F428457

General Info

Members Datasets Scaffolds Average Seq Length
379 237 758 62

Family's Representative Sequence

Representative Sequence 3300046678|Ga0495599_0427392|Ga0495599_0427392_541_744
Length 67
Sequence MEVSMANHLTPAELADQLRMKRQEVIGKCVEMGVPIFHGRIDRTLFETSLRQLSSGPGVRSGASAQH

Samples

Sample ID Description Type Environment
1 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
129 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
130 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 2.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 9.76
Rhizosphere 82.32
Stem 0
Stem Tuber 0
Unclassified 20.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495599_0427392 3300046678 Bacteria 786
2 LJNas_1007082 3300000546 Unclassified 1213
3 JGI24740J21852_10002623 3300001979 Bacteria 8098
4 JGI24034J26672_10000086 3300002239 Bacteria 17704
5 JGI24742J22300_10007450 3300002244 Bacteria 1807
6 Ga0065707_10568376 3300005295 Bacteria 710
7 Ga0070658_10638150 3300005327 Unclassified 924
8 Ga0070683_100799278 3300005329 Bacteria 904
9 Ga0070666_10048502 3300005335 Bacteria 2854
10 Ga0070666_10177286 3300005335 Bacteria 1494
11 Ga0070680_100304769 3300005336 Bacteria 1351
12 Ga0070682_100000032 3300005337 Bacteria 155141
13 Ga0068868_100000978 3300005338 Bacteria 19469
14 Ga0070691_10000003 3300005341 Bacteria 86538
15 Ga0070661_100000236 3300005344 Bacteria 45535
16 Ga0070661_100697942 3300005344 Unclassified 827
17 Ga0070668_100757496 3300005347 Bacteria 860
18 Ga0070659_101262881 3300005366 Bacteria 654
19 Ga0070667_100019543 3300005367 Bacteria 5621
20 Ga0070667_100301090 3300005367 Bacteria 1444
21 Ga0070714_100141426 3300005435 Bacteria 2161
22 Ga0070714_100349720 3300005435 Bacteria 1388
23 Ga0070711_100002459 3300005439 Bacteria 10566
24 Ga0070711_100437839 3300005439 Bacteria 1068
25 Ga0070700_100281446 3300005441 Bacteria 1206
26 Ga0070663_100001455 3300005455 Bacteria 13013
27 Ga0070663_101215313 3300005455 Unclassified 663
28 Ga0070678_100113504 3300005456 Bacteria 2124
29 Ga0070678_100673810 3300005456 Unclassified 929
30 Ga0070678_100884123 3300005456 Bacteria 816
31 Ga0070685_10145908 3300005466 Bacteria 1495
32 Ga0070685_11129742 3300005466 Bacteria 593
33 Ga0070679_100000527 3300005530 Bacteria 32553
34 Ga0070684_100144007 3300005535 Bacteria 2156
35 Ga0070684_100180405 3300005535 Bacteria 1920
36 Ga0070684_101277393 3300005535 Bacteria 691
37 Ga0070684_102301903 3300005535 Bacteria 508
38 Ga0070686_100462022 3300005544 Bacteria 978
39 Ga0070695_100127441 3300005545 Bacteria 1750
40 Ga0070665_100002631 3300005548 Bacteria 19567
41 Ga0070665_100214316 3300005548 Bacteria 1927
42 Ga0070665_100422131 3300005548 Bacteria 1342
43 Ga0070665_101068607 3300005548 Bacteria 819
44 Ga0070665_101576676 3300005548 Bacteria 665
45 Ga0070704_100339647 3300005549 Bacteria 1264
46 Ga0068855_100583554 3300005563 Bacteria 1207
47 Ga0068855_101776336 3300005563 Bacteria 627
48 Ga0070664_101032123 3300005564 Bacteria 773
49 Ga0068857_101091208 3300005577 Bacteria 770
50 Ga0068854_100000133 3300005578 Bacteria 51376
51 Ga0068856_100632060 3300005614 Bacteria 1091
52 Ga0070702_100023007 3300005615 Bacteria 3305
53 Ga0068852_100725510 3300005616 Bacteria 1005
54 Ga0068859_100764402 3300005617 Bacteria 1055
55 Ga0068866_10026919 3300005718 Bacteria 2722
56 Ga0068851_10000247 3300005834 Bacteria 25479
57 Ga0068870_11210945 3300005840 Unclassified 547
58 Ga0068863_100000110 3300005841 Bacteria 86415
59 Ga0068863_100012362 3300005841 Bacteria 8244
60 Ga0068863_100018968 3300005841 Bacteria 6583
61 Ga0068858_100505445 3300005842 Bacteria 1168
