F428463

General Info

Members Datasets Scaffolds Average Seq Length
379 254 758 325

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0033540|Ga0496105_0033540_1099_2235
Length 378
Sequence MAPPQIAGRWCGRLVMVAGAGLDYDVETGAPRIGSSIDRRLSRGMWTTALRKGGELMMSGKTIVALGLLMCFAGSGLEAQEFPTRPITLIVPYTAGGGNDAMARVVADSMGVTLGQQIVIENRGGAGGSIATRQVARAAPDGYTLGLGGTGTLAIDPTLYPNVGYDPRKDFAPVGLIATSALIVLVNPSLPSKTLPEFIAFAKAQPGKINYASAGSGSGIHLGTELLAYMAGIKMTHIPYKGSAPALTDLIGGHVALYFSSLPPAIGLVREGKVRALAVTGPTRSKAFPDVPTAAETLPGFEAVLHYGIIAPAGTPRPVIDKLNAAMRTALATREVQARIETDGAEAFPSTPEQYATDIDREETKWSEIVRRSGAKAE

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
252 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
253 2941479691
254 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19
Nodule 0
Rhizoplane 7.39
Rhizosphere 72.56
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0033540 3300048908 Bacteria 4217
2 JGI25153J46596_10002736 3300003215 Bacteria 10050
3 Ga0055526_1000175 3300003771 Bacteria 56970
4 Ga0055526_1000552 3300003771 Bacteria 29632
5 Ga0055537_1000315 3300003773 Bacteria 33077
6 Ga0055524_1002475 3300003775 Bacteria 9488
7 Ga0055536_1000040 3300003781 Bacteria 128983
8 Ga0055534_1000997 3300003784 Bacteria 12430
9 Ga0055534_1001359 3300003784 Bacteria 9794
10 Ga0055531_10000205 3300003794 Bacteria 65042
11 Ga0070690_100024948 3300005330 Bacteria 3680
12 Ga0070670_100203174 3300005331 Bacteria 1722
13 Ga0070670_100421466 3300005331 Bacteria 1180
14 Ga0070680_100021345 3300005336 Bacteria 5145
15 Ga0070660_100082222 3300005339 Bacteria 2529
16 Ga0070689_100000603 3300005340 Bacteria 21743
17 Ga0070687_100059187 3300005343 Bacteria 2016
18 Ga0070661_100102049 3300005344 Bacteria 2135
19 Ga0070675_100063239 3300005354 Bacteria 3059
20 Ga0070671_100084667 3300005355 Bacteria 2652
21 Ga0070667_100330284 3300005367 Bacteria 1377
22 Ga0070714_100017103 3300005435 Bacteria 5871
23 Ga0070713_100404038 3300005436 Bacteria 1276
24 Ga0070710_10017508 3300005437 Bacteria 3668
25 Ga0070711_100047044 3300005439 Bacteria 2943
26 Ga0070708_100065705 3300005445 Bacteria 3253
27 Ga0070678_100045664 3300005456 Bacteria 3136
28 Ga0070681_10004653 3300005458 Bacteria 13109
29 Ga0070698_100091291 3300005471 Bacteria 3028
30 Ga0070698_100099318 3300005471 Bacteria 2884
31 Ga0070679_100016796 3300005530 Bacteria 7073
32 Ga0068853_100025409 3300005539 Bacteria 4969
33 Ga0070672_100203510 3300005543 Bacteria 1656
34 Ga0068855_100117128 3300005563 Bacteria 3053
35 Ga0068855_100144509 3300005563 Bacteria 2709
36 Ga0068856_100181164 3300005614 Bacteria 2120
37 Ga0068852_100085405 3300005616 Bacteria 2811
38 Ga0068859_100195158 3300005617 Bacteria 2109
39 Ga0068864_100053503 3300005618 Bacteria 3483
40 Ga0081455_10001481 3300005937 Bacteria 29042
41 Ga0081455_10057284 3300005937 Bacteria 3303
42 Ga0081455_10284209 3300005937 Bacteria 1194
43 Ga0081538_10018869 3300005981 Bacteria 5156
44 Ga0081540_1000085 3300005983 Bacteria 99716
45 Ga0081540_1001523 3300005983 Bacteria 19916
46 Ga0081540_1004899 3300005983 Bacteria 10082
