 4647
108 Ga0068859_100218518 3300005617 Bacteria 1993
109 Ga0068859_100305528 3300005617 Bacteria 1684
110 Ga0068864_100061929 3300005618 Unclassified 3241
111 Ga0068866_10135206 3300005718 Bacteria 1408
112 Ga0068861_100185437 3300005719 Bacteria 1735
113 Ga0068851_10185145 3300005834 Bacteria 1155
114 Ga0068863_100023382 3300005841 Bacteria 5904
115 Ga0068863_100056015 3300005841 Bacteria 3733
116 Ga0068863_100087432 3300005841 Unclassified 2953
117 Ga0068858_100015430 3300005842 Bacteria 7185
118 Ga0068858_100101662 3300005842 Bacteria 2681
119 Ga0068858_100185063 3300005842 Bacteria 1967
120 Ga0068860_100109083 3300005843 Bacteria 2645
121 Ga0068860_100158768 3300005843 Unclassified 2180
122 Ga0081540_1030546 3300005983 Bacteria 2981
123 Ga0081539_10010939 3300005985 Bacteria 7276
124 Ga0070717_10000442 3300006028 Bacteria 26293
125 Ga0070717_10003878 3300006028 Bacteria 10751
126 Ga0070717_10006061 3300006028 Bacteria 8865
127 Ga0070717_10169378 3300006028 Bacteria 1899
128 Ga0070717_10189854 3300006028 Unclassified 1795
129 Ga0070716_100001085 3300006173 Bacteria 11935
130 Ga0070716_100020370 3300006173 Unclassified 3481
131 Ga0070712_100001711 3300006175 Bacteria 13417
132 Ga0070712_100002289 3300006175 Bacteria 11794
133 Ga0070712_100002489 3300006175 Bacteria 11360
134 Ga0070712_100216443 3300006175 Bacteria 1514
135 Ga0097621_100014797 3300006237 Bacteria 5850
136 Ga0068871_100224460 3300006358 Bacteria 1629
137 Ga0075428_100002535 3300006844 Bacteria 19851
138 Ga0075431_100003497 3300006847 Bacteria 15231
139 Ga0075431_100556635 3300006847 Unclassified 1134
140 Ga0075433_10244465 3300006852 Bacteria 1593
141 Ga0075434_100013250 3300006871 Bacteria 7836
142 Ga0075429_100087842 3300006880 Bacteria 2710
143 Ga0068865_100246686 3300006881 Bacteria 1407
144 Ga0075436_100004693 3300006914 Bacteria 9374
145 Ga0075436_100106836 3300006914 Bacteria 1952
146 Ga0097620_100041063 3300006931 Bacteria 4647
147 Ga0097620_100218518 3300006931 Bacteria 1993
148 Ga0097620_100305532 3300006931 Bacteria 1684
149 Ga0075435_100040955 3300007076 Bacteria 3701
150 Ga0075435_100066051 3300007076 Unclassified 2942
151 Ga0099794_10006675 3300007265 Bacteria 4688
152 Ga0099794_10040747 3300007265 Bacteria 2210
153 Ga0099794_10050103 3300007265 Unclassified 2008
154 Ga0099794_10067791 3300007265 Bacteria 1744
155 Ga0105250_10113236 3300009092 Bacteria 1112
156 Ga0105240_10060872 3300009093 Bacteria 4706
157 Ga0105240_10111490 3300009093 Unclassified 3309
158 Ga0111539_10033595 3300009094 Bacteria 6228
159 Ga0114129_10176736 3300009147 Unclassified 2908
160 Ga0105243_10036452 3300009148 Bacteria 3818
161 Ga0105243_10191596 3300009148 Bacteria 1786
162 Ga0105241_10028102 3300009174 Unclassified 4189
163 Ga0105241_10092134 3300009174 Bacteria 2393
164 Ga0105242_10024658 3300009176 Bacteria 4752
165 Ga0105242_10220452 3300009176 Bacteria 1695
166 Ga0105248_10237816 3300009177 Bacteria 2050