62 Ga0081455_10063268 3300005937 Bacteria 3105
63 Ga0081455_10691362 3300005937 Unclassified 651
64 Ga0075363_100257916 3300006048 Archaea 1005
65 Ga0075364_10782044 3300006051 Unclassified 651
66 Ga0070715_10016760 3300006163 Bacteria 2760
67 Ga0075433_10004466 3300006852 Bacteria 10896
68 Ga0097620_100764269 3300006931 Bacteria 1055
69 Ga0105240_10363786 3300009093 Bacteria 1638
70 Ga0105240_11248332 3300009093 Unclassified 785
71 Ga0105245_10003467 3300009098 Bacteria 14119
72 Ga0105247_10000064 3300009101 Bacteria 123994
73 Ga0105247_10248293 3300009101 Bacteria 1215
74 Ga0105247_10352259 3300009101 Bacteria 1036
75 Ga0114129_11852371 3300009147 Unclassified 733
76 Ga0105241_10330924 3300009174 Bacteria 1316
77 Ga0105241_11422553 3300009174 Unclassified 665
78 Ga0105242_10000123 3300009176 Bacteria 56900
79 Ga0105242_10000589 3300009176 Bacteria 28679
80 Ga0105242_11044905 3300009176 Unclassified 827
81 Ga0105248_10304496 3300009177 Bacteria 1795
82 Ga0105248_11179549 3300009177 Bacteria 866
83 Ga0105237_10313935 3300009545 Bacteria 1571
84 Ga0105238_10058293 3300009551 Bacteria 3871
85 Ga0105249_10293973 3300009553 Bacteria 1627
86 Ga0105239_10060890 3300010375 Bacteria 4143
87 Ga0105239_10929053 3300010375 Bacteria 999
88 Ga0157370_10003648 3300013104 Bacteria 17997
89 Ga0157374_10002241 3300013296 Bacteria 16284
90 Ga0157374_10041123 3300013296 Bacteria 4258
91 Ga0157374_11235930 3300013296 Unclassified 768
92 Ga0163162_10119144 3300013306 Bacteria 2742
93 Ga0157372_10000809 3300013307 Bacteria 33940
94 Ga0157375_10000126 3300013308 Bacteria 75410
95 Ga0157375_10093081 3300013308 Bacteria 3079
96 Ga0157375_10427037 3300013308 Unclassified 1491
97 Ga0157375_13032656 3300013308 Unclassified 561
98 Ga0163163_10304838 3300014325 Bacteria 1645
99 Ga0163163_11073051 3300014325 Bacteria 868
100 Ga0163163_12378225 3300014325 Bacteria 588
101 Ga0163163_12931804 3300014325 Unclassified 532
102 Ga0157380_10079655 3300014326 Bacteria 2675
103 Ga0157377_11753899 3300014745 Bacteria 503
104 Ga0157379_10154872 3300014968 Bacteria 2067
105 Ga0157379_10186020 3300014968 Bacteria 1877
106 Ga0157379_11527924 3300014968 Unclassified 650
107 Ga0157379_11761467 3300014968 Unclassified 608
108 Ga0157376_10739481 3300014969 Bacteria 992
109 Ga0163161_10000013 3300017792 Bacteria 258747
110 Ga0163161_10320251 3300017792 Bacteria 1226
111 Ga0197907_10969773 3300020069 Unclassified 630
112 Ga0206356_10517561 3300020070 Bacteria 662
113 Ga0206351_10315475 3300020077 Unclassified 763
114 Ga0206352_10925360 3300020078 Unclassified 523
115 Ga0206350_11335362 3300020080 Bacteria 515
116 Ga0206350_11567552 3300020080 Unclassified 527
117 Ga0206354_10274994 3300020081 Bacteria 1143
118 Ga0154015_1094621 3300020610 Unclassified 815
119 Ga0224712_10125227 3300022467 Bacteria 1117
120 Ga0207656_10002300 3300025321 Bacteria 6417
121 Ga0207710_10000165 3300025900 Bacteria 69714
122 Ga0207710_10046349 3300025900 Unclassified 1941
123 Ga0207710_10128391 3300025900 Bacteria 1216
124 Ga0207680_10023163 3300025903 Bacteria 3387
125 Ga0207680_10103719 3300025903 Bacteria 1832
126 Ga0207680_10280830 3300025903 Bacteria 1157
127 Ga0207685_10030940 3300025905 Bacteria 1911
128 Ga0207643_10405537 3300025908 Unclassified 862
129 Ga0207705_11127868 3300025909 Unclassified 603
130 Ga0207654_10491552 3300025911 Unclassified 865
131 Ga0207707_10267104 3300025912 Bacteria 1483
132 Ga0207695_10378132 3300025913 Unclassified 1302
133 Ga0207695_10568144 3300025913 Unclassified 1015
134 Ga0207671_10092850 3300025914 Bacteria 2276
135 Ga0207663_10000767 3300025916 Bacteria 14344