47 Ga0081540_1014611 3300005983 Bacteria 5018
48 Ga0081540_1061762 3300005983 Bacteria 1784
49 Ga0081539_10020850 3300005985 Bacteria 4403
50 Ga0075365_10026147 3300006038 Bacteria 3702
51 Ga0075365_10043847 3300006038 Bacteria 2929
52 Ga0075368_10024970 3300006042 Bacteria 2291
53 Ga0075363_100129005 3300006048 Bacteria 1417
54 Ga0075363_100144665 3300006048 Bacteria 1340
55 Ga0075364_10051233 3300006051 Bacteria 2696
56 Ga0075364_10108143 3300006051 Bacteria 1854
57 Ga0075364_10226147 3300006051 Bacteria 1270
58 Ga0075362_10032515 3300006177 Bacteria 2264
59 Ga0075362_10069003 3300006177 Bacteria 1611
60 Ga0075367_10052071 3300006178 Bacteria 2422
61 Ga0075367_10148872 3300006178 Bacteria 1452
62 Ga0075369_10026530 3300006186 Bacteria 2415
63 Ga0075369_10148946 3300006186 Bacteria 1069
64 Ga0075366_10032598 3300006195 Bacteria 3067
65 Ga0075366_10035443 3300006195 Bacteria 2941
66 Ga0075366_10051044 3300006195 Bacteria 2457
67 Ga0075366_10110670 3300006195 Bacteria 1652
68 Ga0075370_10032071 3300006353 Bacteria 2935
69 Ga0075370_10032612 3300006353 Bacteria 2913
70 Ga0075370_10199734 3300006353 Bacteria 1179
71 Ga0075428_100112597 3300006844 Bacteria 2964
72 Ga0075428_100117178 3300006844 Bacteria 2901
73 Ga0075428_100410314 3300006844 Bacteria 1451
74 Ga0075428_100537457 3300006844 Bacteria 1250
75 Ga0075430_100000415 3300006846 Bacteria 31698
76 Ga0075430_100036301 3300006846 Bacteria 4179
77 Ga0075430_100043309 3300006846 Bacteria 3804
78 Ga0075430_100233546 3300006846 Bacteria 1525
79 Ga0075431_100039300 3300006847 Bacteria 4874
80 Ga0075431_100094111 3300006847 Bacteria 3092
81 Ga0075431_100135737 3300006847 Bacteria 2536
82 Ga0075433_10377019 3300006852 Bacteria 1253
83 Ga0075434_100199783 3300006871 Bacteria 2019
84 Ga0075429_100084666 3300006880 Bacteria 2763
85 Ga0075429_100174030 3300006880 Bacteria 1886
86 Ga0075436_100004103 3300006914 Bacteria 9988
87 Ga0075436_100065448 3300006914 Bacteria 2513
88 Ga0097620_100195147 3300006931 Bacteria 2109
89 Ga0075435_100050690 3300007076 Bacteria 3341
90 Ga0075435_100156713 3300007076 Bacteria 1916
91 Ga0099794_10003727 3300007265 Bacteria 5867
92 Ga0099795_10025843 3300007788 Bacteria 1973
93 Ga0105240_10062234 3300009093 Bacteria 4647
94 Ga0111539_10092935 3300009094 Bacteria 3544
95 Ga0105245_10666841 3300009098 Bacteria 1071
96 Ga0114129_10310693 3300009147 Bacteria 2098
97 Ga0114129_10558177 3300009147 Bacteria 1488
98 Ga0105243_10040300 3300009148 Bacteria 3646
99 Ga0105248_10044442 3300009177 Bacteria 4981
100 Ga0105249_10524337 3300009553 Bacteria 1232
101 Ga0163162_10286098 3300013306 Bacteria 1780
102 Ga0157372_10183499 3300013307 Bacteria 2423
103 Ga0163163_10255182 3300014325 Bacteria 1804
104 Ga0157380_10096719 3300014326 Bacteria 2448
105 Ga0157379_10065942 3300014968 Bacteria 3237
106 Ga0157376_10066897 3300014969 Bacteria 3038
107 Ga0157376_10346361 3300014969 Bacteria 1420
108 Ga0163161_10239311 3300017792 Bacteria 1411
109 Ga0163161_10266712 3300017792 Bacteria 1339