167 Ga0105248_10333640 3300009177 Bacteria 1708
168 Ga0105248_10421637 3300009177 Bacteria 1503
169 Ga0105237_10448327 3300009545 Unclassified 1296
170 Ga0105238_10036276 3300009551 Bacteria 5010
171 Ga0105238_10182237 3300009551 Bacteria 2077
172 Ga0105238_10336955 3300009551 Bacteria 1496
173 Ga0105249_10004935 3300009553 Bacteria 11515
174 Ga0099796_10075291 3300010159 Unclassified 1227
175 Ga0105239_10414123 3300010375 Unclassified 1526
176 Ga0157373_10088201 3300013100 Bacteria 2186
177 Ga0157371_10010312 3300013102 Bacteria 7291
178 Ga0157370_10348053 3300013104 Bacteria 1366
179 Ga0157369_10068738 3300013105 Bacteria 3806
180 Ga0157369_10168137 3300013105 Bacteria 2311
181 Ga0157369_10337700 3300013105 Bacteria 1565
182 Ga0157374_10004000 3300013296 Bacteria 12387
183 Ga0157374_10019204 3300013296 Bacteria 6047
184 Ga0157374_10034799 3300013296 Bacteria 4604
185 Ga0157374_10388498 3300013296 Unclassified 1391
186 Ga0157378_10169641 3300013297 Bacteria 2046
187 Ga0163162_10353488 3300013306 Bacteria 1602
188 Ga0157372_10002713 3300013307 Bacteria 19156
189 Ga0157372_10005161 3300013307 Bacteria 13884
190 Ga0157372_10019884 3300013307 Bacteria 7237
191 Ga0157372_10141154 3300013307 Bacteria 2775
192 Ga0157372_10172042 3300013307 Bacteria 2506
193 Ga0157372_10826071 3300013307 Bacteria 1076
194 Ga0157375_10170744 3300013308 Unclassified 2322
195 Ga0163163_10073991 3300014325 Bacteria 3398
196 Ga0163163_10465755 3300014325 Bacteria 1324
197 Ga0157379_10324921 3300014968 Bacteria 1405
198 Ga0182006_1032480 3300015261 Bacteria 2098
199 Ga0182007_10018837 3300015262 Bacteria 2494
200 Ga0182005_1059631 3300015265 Bacteria 1042
201 Ga0224572_1006954 3300024225 Bacteria 2060
202 Ga0207656_10056209 3300025321 Bacteria 1715
203 Ga0207680_10098015 3300025903 Bacteria 1878
204 Ga0207647_10013010 3300025904 Bacteria 5781
205 Ga0207647_10068910 3300025904 Unclassified 2139
206 Ga0207699_10069738 3300025906 Unclassified 2145
207 Ga0207699_10104835 3300025906 Bacteria 1801
208 Ga0207699_10275090 3300025906 Unclassified 1168
209 Ga0207699_10291443 3300025906 Unclassified 1137
210 Ga0207684_10003864 3300025910 Bacteria 14392
211 Ga0207684_10009913 3300025910 Bacteria 8400
212 Ga0207684_10012365 3300025910 Bacteria 7428
213 Ga0207684_10059124 3300025910 Bacteria 3254
214 Ga0207684_10084121 3300025910 Bacteria 2709
215 Ga0207684_10086143 3300025910 Unclassified 2676
216 Ga0207654_10004925 3300025911 Bacteria 6761
217 Ga0207707_10218630 3300025912 Unclassified 1658
218 Ga0207695_10007887 3300025913 Bacteria 13438
219 Ga0207695_10008581 3300025913 Bacteria 12771
220 Ga0207671_10195380 3300025914 Bacteria 1579
221 Ga0207693_10000084 3300025915 Bacteria 84105
222 Ga0207693_10000386 3300025915 Bacteria 40440
223 Ga0207693_10029438 3300025915 Bacteria 4337
224 Ga0207693_10113611 3300025915 Bacteria 2124
225 Ga0207663_10005053 3300025916 Bacteria 6625
226 Ga0207663_10006167 3300025916 Bacteria 6108