136 Ga0207660_10271501 3300025917 Bacteria 1344
137 Ga0207649_10000166 3300025920 Bacteria 53758
138 Ga0207652_10000437 3300025921 Bacteria 43281
139 Ga0207694_10124879 3300025924 Bacteria 2058
140 Ga0207687_10187896 3300025927 Bacteria 1605
141 Ga0207664_10219603 3300025929 Bacteria 1648
142 Ga0207686_10000066 3300025934 Bacteria 95095
143 Ga0207686_10000967 3300025934 Bacteria 17098
144 Ga0207704_10138369 3300025938 Unclassified 1699
145 Ga0207661_10013529 3300025944 Bacteria 5959
146 Ga0207661_10748389 3300025944 Bacteria 899
147 Ga0207667_11550357 3300025949 Bacteria 632
148 Ga0207712_10474897 3300025961 Bacteria 1065
149 Ga0207668_10608692 3300025972 Bacteria 952
150 Ga0207640_10000147 3300025981 Bacteria 51462
151 Ga0207658_10141837 3300025986 Unclassified 1945
152 Ga0207658_10251695 3300025986 Bacteria 1501
153 Ga0207677_10005583 3300026023 Bacteria 6833
154 Ga0207703_10000122 3300026035 Bacteria 92656
155 Ga0207703_10649398 3300026035 Bacteria 1001
156 Ga0207678_10003762 3300026067 Bacteria 13646
157 Ga0207678_10376604 3300026067 Bacteria 1227
158 Ga0207708_10316049 3300026075 Bacteria 1273
159 Ga0207702_10495230 3300026078 Unclassified 1191
160 Ga0207702_10937704 3300026078 Bacteria 858
161 Ga0207641_10000065 3300026088 Bacteria 156066
162 Ga0207641_10008293 3300026088 Bacteria 8586
163 Ga0207641_10013865 3300026088 Bacteria 6612
164 Ga0207676_10000025 3300026095 Bacteria 261714
165 Ga0207675_102724976 3300026118 Unclassified 502
166 Ga0207683_10069565 3300026121 Bacteria 3109
167 Ga0207698_10197572 3300026142 Bacteria 1798
168 Ga0207698_11176069 3300026142 Bacteria 781
169 Ga0268266_10000973 3300028379 Bacteria 36388
170 Ga0268266_10002641 3300028379 Bacteria 18887
171 Ga0268266_10221670 3300028379 Bacteria 1739
172 Ga0268266_10724426 3300028379 Unclassified 959
173 Ga0268266_10991226 3300028379 Unclassified 813
174 Ga0265326_10041207 3300028558 Bacteria 1311
175 Ga0265319_1000030 3300028563 Bacteria 129742
176 Ga0265336_10008315 3300028666 Bacteria 3647
177 Ga0265338_10000156 3300028800 Bacteria 125065
178 Ga0265325_10212706 3300031241 Unclassified 887
179 Ga0265331_10195716 3300031250 Bacteria 911
180 Ga0373954_0198109 3300035118 Bacteria 987
181 Ga0373956_0350671 3300035119 Bacteria 704
182 Ga0373937_0482499 3300036401 Unclassified 1177
183 Ga0316582_0815702 3300036647 Bacteria 639
184 Ga0451791_1123960 3300041451 Bacteria 507
185 Ga0451804_0012943 3300041463 Unclassified 612
186 Ga0451807_0264330 3300041486 Bacteria 2611
187 Ga0451807_1086899 3300041486 Unclassified 800
188 Ga0451835_0937288 3300041492 Bacteria 904
189 Ga0451839_1112076 3300041496 Unclassified 546
190 Ga0451845_0446452 3300041501 Unclassified 881
191 Ga0451853_1819686 3300041512 Unclassified 2893
192 Ga0466965_0115628 3300044683 Bacteria 1382
193 Ga0466957_0074256 3300044842 Bacteria 2108
194 Ga0466960_0943817 3300044901 Unclassified 528
195 Ga0466967_0875796 3300045976 Unclassified 893
196 Ga0466967_1889452 3300045976 Unclassified 594
197 Ga0495592_0000752 3300046454 Bacteria 22576
198 Ga0495592_0336397 3300046454 Unclassified 972
199 Ga0495592_0569783 3300046454 Unclassified 694
200 Ga0495629_0029334 3300046459 Bacteria 3902
201 Ga0495629_0044723 3300046459 Unclassified 3107
202 Ga0495641_0038942 3300046461 Bacteria 2220
203 Ga0495641_0054108 3300046461 Bacteria 1824
204 Ga0495641_0495773 3300046461 Unclassified 557
205 Ga0495651_0113387 3300046462 Bacteria 2001
206 Ga0495653_0029557 3300046463 Bacteria 4373
207 Ga0495653_0275487 3300046463 Unclassified 1106
208 Ga0495653_0316683 3300046463 Bacteria 1012
209 Ga0495662_0000212 3300046476 Bacteria 24249