110 Ga0209672_104067 3300025228 Bacteria 2819
111 Ga0209565_1000076 3300025263 Bacteria 161760
112 Ga0209455_1000470 3300025272 Bacteria 30269
113 Ga0209673_1018366 3300025273 Bacteria 2545
114 Ga0209673_1019101 3300025273 Bacteria 2472
115 Ga0209130_1005427 3300025284 Bacteria 4421
116 Ga0209675_1000043 3300025291 Bacteria 235320
117 Ga0209675_1000047 3300025291 Bacteria 221683
118 Ga0209676_1000083 3300025292 Bacteria 279816
119 Ga0209025_1000106 3300025294 Bacteria 222421
120 Ga0209025_1019626 3300025294 Bacteria 3747
121 Ga0209564_1000145 3300025295 Bacteria 175251
122 Ga0209564_1000169 3300025295 Bacteria 157180
123 Ga0209564_1000553 3300025295 Bacteria 60114
124 Ga0209758_1000370 3300025297 Bacteria 79289
125 Ga0209758_1040404 3300025297 Bacteria 1760
126 Ga0209256_1001339 3300025299 Bacteria 26190
127 Ga0209051_1000310 3300025303 Bacteria 76181
128 Ga0209257_1000165 3300025304 Bacteria 172773
129 Ga0207692_10010740 3300025898 Bacteria 3873
130 Ga0207699_10061307 3300025906 Bacteria 2262
131 Ga0207699_10079203 3300025906 Bacteria 2032
132 Ga0207684_10070691 3300025910 Bacteria 2966
133 Ga0207695_10120362 3300025913 Bacteria 2594
134 Ga0207693_10021964 3300025915 Bacteria 5073
135 Ga0207662_10009892 3300025918 Bacteria 5262
136 Ga0207657_10058797 3300025919 Bacteria 3306
137 Ga0207657_10098170 3300025919 Bacteria 2434
138 Ga0207652_10437774 3300025921 Bacteria 1179
139 Ga0207650_10095963 3300025925 Bacteria 2274
140 Ga0207659_10037172 3300025926 Bacteria 3378
141 Ga0207700_10083898 3300025928 Bacteria 2496
142 Ga0207700_10355186 3300025928 Bacteria 1277
143 Ga0207644_10074344 3300025931 Bacteria 2494
144 Ga0207709_10065852 3300025935 Bacteria 2280
145 Ga0207670_10001143 3300025936 Bacteria 13975
146 Ga0207669_10089074 3300025937 Bacteria 2003
147 Ga0207704_10046902 3300025938 Bacteria 2579
148 Ga0207704_10363218 3300025938 Bacteria 1131
149 Ga0207665_10115051 3300025939 Bacteria 1894
150 Ga0207691_10155124 3300025940 Bacteria 2011
151 Ga0207711_10044455 3300025941 Bacteria 3791
152 Ga0207667_10087243 3300025949 Bacteria 3228
153 Ga0207668_10064242 3300025972 Bacteria 2593
154 Ga0207658_10056143 3300025986 Bacteria 2921
155 Ga0207677_10087568 3300026023 Bacteria 2255
156 Ga0207639_10313571 3300026041 Bacteria 1390
157 Ga0207708_10058004 3300026075 Bacteria 2954
158 Ga0207676_10326315 3300026095 Bacteria 1411
159 Ga0207675_100101582 3300026118 Bacteria 2709
160 Ga0207683_10023512 3300026121 Bacteria 5302
161 Ga0209813_10012253 3300027866 Bacteria 2261
162 Ga0265338_10242080 3300028800 Bacteria 1335
163 Ga0265330_10019803 3300031235 Bacteria 3077
164 Ga0265330_10049109 3300031235 Bacteria 1855
165 Ga0265332_10062742 3300031238 Bacteria 1588
166 Ga0265320_10008779 3300031240 Bacteria 6152
167 Ga0265325_10001607 3300031241 Bacteria 15749
168 Ga0265325_10044153 3300031241 Bacteria 2323
169 Ga0265325_10088700 3300031241 Bacteria 1528
170 Ga0265340_10013612 3300031247 Bacteria 4270
171 Ga0265340_10084499 3300031247 Bacteria 1490
172 Ga0265340_10122736 3300031247 Bacteria 1194