227 Ga0207663_10025514 3300025916 Bacteria 3418
228 Ga0207657_10000770 3300025919 Bacteria 33991
229 Ga0207649_10057566 3300025920 Unclassified 2431
230 Ga0207652_10024653 3300025921 Bacteria 4992
231 Ga0207652_10030236 3300025921 Bacteria 4534
232 Ga0207652_10197583 3300025921 Bacteria 1810
233 Ga0207646_10003435 3300025922 Bacteria 17891
234 Ga0207646_10011035 3300025922 Bacteria 8773
235 Ga0207646_10015638 3300025922 Bacteria 7156
236 Ga0207646_10270316 3300025922 Bacteria 1536
237 Ga0207681_10300750 3300025923 Bacteria 1269
238 Ga0207650_10052967 3300025925 Unclassified 3007
239 Ga0207687_10002428 3300025927 Bacteria 12650
240 Ga0207700_10000207 3300025928 Bacteria 35195
241 Ga0207700_10146976 3300025928 Bacteria 1944
242 Ga0207700_10303624 3300025928 Unclassified 1379
243 Ga0207664_10032750 3300025929 Bacteria 3987
244 Ga0207664_10118116 3300025929 Bacteria 2215
245 Ga0207690_10147690 3300025932 Unclassified 1740
246 Ga0207706_10000687 3300025933 Bacteria 35398
247 Ga0207709_10039842 3300025935 Bacteria 2809
248 Ga0207670_10321532 3300025936 Bacteria 1217
249 Ga0207704_10405356 3300025938 Bacteria 1077
250 Ga0207665_10000136 3300025939 Bacteria 48958
251 Ga0207665_10050784 3300025939 Unclassified 2790
252 Ga0207665_10071045 3300025939 Unclassified 2376
253 Ga0207665_10090652 3300025939 Bacteria 2119
254 Ga0207665_10154867 3300025939 Bacteria 1644
255 Ga0207665_10250025 3300025939 Bacteria 1310
256 Ga0207691_10177517 3300025940 Bacteria 1862
257 Ga0207711_10007257 3300025941 Bacteria 9286
258 Ga0207711_10223390 3300025941 Bacteria 1723
259 Ga0207689_10000901 3300025942 Bacteria 28528
260 Ga0207661_10001001 3300025944 Bacteria 18654
261 Ga0207661_10681313 3300025944 Bacteria 945
262 Ga0207679_10321918 3300025945 Bacteria 1339
263 Ga0207667_10004797 3300025949 Bacteria 16535
264 Ga0207667_10599382 3300025949 Bacteria 1111
265 Ga0207712_10022215 3300025961 Bacteria 4175
266 Ga0207668_10042604 3300025972 Bacteria 3075
267 Ga0207640_10044971 3300025981 Bacteria 2833
268 Ga0207658_10185185 3300025986 Bacteria 1726
269 Ga0207703_10007660 3300026035 Bacteria 8555
270 Ga0207703_10057625 3300026035 Bacteria 3169
271 Ga0207639_10422591 3300026041 Bacteria 1205
272 Ga0207678_10001244 3300026067 Bacteria 23504
273 Ga0207702_10012479 3300026078 Bacteria 7070
274 Ga0207641_10004872 3300026088 Bacteria 11549
275 Ga0207641_10065483 3300026088 Bacteria 3109
276 Ga0207641_10073631 3300026088 Unclassified 2944
277 Ga0207648_10006876 3300026089 Bacteria 11280
278 Ga0207648_10016621 3300026089 Bacteria 6716
279 Ga0207676_10472614 3300026095 Bacteria 1186
280 Ga0207674_10008896 3300026116 Bacteria 11546
281 Ga0207674_10049804 3300026116 Bacteria 4282
282 Ga0207675_100560763 3300026118 Bacteria 1142
283 Ga0207698_10393534 3300026142 Bacteria 1322
284 Ga0209588_1002852 3300027671 Bacteria 4740
285 Ga0209588_1003168 3300027671 Bacteria 4537
286 Ga0209588_1039267 3300027671 Bacteria 1526
287 Ga0265354_1002258 3300028016 Bacteria 2436