210 Ga0495662_0081700 3300046476 Unclassified 1572
211 Ga0495594_0000001 3300046499 Bacteria 293051
212 Ga0495608_0004956 3300046511 Bacteria 9532
213 Ga0495610_0166141 3300046512 Bacteria 929
214 Ga0495618_0000037 3300046514 Bacteria 99735
215 Ga0495618_0228897 3300046514 Unclassified 1171
216 Ga0495628_0002292 3300046516 Bacteria 17305
217 Ga0495628_0018585 3300046516 Bacteria 5755
218 Ga0495628_0114248 3300046516 Bacteria 2075
219 Ga0495628_0415720 3300046516 Bacteria 981
220 Ga0495628_1189680 3300046516 Unclassified 517
221 Ga0495630_0003679 3300046517 Bacteria 10686
222 Ga0495630_0599099 3300046517 Unclassified 845
223 Ga0495632_0051782 3300046519 Bacteria 2020
224 Ga0495652_0065935 3300046529 Bacteria 3041
225 Ga0495640_0013833 3300046533 Bacteria 6129
226 Ga0495586_0433411 3300046535 Bacteria 757
227 Ga0495587_0076592 3300046536 Bacteria 1942
228 Ga0495587_0086207 3300046536 Unclassified 1817
229 Ga0495587_0102932 3300046536 Bacteria 1644
230 Ga0495622_0000069 3300046557 Bacteria 89759
231 Ga0495634_0013095 3300046642 Bacteria 5996
232 Ga0495625_0135104 3300046660 Bacteria 1668
233 Ga0495635_0748709 3300046663 Bacteria 632
234 Ga0495588_0000175 3300046674 Bacteria 80911
235 Ga0495657_0006659 3300046675 Bacteria 9022
236 Ga0495599_0401853 3300046678 Bacteria 816
237 Ga0495623_0090269 3300046679 Bacteria 1882
238 Ga0495646_0257558 3300046680 Bacteria 933
239 Ga0495647_0000002 3300046681 Bacteria 174959
240 Ga0495658_0413541 3300046683 Unclassified 860
241 Ga0495613_0000190 3300046689 Bacteria 60696
242 Ga0495624_0000005 3300046690 Bacteria 158127
243 Ga0495624_0010629 3300046690 Bacteria 6339
244 Ga0495600_0002305 3300046809 Bacteria 10893
245 Ga0495600_0033104 3300046809 Bacteria 3355
246 Ga0495600_0033185 3300046809 Bacteria 3351
247 Ga0495581_0089243 3300047315 Bacteria 1788
248 Ga0495604_0209819 3300047317 Bacteria 1346
249 Ga0495604_0340290 3300047317 Unclassified 999
250 Ga0495672_0111712 3300047320 Unclassified 1465
251 Ga0495672_0473673 3300047320 Bacteria 561
252 Ga0495676_0029191 3300047321 Bacteria 4698
253 Ga0495676_0643395 3300047321 Bacteria 688
254 Ga0495680_0122828 3300047322 Unclassified 1915
255 Ga0495680_0275926 3300047322 Unclassified 1186
256 Ga0495680_0716444 3300047322 Unclassified 660
257 Ga0495675_0406047 3300047444 Unclassified 793
258 Ga0495675_0676202 3300047444 Bacteria 580
259 Ga0495684_1002735 3300047471 Unclassified 530
260 Ga0495684_1057421 3300047471 Unclassified 512
261 Ga0495686_0054554 3300047472 Bacteria 2502
262 Ga0495593_0125998 3300047673 Bacteria 1302
263 Ga0495593_0252145 3300047673 Bacteria 884
264 Ga0495602_0043909 3300048088 Bacteria 4058
265 Ga0495602_0097031 3300048088 Bacteria 2430
266 Ga0495602_0731760 3300048088 Unclassified 669
267 Ga0496100_0987994 3300048903 Bacteria 662
268 Ga0496100_1353873 3300048903 Unclassified 562
269 Ga0496102_0000021 3300048905 Bacteria 246920
270 Ga0496102_0002673 3300048905 Bacteria 15162
271 Ga0496102_0835932 3300048905 Archaea 843
272 Ga0496102_1975100 3300048905 Unclassified 500
273 Ga0496103_0000001 3300048906 Bacteria 643471
274 Ga0496103_0020009 3300048906 Bacteria 4019
275 Ga0496103_0646084 3300048906 Bacteria 672
276 Ga0496104_0000029 3300048907 Bacteria 202968
277 Ga0496104_0000214 3300048907 Bacteria 51141
278 Ga0496104_0034623 3300048907 Bacteria 4711
279 Ga0496104_1040822 3300048907 Bacteria 722
280 Ga0496105_0000002 3300048908 Bacteria 753215
281 Ga0496105_0000070 3300048908 Bacteria 80117
282 Ga0496105_1387509 3300048908 Unclassified 509
283 Ga0496106_0000307 3300048909 Bacteria 34433
284 Ga0496106_1193302 3300048909 Bacteria 594