173 Ga0265339_10110941 3300031249 Bacteria 1419
174 Ga0265331_10114578 3300031250 Bacteria 1235
175 Ga0265327_10059142 3300031251 Bacteria 1964
176 Ga0307408_100002243 3300031548 Bacteria 13790
177 Ga0265313_10009178 3300031595 Bacteria 6453
178 Ga0265313_10054540 3300031595 Bacteria 1898
179 Ga0265314_10121974 3300031711 Bacteria 1639
180 Ga0265342_10057608 3300031712 Bacteria 2299
181 Ga0307406_10016868 3300031901 Bacteria 4249
182 Ga0307409_100469087 3300031995 Bacteria 1219
183 Ga0373929_0026703 3300035085 Bacteria 1208
184 Ga0373934_0081376 3300035086 Bacteria 1301
185 Ga0373934_0100764 3300035086 Unclassified 1168
186 Ga0373923_0000690 3300035111 Bacteria 8614
187 Ga0373936_0000146 3300035113 Bacteria 23912
188 Ga0373936_0008284 3300035113 Bacteria 3909
189 Ga0373936_0084960 3300035113 Bacteria 1321
190 Ga0373953_0079008 3300035117 Bacteria 1365
191 Ga0373954_0006243 3300035118 Bacteria 5195
192 Ga0373954_0011226 3300035118 Bacteria 3966
193 Ga0373943_0005491 3300035170 Bacteria 5703
194 Ga0373946_0005533 3300035171 Bacteria 4558
195 Ga0373955_0030817 3300035172 Bacteria 2804
196 Ga0373961_0016098 3300035241 Bacteria 1923
197 Ga0373924_0011661 3300035410 Bacteria 3268
198 Ga0373924_0049043 3300035410 Bacteria 1746
199 Ga0373931_0006360 3300035691 Bacteria 5514
200 Ga0373931_0111061 3300035691 Bacteria 1555
201 Ga0373931_0151767 3300035691 Bacteria 1351
202 Ga0373935_0000054 3300035692 Bacteria 46833
203 Ga0373935_0105595 3300035692 Bacteria 1863
204 Ga0373935_0114748 3300035692 Bacteria 1792
205 Ga0373935_0202198 3300035692 Bacteria 1373
206 Ga0373927_0011802 3300035695 Bacteria 5819
207 Ga0373933_0007429 3300035724 Bacteria 5979
208 Ga0373947_0115079 3300035725 Bacteria 1704
209 Ga0373937_0000378 3300036401 Bacteria 41426
210 Ga0373937_0017808 3300036401 Bacteria 6338
211 Ga0373925_0000075 3300037068 Bacteria 105395
212 Ga0373925_0222474 3300037068 Bacteria 1507
213 Ga0395898_0208606 3300037466 Bacteria 1864
214 Ga0395905_0000043 3300037471 Bacteria 247469
215 Ga0395905_0001258 3300037471 Bacteria 31334
216 Ga0395901_0271691 3300038443 Bacteria 1763
217 Ga0436365_1008402 3300039437 Bacteria 1535
218 Ga0436361_0149422 3300039447 Bacteria 7078
219 Ga0436363_0818795 3300039450 Bacteria 1510
220 Ga0439459_0005571 3300042438 Bacteria 2074
221 Ga0466967_0040942 3300045976 Bacteria 3991
222 Ga0495592_0000060 3300046454 Bacteria 100113
223 Ga0495629_0015473 3300046459 Bacteria 5478
224 Ga0495651_0014759 3300046462 Bacteria 6041
225 Ga0495651_0129261 3300046462 Bacteria 1846
226 Ga0495653_0000063 3300046463 Bacteria 93232
227 Ga0495582_0059338 3300046473 Bacteria 2111
228 Ga0495664_0000004 3300046477 Bacteria 489411
229 Ga0495608_0000005 3300046511 Bacteria 350726
230 Ga0495618_0010849 3300046514 Bacteria 5515
231 Ga0495628_0000001 3300046516 Bacteria 917742
232 Ga0495630_0025370 3300046517 Bacteria 4382
233 Ga0495630_0040099 3300046517 Bacteria 3499
234 Ga0495652_0000002 3300046529 Bacteria 946606
235 Ga0495652_0204119 3300046529 Bacteria 1498