288 Ga0265354_1002285 3300028016 Bacteria 2417
289 Ga0268266_10059538 3300028379 Unclassified 3291
290 Ga0268265_10133918 3300028380 Bacteria 2064
291 Ga0268264_10180591 3300028381 Bacteria 1916
292 Ga0268264_10192567 3300028381 Bacteria 1860
293 Ga0268264_10335056 3300028381 Bacteria 1435
294 Ga0265760_10000150 3300031090 Bacteria 17997
295 Ga0265760_10008935 3300031090 Unclassified 2862
296 Ga0265760_10015907 3300031090 Unclassified 2158
297 Ga0265325_10005033 3300031241 Bacteria 8225
298 Ga0265325_10132094 3300031241 Bacteria 1194
299 Ga0265339_10083817 3300031249 Bacteria 1681
300 Ga0265316_10000888 3300031344 Bacteria 32784
301 Ga0265316_10126132 3300031344 Bacteria 1930
302 Ga0265316_10154855 3300031344 Unclassified 1715
303 Ga0316212_1005887 3300033547 Unclassified 1779
304 Ga0373923_0071912 3300035111 Unclassified 1487
305 Ga0373936_0004496 3300035113 Bacteria 5276
306 Ga0373954_0010981 3300035118 Bacteria 4006
307 Ga0373954_0028488 3300035118 Unclassified 2568
308 Ga0373943_0048102 3300035170 Bacteria 2088
309 Ga0373943_0182571 3300035170 Bacteria 1154
310 Ga0373955_0003600 3300035172 Bacteria 6817
311 Ga0373955_0102734 3300035172 Unclassified 1643
312 Ga0373961_0032079 3300035241 Unclassified 1471
313 Ga0373935_0051130 3300035692 Bacteria 2624
314 Ga0373935_0057438 3300035692 Unclassified 2482
315 Ga0373935_0157858 3300035692 Bacteria 1544
316 Ga0373933_0001405 3300035724 Bacteria 14141
317 Ga0373947_0067064 3300035725 Unclassified 2191
318 Ga0373937_0000250 3300036401 Bacteria 52583
319 Ga0373937_0012670 3300036401 Bacteria 7421
320 Ga0373937_0072842 3300036401 Bacteria 3169
321 Ga0373937_0305405 3300036401 Unclassified 1504
322 Ga0373937_0598456 3300036401 Bacteria 1047
323 Ga0373925_0039186 3300037068 Bacteria 3505
324 Ga0436365_0590769 3300039437 Bacteria 1315
325 Ga0453683_0045687 3300044673 Bacteria 2746
326 Ga0466963_0047166 3300044694 Bacteria 2843
327 Ga0451576_0347541 3300045051 Bacteria 1553
328 Ga0466967_0026613 3300045976 Bacteria 4793
329 Ga0466967_0157527 3300045976 Bacteria 2129
330 Ga0495629_0017843 3300046459 Bacteria 5087
331 Ga0495651_0009448 3300046462 Bacteria 7490
332 Ga0495653_0090055 3300046463 Bacteria 2246
333 Ga0495580_0001042 3300046472 Bacteria 24345
334 Ga0495580_0009414 3300046472 Bacteria 7684
335 Ga0495582_0000860 3300046473 Bacteria 16879
336 Ga0495639_0045685 3300046475 Unclassified 1982
337 Ga0495666_0023672 3300046526 Bacteria 3037
338 Ga0495665_0109953 3300046531 Bacteria 1446
339 Ga0495640_0119567 3300046533 Unclassified 1714
340 Ga0495587_0003432 3300046536 Bacteria 10571
341 Ga0495587_0011610 3300046536 Bacteria 5578
342 Ga0495645_0057282 3300046543 Unclassified 2829
343 Ga0495667_0016069 3300046559 Bacteria 5059
344 Ga0495657_0138271 3300046675 Bacteria 1520
345 Ga0495599_0174716 3300046678 Unclassified 1325
346 Ga0495623_0099894 3300046679 Bacteria 1769
347 Ga0495658_0254253 3300046683 Bacteria 1105