285 Ga0496107_0102568 3300048910 Bacteria 2098
286 Ga0496107_0119013 3300048910 Bacteria 1945
287 Ga0496108_0000339 3300048911 Bacteria 39428
288 Ga0496109_0000391 3300048912 Bacteria 39830
289 Ga0496109_0001321 3300048912 Bacteria 20438
290 Ga0496109_0601104 3300048912 Bacteria 1036
291 Ga0496110_0000325 3300048913 Bacteria 31707
292 Ga0496111_0000171 3300048914 Bacteria 29367
293 Ga0496112_0002000 3300048915 Bacteria 16136
294 Ga0496113_0000002 3300048916 Bacteria 220193
295 Ga0496114_0000097 3300048917 Bacteria 63410
296 Ga0496114_0004701 3300048917 Bacteria 10621
297 Ga0496114_0448506 3300048917 Bacteria 1143
298 Ga0496115_0000151 3300048918 Bacteria 64493
299 Ga0496115_0911161 3300048918 Unclassified 677
300 Ga0496116_0000529 3300048919 Bacteria 51417
301 Ga0496117_0042384 3300048920 Bacteria 3322
302 Ga0496118_0004226 3300048921 Bacteria 17234
303 Ga0496118_0035771 3300048921 Bacteria 4026
304 Ga0496118_0394402 3300048921 Bacteria 721
305 Ga0496119_0004226 3300048922 Bacteria 14408
306 Ga0496119_0004642 3300048922 Bacteria 13555
307 Ga0496119_0030134 3300048922 Bacteria 3664
308 Ga0496119_0113040 3300048922 Bacteria 1504
309 Ga0496120_0007950 3300048923 Bacteria 7807
310 Ga0496121_0028233 3300048924 Bacteria 5228
311 Ga0496121_0083273 3300048924 Bacteria 2526
312 Ga0496121_0312135 3300048924 Bacteria 1062
313 Ga0496125_0040204 3300048928 Bacteria 4014
314 Ga0496125_0063542 3300048928 Bacteria 2943
315 Ga0496125_0307717 3300048928 Bacteria 967
316 Ga0496126_0497579 3300048929 Bacteria 975
317 Ga0496126_1027953 3300048929 Bacteria 617
318 Ga0496126_1279387 3300048929 Unclassified 535
319 Ga0501031_0008611 3300049568 Bacteria 6635
320 Ga0501032_0000843 3300049569 Bacteria 24899
321 Ga0501033_0001203 3300049570 Bacteria 23326
322 Ga0501034_0015370 3300049571 Bacteria 7866
323 Ga0501034_0377030 3300049571 Bacteria 1344
324 Ga0501036_0000711 3300049572 Bacteria 24631
325 Ga0501037_0000522 3300049573 Bacteria 30837
326 Ga0501038_0002510 3300049574 Bacteria 17093
327 Ga0501039_0003044 3300049575 Bacteria 12541
328 Ga0501040_0065852 3300049576 Bacteria 2496
329 Ga0501042_0016864 3300049578 Bacteria 5025
330 Ga0501043_0002028 3300049579 Bacteria 17289
331 Ga0501043_0391570 3300049579 Bacteria 1051
332 Ga0501043_1115565 3300049579 Unclassified 557
333 Ga0501046_0001261 3300049580 Bacteria 24516
334 Ga0501047_0001310 3300049581 Bacteria 24535
335 Ga0501047_0935740 3300049581 Bacteria 680
336 Ga0501047_1072469 3300049581 Unclassified 619
337 Ga0501047_1435951 3300049581 Unclassified 505
338 Ga0501048_0000689 3300049582 Bacteria 24553
339 Ga0501067_0117714 3300049583 Bacteria 1478
340 Ga0501068_0074801 3300049584 Bacteria 2071
341 Ga0501069_0591717 3300049585 Bacteria 665
342 Ga0501070_0000267 3300049586 Bacteria 49167
343 Ga0501070_0001982 3300049586 Bacteria 18007
344 Ga0501070_0076407 3300049586 Bacteria 2773
345 Ga0501070_0127456 3300049586 Bacteria 2103
346 Ga0501071_0048315 3300049587 Bacteria 3060
347 Ga0501072_0811007 3300049588 Unclassified 733
348 Ga0501072_0851289 3300049588 Bacteria 713
349 Ga0501073_0001506 3300049589 Bacteria 17232
350 Ga0501074_0003835 3300049590 Bacteria 10696
351 Ga0501074_0448179 3300049590 Unclassified 915
352 Ga0501074_1106000 3300049590 Unclassified 556
353 Ga0501075_0045791 3300049591 Bacteria 3284
354 Ga0501079_0053148 3300049741 Bacteria 3126
355 Ga0501080_0324813 3300049742 Bacteria 1392
356 Ga0501080_0701931 3300049742 Unclassified 892
357 Ga0501083_0007708 3300049744 Bacteria 7632
358 Ga0501083_0033628 3300049744 Bacteria 3509
359 Ga0501035_0001546 3300049822 Bacteria 23436