236 Ga0495640_0000001 3300046533 Bacteria 853827
237 Ga0495640_0062373 3300046533 Bacteria 2528
238 Ga0495587_0000001 3300046536 Bacteria 724132
239 Ga0495645_0000002 3300046543 Bacteria 651644
240 Ga0495667_0000039 3300046559 Bacteria 131308
241 Ga0495667_0071226 3300046559 Bacteria 2268
242 Ga0495656_0005165 3300046615 Bacteria 4502
243 Ga0495634_0015722 3300046642 Bacteria 5427
244 Ga0495634_0133348 3300046642 Bacteria 1582
245 Ga0495635_0000002 3300046663 Bacteria 490490
246 Ga0495659_0018301 3300046664 Bacteria 2333
247 Ga0495657_0000042 3300046675 Bacteria 114669
248 Ga0495599_0000013 3300046678 Bacteria 179828
249 Ga0495623_0000604 3300046679 Bacteria 23931
250 Ga0495646_0000009 3300046680 Bacteria 200698
251 Ga0495600_0000035 3300046809 Bacteria 80552
252 Ga0495604_0000020 3300047317 Bacteria 171989
253 Ga0495674_0000002 3300047319 Bacteria 642785
254 Ga0495674_0069161 3300047319 Bacteria 3054
255 Ga0495680_0002330 3300047322 Bacteria 19470
256 Ga0495675_0016473 3300047444 Bacteria 4675
257 Ga0495684_0000016 3300047471 Bacteria 169338
258 Ga0495593_0014706 3300047673 Bacteria 4448
259 Ga0495602_0036620 3300048088 Bacteria 4564
260 Ga0495602_0294746 3300048088 Bacteria 1189
261 Ga0496100_0013927 3300048903 Bacteria 4655
262 Ga0496101_0024030 3300048904 Bacteria 4216
263 Ga0496102_0095653 3300048905 Bacteria 2753
264 Ga0496104_0000406 3300048907 Bacteria 37705
265 Ga0496104_0091653 3300048907 Bacteria 2905
266 Ga0496104_0094284 3300048907 Bacteria 2863
267 Ga0496105_0026574 3300048908 Bacteria 4724
268 Ga0496105_0195962 3300048908 Bacteria 1650
269 Ga0496106_0127264 3300048909 Bacteria 1995
270 Ga0496106_0139967 3300048909 Bacteria 1903
271 Ga0496106_0159761 3300048909 Bacteria 1782
272 Ga0496108_0123671 3300048911 Bacteria 2220
273 Ga0496108_0239742 3300048911 Bacteria 1577
274 Ga0496109_0043766 3300048912 Bacteria 4059
275 Ga0496109_0191296 3300048912 Bacteria 1923
276 Ga0496109_0219471 3300048912 Bacteria 1788
277 Ga0496110_0030423 3300048913 Bacteria 4654
278 Ga0496110_0085613 3300048913 Bacteria 2813
279 Ga0496110_0093117 3300048913 Bacteria 2697
280 Ga0496110_0119865 3300048913 Bacteria 2370
281 Ga0496111_0053689 3300048914 Bacteria 2912
282 Ga0496112_0122737 3300048915 Bacteria 2568
283 Ga0496112_0129757 3300048915 Bacteria 2492
284 Ga0496114_0018547 3300048917 Bacteria 5627
285 Ga0496114_0188864 3300048917 Bacteria 1802
286 Ga0496115_0046163 3300048918 Bacteria 3480
287 Ga0496115_0056128 3300048918 Bacteria 3165
288 Ga0501031_0029599 3300049568 Bacteria 3572
289 Ga0501033_0016164 3300049570 Bacteria 5651
290 Ga0501034_0124998 3300049571 Bacteria 2557
291 Ga0501034_0515699 3300049571 Bacteria 1108
292 Ga0501036_0081616 3300049572 Bacteria 2732
293 Ga0501037_0022070 3300049573 Bacteria 4711
294 Ga0501037_0178039 3300049573 Bacteria 1510
295 Ga0501039_0016654 3300049575 Bacteria 5631
296 Ga0501042_0103515 3300049578 Bacteria 2048
297 Ga0501043_0036153 3300049579 Bacteria 3885
298 Ga0501043_0100993 3300049579 Bacteria 2267
299 Ga0501043_0266249 3300049579 Bacteria 1317