348 Ga0495604_0000529 3300047317 Bacteria 33758
349 Ga0495674_0070404 3300047319 Bacteria 3023
350 Ga0495675_0055874 3300047444 Bacteria 2504
351 Ga0495684_0002283 3300047471 Bacteria 15344
352 Ga0495602_0012902 3300048088 Bacteria 8563
353 Ga0496100_0076924 3300048903 Unclassified 2242
354 Ga0496104_0117730 3300048907 Unclassified 2550
355 Ga0496106_0028712 3300048909 Bacteria 4144
356 Ga0496107_0047567 3300048910 Bacteria 3089
357 Ga0496109_0194163 3300048912 Bacteria 1908
358 Ga0496109_0205686 3300048912 Bacteria 1851
359 Ga0496109_0779541 3300048912 Unclassified 894
360 Ga0496112_0037273 3300048915 Bacteria 4746
361 Ga0496113_0352103 3300048916 Bacteria 1181
362 Ga0496114_0040152 3300048917 Bacteria 3873
363 Ga0496115_0031118 3300048918 Bacteria 4202
364 Ga0496115_0104417 3300048918 Bacteria 2325
365 nmdc:mga05p37_519484_c1 3300050507 Unclassified 1362
366 nmdc:mga05p37_948258_c1 3300050507 Unclassified 921
367 nmdc:mga09592_76845_c1 3300050508 Bacteria 2840
368 nmdc:mga06r32_151210_c1 3300050510 Bacteria 2300
369 nmdc:mga08y16_6090_c1 3300050511 Bacteria 12650
370 nmdc:mga0n895_103039_c1 3300050512 Unclassified 2865
371 nmdc:mga0n895_293116_c1 3300050512 Bacteria 1649
372 nmdc:mga0rr50_284748_c1 3300050513 Unclassified 1380
373 nmdc:mga0rr50_71277_c1 3300050513 Bacteria 2651
374 nmdc:mga08x19_190679_c1 3300050514 Unclassified 1402
375 nmdc:mga08x19_251731_c1 3300050514 Unclassified 1220
376 nmdc:mga08x19_44433_c1 3300050514 Unclassified 2837
377 nmdc:mga0a205_130497_c1 3300050515 Unclassified 2413
378 nmdc:mga0a205_218984_c1 3300050515 Bacteria 1790
379 Ga0495601_0025478 3300053077 Bacteria 3648
380 Ga0373923_0102041
381 Ga0065715_10258102
382 Ga0065707_10016457
383 Ga0070658_10177223
384 Ga0070676_10018432
385 Ga0070683_100001100
386 Ga0070683_100245255
387 Ga0070690_100240434
388 Ga0068869_100050859
389 Ga0070666_10024852
390 Ga0070666_10256735
391 Ga0070682_100045098
392 Ga0068868_100001598
393 Ga0070660_100083188
394 Ga0070660_100116091
395 Ga0070687_100180469
396 Ga0070661_100236348
397 Ga0070661_100457380
398 Ga0070661_100500851
399 Ga0070668_100014267
400 Ga0070669_100319713
401 Ga0070669_100398853
402 Ga0070675_100320415
403 Ga0070671_100570491
404 Ga0070659_100030418
405 Ga0070659_100475815
406 Ga0070667_100127759
407 Ga0070709_10034560
408 Ga0070709_10046407
409 Ga0070714_100016874
410 Ga0070714_100021945
411 Ga0070713_100003252
412 Ga0070713_100195031
413 Ga0070713_100207543
414 Ga0070710_10027742
415 Ga0070701_10215101
416 Ga0070711_100000184
417 Ga0070711_100001678
418 Ga0070711_100031845
419 Ga0070705_100071202
420 Ga0070705_100095722
421 Ga0070694_100006224
422 Ga0070694_100108681
423 Ga0070694_100172362
424 Ga0070708_100000679
425 Ga0070708_100008937
426 Ga0070708_100042355
427 Ga0070708_100095102
428 Ga0070708_100461147
429 Ga0070663_100181222
430 Ga0070663_100260481
431 Ga0070662_100001344
432 Ga0070681_10224687
433 Ga0068867_100647805
434 Ga0070685_10221824