360 Ga0501044_0003136 3300049823 Bacteria 18695
361 Ga0501044_0793389 3300049823 Unclassified 827
362 Ga0501045_0232521 3300049824 Bacteria 1372
363 nmdc:mga03n38_368594_c1 3300050490 Archaea 785
364 nmdc:mga05p37_1976456_c1 3300050507 Unclassified 553
365 Ga0495601_0007898 3300053077 Bacteria 6267
366 Ga0495601_0063199 3300053077 Bacteria 2353
367 Ga0495655_0000013 3300053083 Bacteria 63264
368 Ga0495655_0001197 3300053083 Bacteria 4010
369 Ga0495595_0000579 3300053084 Bacteria 14007
370 Ga0495595_0101887 3300053084 Bacteria 1387
371 Ga0495619_0000069 3300053085 Bacteria 82755
372 Ga0495619_0000564 3300053085 Bacteria 24556
373 Ga0495619_0010064 3300053085 Bacteria 5953
374 Ga0495619_0030361 3300053085 Bacteria 3499
375 Ga0500566_0003812 3300053094 Bacteria 8988
376 Ga0500566_0223948 3300053094 Bacteria 933
377 Ga0500595_013400 3300053119 Bacteria 3142
378 Ga0500628_000045 3300053129 Bacteria 45042
379 Ga0501084_0065488 3300054114 Bacteria 3040
380 Ga0495599_0427392
381 LJNas_1007082
382 JGI24740J21852_10002623
383 JGI24034J26672_10000086
384 JGI24742J22300_10007450
385 Ga0065707_10568376
386 Ga0070658_10638150
387 Ga0070683_100799278
388 Ga0070666_10048502
389 Ga0070666_10177286
390 Ga0070680_100304769
391 Ga0070682_100000032
392 Ga0068868_100000978
393 Ga0070691_10000003
394 Ga0070661_100000236
395 Ga0070661_100697942
396 Ga0070668_100757496
397 Ga0070659_101262881
398 Ga0070667_100019543
399 Ga0070667_100301090
400 Ga0070714_100141426
401 Ga0070714_100349720
402 Ga0070711_100002459
403 Ga0070711_100437839
404 Ga0070700_100281446
405 Ga0070663_100001455
406 Ga0070663_101215313
407 Ga0070678_100113504
408 Ga0070678_100673810
409 Ga0070678_100884123
410 Ga0070685_10145908
411 Ga0070685_11129742
412 Ga0070679_100000527
413 Ga0070684_100144007
414 Ga0070684_100180405
415 Ga0070684_101277393
416 Ga0070684_102301903
417 Ga0070686_100462022
418 Ga0070695_100127441
419 Ga0070665_100002631
420 Ga0070665_100214316
421 Ga0070665_100422131
422 Ga0070665_101068607
423 Ga0070665_101576676
424 Ga0070704_100339647
425 Ga0068855_100583554
426 Ga0068855_101776336
427 Ga0070664_101032123
428 Ga0068857_101091208
429 Ga0068854_100000133
430 Ga0068856_100632060
431 Ga0070702_100023007
432 Ga0068852_100725510
433 Ga0068859_100764402
434 Ga0068866_10026919
435 Ga0068851_10000247
436 Ga0068870_11210945
437 Ga0068863_100000110
438 Ga0068863_100012362
439 Ga0068863_100018968
440 Ga0068858_100505445
441 Ga0081455_10063268
442 Ga0081455_10691362
443 Ga0075363_100257916
444 Ga0075364_10782044
445 Ga0070715_10016760
446 Ga0075433_10004466
447 Ga0097620_100764269
448 Ga0105240_10363786
449 Ga0105240_11248332
450 Ga0105245_10003467
451 Ga0105247_10000064
452 Ga0105247_10248293
453 Ga0105247_10352259
454 Ga0114129_11852371
455 Ga0105241_10330924
456 Ga0105241_11422553
457 Ga0105242_10000123
458 Ga0105242_10000589
459 Ga0105242_11044905
460 Ga0105248_10304496
461 Ga0105248_11179549
462 Ga0105237_10313935
463 Ga0105238_10058293
464 Ga0105249_10293973
465 Ga0105239_10060890
466 Ga0105239_10929053
467 Ga0157370_10003648
468 Ga0157374_10002241
469 Ga0157374_10041123
470 Ga0157374_11235930
471 Ga0163162_10119144
472 Ga0157372_10000809
473 Ga0157375_10000126
474 Ga0157375_10093081
475 Ga0157375_10427037
476 Ga0157375_13032656
477 Ga0163163_10304838
478 Ga0163163_11073051
479 Ga0163163_12378225
480 Ga0163163_12931804
481 Ga0157380_10079655
482 Ga0157377_11753899
483 Ga0157379_10154872
484 Ga0157379_10186020
485 Ga0157379_11527924
486 Ga0157379_11761467
487 Ga0157376_10739481
488 Ga0163161_10000013
489 Ga0163161_10320251
490 Ga0197907_10969773
491 Ga0206356_10517561
492 Ga0206351_10315475