300 Ga0501046_0011557 3300049580 Bacteria 7549
301 Ga0501047_0166219 3300049581 Bacteria 2076
302 Ga0501047_0235218 3300049581 Bacteria 1684
303 Ga0501048_0010417 3300049582 Bacteria 6943
304 Ga0501067_0005882 3300049583 Bacteria 6797
305 Ga0501068_0019656 3300049584 Bacteria 3926
306 Ga0501068_0159588 3300049584 Bacteria 1421
307 Ga0501069_0004753 3300049585 Bacteria 7027
308 Ga0501070_0029517 3300049586 Bacteria 4596
309 Ga0501071_0190814 3300049587 Bacteria 1537
310 Ga0501072_0287563 3300049588 Bacteria 1307
311 Ga0501073_0028129 3300049589 Bacteria 4016
312 Ga0501074_0016242 3300049590 Bacteria 5407
313 Ga0501076_0110337 3300049592 Bacteria 2224
314 Ga0501077_0187255 3300049593 Bacteria 1315
315 Ga0501080_0123775 3300049742 Bacteria 2395
316 Ga0501083_0049048 3300049744 Bacteria 2848
317 Ga0501035_0107772 3300049822 Bacteria 2442
318 Ga0501044_0054477 3300049823 Bacteria 4110
319 Ga0501045_0011023 3300049824 Bacteria 6337
320 Ga0501045_0129453 3300049824 Bacteria 1876
321 nmdc:mga03683_86715_c1 3300050489 Bacteria 1360
322 nmdc:mga03n38_33182_c1 3300050490 Bacteria 2194
323 nmdc:mga00v17_238549_c1 3300050491 Bacteria 1179
324 nmdc:mga00v17_242057_c1 3300050491 Bacteria 1170
325 nmdc:mga00v17_65626_c1 3300050491 Bacteria 2240
326 nmdc:mga00v17_80918_c1 3300050491 Bacteria 2028
327 nmdc:mga0yw44_111304_c1 3300050492 Bacteria 1755
328 nmdc:mga0yw44_22335_c1 3300050492 Bacteria 3547
329 nmdc:mga0yw44_316329_c1 3300050492 Bacteria 1048
330 nmdc:mga0yw44_74853_c2 3300050492 Bacteria 1437
331 nmdc:mga0k408_31803_c1 3300050493 Bacteria 3015
332 nmdc:mga0k408_56621_c2 3300050493 Bacteria 1931
333 nmdc:mga0k408_87670_c1 3300050493 Bacteria 1828
334 nmdc:mga0k408_93807_c2 3300050493 Bacteria 1269
335 nmdc:mga06z11_205692_c1 3300050494 Bacteria 1145
336 nmdc:mga06z11_24570_c1 3300050494 Bacteria 2845
337 nmdc:mga06z11_33475_c1 3300050494 Bacteria 2514
338 nmdc:mga04h51_13753_c1 3300050495 Bacteria 2298
339 nmdc:mga07m45_56706_c1 3300050496 Bacteria 2215
340 nmdc:mga05p37_444916_c1 3300050507 Bacteria 1501
341 nmdc:mga09592_138496_c1 3300050508 Bacteria 2097
342 nmdc:mga09592_199559_c1 3300050508 Bacteria 1732
343 nmdc:mga09592_96730_c1 3300050508 Bacteria 2526
344 nmdc:mga0qj67_132633_c1 3300050509 Bacteria 2018
345 nmdc:mga0qj67_148685_c1 3300050509 Bacteria 1900
346 nmdc:mga0qj67_190929_c1 3300050509 Bacteria 1665
347 nmdc:mga0qj67_19_c1 3300050509 Bacteria 112208
348 nmdc:mga06r32_111910_c1 3300050510 Bacteria 2687
349 nmdc:mga06r32_304167_c1 3300050510 Bacteria 1580
350 nmdc:mga06r32_550889_c1 3300050510 Bacteria 1127
351 nmdc:mga0n895_186049_c1 3300050512 Bacteria 2108
352 nmdc:mga0n895_361750_c1 3300050512 Bacteria 1469
353 nmdc:mga0n895_517762_c1 3300050512 Bacteria 1201
354 nmdc:mga0rr50_148925_c1 3300050513 Bacteria 1889
355 nmdc:mga0rr50_296548_c1 3300050513 Bacteria 1352
356 nmdc:mga08x19_93538_c1 3300050514 Bacteria 1987
357 nmdc:mga08x19_98465_c1 3300050514 Bacteria 1937
358 nmdc:mga0a205_147774_c1 3300050515 Bacteria 2250