435 Ga0070706_100000454
436 Ga0070706_100009824
437 Ga0070706_100075036
438 Ga0070706_100113163
439 Ga0070706_100261500
440 Ga0070706_100316255
441 Ga0070707_100000497
442 Ga0070707_100035343
443 Ga0070707_100294649
444 Ga0070698_100001288
445 Ga0070698_100009995
446 Ga0070698_100049551
447 Ga0070698_100095288
448 Ga0070698_100500310
449 Ga0070699_100014814
450 Ga0070699_100016649
451 Ga0070699_100076127
452 Ga0070699_100106621
453 Ga0070699_100362549
454 Ga0070679_100041588
455 Ga0070684_100001196
456 Ga0070684_100058925
457 Ga0070684_100172358
458 Ga0070697_100000411
459 Ga0070697_100000671
460 Ga0070697_100000784
461 Ga0070697_100002338
462 Ga0070697_100005876
463 Ga0070697_100008836
464 Ga0070697_100092533
465 Ga0070697_100136030
466 Ga0070697_100234060
467 Ga0068853_100214483
468 Ga0070672_100173396
469 Ga0070695_100001473
470 Ga0070695_100014719
471 Ga0070695_100111676
472 Ga0070696_100001746
473 Ga0070693_100000070
474 Ga0070693_100089443
475 Ga0070693_100177377
476 Ga0070665_100247096
477 Ga0070704_100008207
478 Ga0070704_100191911
479 Ga0070704_100297080
480 Ga0068855_100139379
481 Ga0070664_100016650
482 Ga0068854_100028024
483 Ga0068856_100006168
484 Ga0070702_100226215
485 Ga0068852_100047059
486 Ga0068859_100041061
487 Ga0068859_100218518
488 Ga0068859_100305528
489 Ga0068864_100061929
490 Ga0068866_10135206
491 Ga0068861_100185437
492 Ga0068851_10185145
493 Ga0068863_100023382
494 Ga0068863_100056015
495 Ga0068863_100087432
496 Ga0068858_100015430
497 Ga0068858_100101662
498 Ga0068858_100185063
499 Ga0068860_100109083
500 Ga0068860_100158768
501 Ga0081540_1030546
502 Ga0081539_10010939
503 Ga0070717_10000442
504 Ga0070717_10003878
505 Ga0070717_10006061
506 Ga0070717_10169378
507 Ga0070717_10189854
508 Ga0070716_100001085
509 Ga0070716_100020370
510 Ga0070712_100001711
511 Ga0070712_100002289
512 Ga0070712_100002489
513 Ga0070712_100216443
514 Ga0097621_100014797
515 Ga0068871_100224460
516 Ga0075428_100002535
517 Ga0075431_100003497
518 Ga0075431_100556635
519 Ga0075433_10244465
520 Ga0075434_100013250
521 Ga0075429_100087842
522 Ga0068865_100246686
523 Ga0075436_100004693
524 Ga0075436_100106836
525 Ga0097620_100041063
526 Ga0097620_100218518
527 Ga0097620_100305532
528 Ga0075435_100040955
529 Ga0075435_100066051
530 Ga0099794_10006675
531 Ga0099794_10040747
532 Ga0099794_10050103
533 Ga0099794_10067791
534 Ga0105250_10113236
535 Ga0105240_10060872
536 Ga0105240_10111490
537 Ga0111539_10033595
538 Ga0114129_10176736
539 Ga0105243_10036452
540 Ga0105243_10191596
541 Ga0105241_10028102
542 Ga0105241_10092134
543 Ga0105242_10024658
544 Ga0105242_10220452
545 Ga0105248_10237816
546 Ga0105248_10333640
547 Ga0105248_10421637
548 Ga0105237_10448327
549 Ga0105238_10036276
550 Ga0105238_10182237
551 Ga0105238_10336955
552 Ga0105249_10004935
553 Ga0099796_10075291
554 Ga0105239_10414123
555 Ga0157373_10088201
556 Ga0157371_10010312
557 Ga0157370_10348053
558 Ga0157369_10068738