493 Ga0206352_10925360
494 Ga0206350_11335362
495 Ga0206350_11567552
496 Ga0206354_10274994
497 Ga0154015_1094621
498 Ga0224712_10125227
499 Ga0207656_10002300
500 Ga0207710_10000165
501 Ga0207710_10046349
502 Ga0207710_10128391
503 Ga0207680_10023163
504 Ga0207680_10103719
505 Ga0207680_10280830
506 Ga0207685_10030940
507 Ga0207643_10405537
508 Ga0207705_11127868
509 Ga0207654_10491552
510 Ga0207707_10267104
511 Ga0207695_10378132
512 Ga0207695_10568144
513 Ga0207671_10092850
514 Ga0207663_10000767
515 Ga0207660_10271501
516 Ga0207649_10000166
517 Ga0207652_10000437
518 Ga0207694_10124879
519 Ga0207687_10187896
520 Ga0207664_10219603
521 Ga0207686_10000066
522 Ga0207686_10000967
523 Ga0207704_10138369
524 Ga0207661_10013529
525 Ga0207661_10748389
526 Ga0207667_11550357
527 Ga0207712_10474897
528 Ga0207668_10608692
529 Ga0207640_10000147
530 Ga0207658_10141837
531 Ga0207658_10251695
532 Ga0207677_10005583
533 Ga0207703_10000122
534 Ga0207703_10649398
535 Ga0207678_10003762
536 Ga0207678_10376604
537 Ga0207708_10316049
538 Ga0207702_10495230
539 Ga0207702_10937704
540 Ga0207641_10000065
541 Ga0207641_10008293
542 Ga0207641_10013865
543 Ga0207676_10000025
544 Ga0207675_102724976
545 Ga0207683_10069565
546 Ga0207698_10197572
547 Ga0207698_11176069
548 Ga0268266_10000973
549 Ga0268266_10002641
550 Ga0268266_10221670
551 Ga0268266_10724426
552 Ga0268266_10991226
553 Ga0265326_10041207
554 Ga0265319_1000030
555 Ga0265336_10008315
556 Ga0265338_10000156
557 Ga0265325_10212706
558 Ga0265331_10195716
559 Ga0373954_0198109
560 Ga0373956_0350671
561 Ga0373937_0482499
562 Ga0316582_0815702
563 Ga0451791_1123960
564 Ga0451804_0012943
565 Ga0451807_0264330
566 Ga0451807_1086899
567 Ga0451835_0937288
568 Ga0451839_1112076
569 Ga0451845_0446452
570 Ga0451853_1819686
571 Ga0466965_0115628
572 Ga0466957_0074256
573 Ga0466960_0943817
574 Ga0466967_0875796
575 Ga0466967_1889452
576 Ga0495592_0000752
577 Ga0495592_0336397
578 Ga0495592_0569783
579 Ga0495629_0029334
580 Ga0495629_0044723
581 Ga0495641_0038942
582 Ga0495641_0054108
583 Ga0495641_0495773
584 Ga0495651_0113387
585 Ga0495653_0029557
586 Ga0495653_0275487
587 Ga0495653_0316683
588 Ga0495662_0000212
589 Ga0495662_0081700
590 Ga0495594_0000001
591 Ga0495608_0004956
592 Ga0495610_0166141
593 Ga0495618_0000037
594 Ga0495618_0228897
595 Ga0495628_0002292
596 Ga0495628_0018585
597 Ga0495628_0114248
598 Ga0495628_0415720
599 Ga0495628_1189680
600 Ga0495630_0003679
601 Ga0495630_0599099
602 Ga0495632_0051782
603 Ga0495652_0065935
604 Ga0495640_0013833
605 Ga0495586_0433411
606 Ga0495587_0076592
607 Ga0495587_0086207
608 Ga0495587_0102932
609 Ga0495622_0000069
610 Ga0495634_0013095
611 Ga0495625_0135104
612 Ga0495635_0748709
613 Ga0495588_0000175
614 Ga0495657_0006659
615 Ga0495599_0401853
616 Ga0495623_0090269
617 Ga0495646_0257558
618 Ga0495647_0000002
619 Ga0495658_0413541
620 Ga0495613_0000190
621 Ga0495624_0000005
622 Ga0495624_0010629
623 Ga0495600_0002305
624 Ga0495600_0033104
625 Ga0495600_0033185
626 Ga0495581_0089243
627 Ga0495604_0209819
628 Ga0495604_0340290
629 Ga0495672_0111712
630 Ga0495672_0473673
631 Ga0495676_0029191
632 Ga0495676_0643395
633 Ga0495680_0122828
634 Ga0495680_0275926
635 Ga0495680_0716444
636 Ga0495675_0406047
637 Ga0495675_0676202
638 Ga0495684_1002735
639 Ga0495684_1057421
640 Ga0495686_0054554
641 Ga0495593_0125998
642 Ga0495593_0252145
643 Ga0495602_0043909
644 Ga0495602_0097031
645 Ga0495602_0731760
646 Ga0496100_0987994
647 Ga0496100_1353873
648 Ga0496102_0000021
649 Ga0496102_0002673
650 Ga0496102_0835932
651 Ga0496102_1975100
652 Ga0496103_0000001
653 Ga0496103_0020009