359 nmdc:mga0sz30_24547_c1 3300050516 Bacteria 2461
360 Ga0495601_0000018 3300053077 Bacteria 171665
361 Ga0495601_0003815 3300053077 Bacteria 8670
362 Ga0495612_0000017 3300053078 Bacteria 152112
363 Ga0495595_0000010 3300053084 Bacteria 178819
364 Ga0495595_0020867 3300053084 Bacteria 2855
365 Ga0495619_0000014 3300053085 Bacteria 261449
366 Ga0495619_0097708 3300053085 Bacteria 1995
367 Ga0495619_0278571 3300053085 Bacteria 1159
368 Ga0500642_0132051 3300053130 Bacteria 1170
369 Ga0500616_0015381 3300053153 Bacteria 4377
370 Ga0501084_0023624 3300054114 Bacteria 5127
371 Ga0501084_0128083 3300054114 Bacteria 2137
372 Ga0501082_0015352 3300060353 Bacteria 6591
373 Ga0501082_0106746 3300060353 Bacteria 2423
374 Ga0501082_0272110 3300060353 Bacteria 1474
375 Ga0530510_0025338 3300061734 Bacteria 4240
376 2834645674 2834641062 Bacteria 5559922
377 2881102037 2881101125 Bacteria 4590519
378 2941484857
379 8003405420 8003400568 Bacteria 5535898
380 Ga0496105_0033540
381 JGI25153J46596_10002736
382 Ga0055526_1000175
383 Ga0055526_1000552
384 Ga0055537_1000315
385 Ga0055524_1002475
386 Ga0055536_1000040
387 Ga0055534_1000997
388 Ga0055534_1001359
389 Ga0055531_10000205
390 Ga0070690_100024948
391 Ga0070670_100203174
392 Ga0070670_100421466
393 Ga0070680_100021345
394 Ga0070660_100082222
395 Ga0070689_100000603
396 Ga0070687_100059187
397 Ga0070661_100102049
398 Ga0070675_100063239
399 Ga0070671_100084667
400 Ga0070667_100330284
401 Ga0070714_100017103
402 Ga0070713_100404038
403 Ga0070710_10017508
404 Ga0070711_100047044
405 Ga0070708_100065705
406 Ga0070678_100045664
407 Ga0070681_10004653
408 Ga0070698_100091291
409 Ga0070698_100099318
410 Ga0070679_100016796
411 Ga0068853_100025409
412 Ga0070672_100203510
413 Ga0068855_100117128
414 Ga0068855_100144509
415 Ga0068856_100181164
416 Ga0068852_100085405
417 Ga0068859_100195158
418 Ga0068864_100053503
419 Ga0081455_10001481
420 Ga0081455_10057284
421 Ga0081455_10284209
422 Ga0081538_10018869
423 Ga0081540_1000085
424 Ga0081540_1001523
425 Ga0081540_1004899
426 Ga0081540_1014611
427 Ga0081540_1061762
428 Ga0081539_10020850
429 Ga0075365_10026147
430 Ga0075365_10043847
431 Ga0075368_10024970
432 Ga0075363_100129005
433 Ga0075363_100144665
434 Ga0075364_10051233
435 Ga0075364_10108143
436 Ga0075364_10226147
437 Ga0075362_10032515
438 Ga0075362_10069003
439 Ga0075367_10052071
440 Ga0075367_10148872
441 Ga0075369_10026530
442 Ga0075369_10148946
443 Ga0075366_10032598
444 Ga0075366_10035443
445 Ga0075366_10051044
446 Ga0075366_10110670
447 Ga0075370_10032071
448 Ga0075370_10032612
449 Ga0075370_10199734
450 Ga0075428_100112597
451 Ga0075428_100117178
452 Ga0075428_100410314
453 Ga0075428_100537457
454 Ga0075430_100000415
455 Ga0075430_100036301
456 Ga0075430_100043309
457 Ga0075430_100233546
458 Ga0075431_100039300
459 Ga0075431_100094111
460 Ga0075431_100135737
461 Ga0075433_10377019
462 Ga0075434_100199783
463 Ga0075429_100084666
464 Ga0075429_100174030
465 Ga0075436_100004103
466 Ga0075436_100065448
467 Ga0097620_100195147
468 Ga0075435_100050690