559 Ga0157369_10168137
560 Ga0157369_10337700
561 Ga0157374_10004000
562 Ga0157374_10019204
563 Ga0157374_10034799
564 Ga0157374_10388498
565 Ga0157378_10169641
566 Ga0163162_10353488
567 Ga0157372_10002713
568 Ga0157372_10005161
569 Ga0157372_10019884
570 Ga0157372_10141154
571 Ga0157372_10172042
572 Ga0157372_10826071
573 Ga0157375_10170744
574 Ga0163163_10073991
575 Ga0163163_10465755
576 Ga0157379_10324921
577 Ga0182006_1032480
578 Ga0182007_10018837
579 Ga0182005_1059631
580 Ga0224572_1006954
581 Ga0207656_10056209
582 Ga0207680_10098015
583 Ga0207647_10013010
584 Ga0207647_10068910
585 Ga0207699_10069738
586 Ga0207699_10104835
587 Ga0207699_10275090
588 Ga0207699_10291443
589 Ga0207684_10003864
590 Ga0207684_10009913
591 Ga0207684_10012365
592 Ga0207684_10059124
593 Ga0207684_10084121
594 Ga0207684_10086143
595 Ga0207654_10004925
596 Ga0207707_10218630
597 Ga0207695_10007887
598 Ga0207695_10008581
599 Ga0207671_10195380
600 Ga0207693_10000084
601 Ga0207693_10000386
602 Ga0207693_10029438
603 Ga0207693_10113611
604 Ga0207663_10005053
605 Ga0207663_10006167
606 Ga0207663_10025514
607 Ga0207657_10000770
608 Ga0207649_10057566
609 Ga0207652_10024653
610 Ga0207652_10030236
611 Ga0207652_10197583
612 Ga0207646_10003435
613 Ga0207646_10011035
614 Ga0207646_10015638
615 Ga0207646_10270316
616 Ga0207681_10300750
617 Ga0207650_10052967
618 Ga0207687_10002428
619 Ga0207700_10000207
620 Ga0207700_10146976
621 Ga0207700_10303624
622 Ga0207664_10032750
623 Ga0207664_10118116
624 Ga0207690_10147690
625 Ga0207706_10000687
626 Ga0207709_10039842
627 Ga0207670_10321532
628 Ga0207704_10405356
629 Ga0207665_10000136
630 Ga0207665_10050784
631 Ga0207665_10071045
632 Ga0207665_10090652
633 Ga0207665_10154867
634 Ga0207665_10250025
635 Ga0207691_10177517
636 Ga0207711_10007257
637 Ga0207711_10223390
638 Ga0207689_10000901
639 Ga0207661_10001001
640 Ga0207661_10681313
641 Ga0207679_10321918
642 Ga0207667_10004797
643 Ga0207667_10599382
644 Ga0207712_10022215
645 Ga0207668_10042604
646 Ga0207640_10044971
647 Ga0207658_10185185
648 Ga0207703_10007660
649 Ga0207703_10057625
650 Ga0207639_10422591
651 Ga0207678_10001244
652 Ga0207702_10012479
653 Ga0207641_10004872
654 Ga0207641_10065483
655 Ga0207641_10073631
656 Ga0207648_10006876
657 Ga0207648_10016621
658 Ga0207676_10472614
659 Ga0207674_10008896
660 Ga0207674_10049804
661 Ga0207675_100560763
662 Ga0207698_10393534
663 Ga0209588_1002852
664 Ga0209588_1003168
665 Ga0209588_1039267
666 Ga0265354_1002258
667 Ga0265354_1002285
668 Ga0268266_10059538
669 Ga0268265_10133918
670 Ga0268264_10180591
671 Ga0268264_10192567
672 Ga0268264_10335056
673 Ga0265760_10000150
674 Ga0265760_10008935
675 Ga0265760_10015907
676 Ga0265325_10005033
677 Ga0265325_10132094
678 Ga0265339_10083817
679 Ga0265316_10000888
680 Ga0265316_10126132
681 Ga0265316_10154855
682 Ga0316212_1005887
683 Ga0373923_0071912
684 Ga0373936_0004496
685 Ga0373954_0010981
686 Ga0373954_0028488