654 Ga0496103_0646084
655 Ga0496104_0000029
656 Ga0496104_0000214
657 Ga0496104_0034623
658 Ga0496104_1040822
659 Ga0496105_0000002
660 Ga0496105_0000070
661 Ga0496105_1387509
662 Ga0496106_0000307
663 Ga0496106_1193302
664 Ga0496107_0102568
665 Ga0496107_0119013
666 Ga0496108_0000339
667 Ga0496109_0000391
668 Ga0496109_0001321
669 Ga0496109_0601104
670 Ga0496110_0000325
671 Ga0496111_0000171
672 Ga0496112_0002000
673 Ga0496113_0000002
674 Ga0496114_0000097
675 Ga0496114_0004701
676 Ga0496114_0448506
677 Ga0496115_0000151
678 Ga0496115_0911161
679 Ga0496116_0000529
680 Ga0496117_0042384
681 Ga0496118_0004226
682 Ga0496118_0035771
683 Ga0496118_0394402
684 Ga0496119_0004226
685 Ga0496119_0004642
686 Ga0496119_0030134
687 Ga0496119_0113040
688 Ga0496120_0007950
689 Ga0496121_0028233
690 Ga0496121_0083273
691 Ga0496121_0312135
692 Ga0496125_0040204
693 Ga0496125_0063542
694 Ga0496125_0307717
695 Ga0496126_0497579
696 Ga0496126_1027953
697 Ga0496126_1279387
698 Ga0501031_0008611
699 Ga0501032_0000843
700 Ga0501033_0001203
701 Ga0501034_0015370
702 Ga0501034_0377030
703 Ga0501036_0000711
704 Ga0501037_0000522
705 Ga0501038_0002510
706 Ga0501039_0003044
707 Ga0501040_0065852
708 Ga0501042_0016864
709 Ga0501043_0002028
710 Ga0501043_0391570
711 Ga0501043_1115565
712 Ga0501046_0001261
713 Ga0501047_0001310
714 Ga0501047_0935740
715 Ga0501047_1072469
716 Ga0501047_1435951
717 Ga0501048_0000689
718 Ga0501067_0117714
719 Ga0501068_0074801
720 Ga0501069_0591717
721 Ga0501070_0000267
722 Ga0501070_0001982
723 Ga0501070_0076407
724 Ga0501070_0127456
725 Ga0501071_0048315
726 Ga0501072_0811007
727 Ga0501072_0851289
728 Ga0501073_0001506
729 Ga0501074_0003835
730 Ga0501074_0448179
731 Ga0501074_1106000
732 Ga0501075_0045791
733 Ga0501079_0053148
734 Ga0501080_0324813
735 Ga0501080_0701931
736 Ga0501083_0007708
737 Ga0501083_0033628
738 Ga0501035_0001546
739 Ga0501044_0003136
740 Ga0501044_0793389
741 Ga0501045_0232521
742 nmdc:mga03n38_368594_c1
743 nmdc:mga05p37_1976456_c1
744 Ga0495601_0007898
745 Ga0495601_0063199
746 Ga0495655_0000013
747 Ga0495655_0001197
748 Ga0495595_0000579
749 Ga0495595_0101887
750 Ga0495619_0000069
751 Ga0495619_0000564
752 Ga0495619_0010064
753 Ga0495619_0030361
754 Ga0500566_0003812
755 Ga0500566_0223948
756 Ga0500595_013400
757 Ga0500628_000045
758 Ga0501084_0065488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.7913 1 45
7lwr-assembly1.cif.gz_H-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7848 4 49
7lwr-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7842 4 49
7lwr-assembly3.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7775 4 48
6hlk-assembly1.cif.gz_A-2 hijacking the hijackers: escherichia coli pathogenicity islands redirect helper phage packaging for their own benefit. 0.7735 5 59
ID Description Score Start End Superfamily
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.813 3 38 1.10.10.10
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7995 5 43 1.10.10.10
af_P31062_1_68_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7992 4 52 1.10.10.10
3irqD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7979 4 29 1.10.10.10
af_P0ACK5_8_61_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7776 2 37 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9K5C0-F1-model_v4 DNA-binding protein 1.003 4 52
AF-A0A7W0JZV4-F1-model_v4 DNA-binding protein 0.9968 4 52
AF-A0A1H6FQD3-F1-model_v4 DNA binding domain-containing protein, excisionase family 0.9952 4 52
AF-A0A7V9EZE6-F1-model_v4 DNA-binding protein 0.9949 4 52
AF-A0A1M3BGI0-F1-model_v4 DNA-binding protein 0.9854 1 52

Map