687 Ga0373943_0048102
688 Ga0373943_0182571
689 Ga0373955_0003600
690 Ga0373955_0102734
691 Ga0373961_0032079
692 Ga0373935_0051130
693 Ga0373935_0057438
694 Ga0373935_0157858
695 Ga0373933_0001405
696 Ga0373947_0067064
697 Ga0373937_0000250
698 Ga0373937_0012670
699 Ga0373937_0072842
700 Ga0373937_0305405
701 Ga0373937_0598456
702 Ga0373925_0039186
703 Ga0436365_0590769
704 Ga0453683_0045687
705 Ga0466963_0047166
706 Ga0451576_0347541
707 Ga0466967_0026613
708 Ga0466967_0157527
709 Ga0495629_0017843
710 Ga0495651_0009448
711 Ga0495653_0090055
712 Ga0495580_0001042
713 Ga0495580_0009414
714 Ga0495582_0000860
715 Ga0495639_0045685
716 Ga0495666_0023672
717 Ga0495665_0109953
718 Ga0495640_0119567
719 Ga0495587_0003432
720 Ga0495587_0011610
721 Ga0495645_0057282
722 Ga0495667_0016069
723 Ga0495657_0138271
724 Ga0495599_0174716
725 Ga0495623_0099894
726 Ga0495658_0254253
727 Ga0495604_0000529
728 Ga0495674_0070404
729 Ga0495675_0055874
730 Ga0495684_0002283
731 Ga0495602_0012902
732 Ga0496100_0076924
733 Ga0496104_0117730
734 Ga0496106_0028712
735 Ga0496107_0047567
736 Ga0496109_0194163
737 Ga0496109_0205686
738 Ga0496109_0779541
739 Ga0496112_0037273
740 Ga0496113_0352103
741 Ga0496114_0040152
742 Ga0496115_0031118
743 Ga0496115_0104417
744 nmdc:mga05p37_519484_c1
745 nmdc:mga05p37_948258_c1
746 nmdc:mga09592_76845_c1
747 nmdc:mga06r32_151210_c1
748 nmdc:mga08y16_6090_c1
749 nmdc:mga0n895_103039_c1
750 nmdc:mga0n895_293116_c1
751 nmdc:mga0rr50_284748_c1
752 nmdc:mga0rr50_71277_c1
753 nmdc:mga08x19_190679_c1
754 nmdc:mga08x19_251731_c1
755 nmdc:mga08x19_44433_c1
756 nmdc:mga0a205_130497_c1
757 nmdc:mga0a205_218984_c1
758 Ga0495601_0025478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

51

283

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8787 36 263
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8555 36 263
3l23-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase/epimerase (yp_001303399.1) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8483 36 282
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8258 30 284
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8218 32 285
ID Description Score Start End Superfamily
af_P32134_16_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8169 36 266 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8014 36 284 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7955 36 284 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7866 32 285 3.20.20.150
af_P32134_16_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7772 36 266 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A1Q6YDU6-F1-model_v4 Xylose isomerase 0.9953 36 285 GO:0016853
AF-A0A3D1AXT5-F1-model_v4 Xylose isomerase 0.9858 135 287 GO:0016853
AF-A0A359LM66-F1-model_v4 Xylose isomerase 0.9819 35 287 GO:0016853
AF-A0A2V9BM78-F1-model_v4 Xylose isomerase 0.9819 64 166 GO:0016853
AF-A0A1Q6YDU6-F1-model_v4 Xylose isomerase 0.9796 36 285 GO:0016853

Map