469 Ga0075435_100156713
470 Ga0099794_10003727
471 Ga0099795_10025843
472 Ga0105240_10062234
473 Ga0111539_10092935
474 Ga0105245_10666841
475 Ga0114129_10310693
476 Ga0114129_10558177
477 Ga0105243_10040300
478 Ga0105248_10044442
479 Ga0105249_10524337
480 Ga0163162_10286098
481 Ga0157372_10183499
482 Ga0163163_10255182
483 Ga0157380_10096719
484 Ga0157379_10065942
485 Ga0157376_10066897
486 Ga0157376_10346361
487 Ga0163161_10239311
488 Ga0163161_10266712
489 Ga0209672_104067
490 Ga0209565_1000076
491 Ga0209455_1000470
492 Ga0209673_1018366
493 Ga0209673_1019101
494 Ga0209130_1005427
495 Ga0209675_1000043
496 Ga0209675_1000047
497 Ga0209676_1000083
498 Ga0209025_1000106
499 Ga0209025_1019626
500 Ga0209564_1000145
501 Ga0209564_1000169
502 Ga0209564_1000553
503 Ga0209758_1000370
504 Ga0209758_1040404
505 Ga0209256_1001339
506 Ga0209051_1000310
507 Ga0209257_1000165
508 Ga0207692_10010740
509 Ga0207699_10061307
510 Ga0207699_10079203
511 Ga0207684_10070691
512 Ga0207695_10120362
513 Ga0207693_10021964
514 Ga0207662_10009892
515 Ga0207657_10058797
516 Ga0207657_10098170
517 Ga0207652_10437774
518 Ga0207650_10095963
519 Ga0207659_10037172
520 Ga0207700_10083898
521 Ga0207700_10355186
522 Ga0207644_10074344
523 Ga0207709_10065852
524 Ga0207670_10001143
525 Ga0207669_10089074
526 Ga0207704_10046902
527 Ga0207704_10363218
528 Ga0207665_10115051
529 Ga0207691_10155124
530 Ga0207711_10044455
531 Ga0207667_10087243
532 Ga0207668_10064242
533 Ga0207658_10056143
534 Ga0207677_10087568
535 Ga0207639_10313571
536 Ga0207708_10058004
537 Ga0207676_10326315
538 Ga0207675_100101582
539 Ga0207683_10023512
540 Ga0209813_10012253
541 Ga0265338_10242080
542 Ga0265330_10019803
543 Ga0265330_10049109
544 Ga0265332_10062742
545 Ga0265320_10008779
546 Ga0265325_10001607
547 Ga0265325_10044153
548 Ga0265325_10088700
549 Ga0265340_10013612
550 Ga0265340_10084499
551 Ga0265340_10122736
552 Ga0265339_10110941
553 Ga0265331_10114578
554 Ga0265327_10059142
555 Ga0307408_100002243
556 Ga0265313_10009178
557 Ga0265313_10054540
558 Ga0265314_10121974
559 Ga0265342_10057608
560 Ga0307406_10016868
561 Ga0307409_100469087
562 Ga0373929_0026703
563 Ga0373934_0081376
564 Ga0373934_0100764
565 Ga0373923_0000690
566 Ga0373936_0000146
567 Ga0373936_0008284
568 Ga0373936_0084960
569 Ga0373953_0079008
570 Ga0373954_0006243
571 Ga0373954_0011226
572 Ga0373943_0005491
573 Ga0373946_0005533
574 Ga0373955_0030817
575 Ga0373961_0016098
576 Ga0373924_0011661
577 Ga0373924_0049043
578 Ga0373931_0006360
579 Ga0373931_0111061
580 Ga0373931_0151767
581 Ga0373935_0000054
582 Ga0373935_0105595
583 Ga0373935_0114748
584 Ga0373935_0202198
585 Ga0373927_0011802
586 Ga0373933_0007429
587 Ga0373947_0115079
588 Ga0373937_0000378
589 Ga0373937_0017808
590 Ga0373925_0000075
591 Ga0373925_0222474
592 Ga0395898_0208606
593 Ga0395905_0000043
594 Ga0395905_0001258
595 Ga0395901_0271691
596 Ga0436365_1008402
597 Ga0436361_0149422
598 Ga0436363_0818795
599 Ga0439459_0005571
600 Ga0466967_0040942
601 Ga0495592_0000060
602 Ga0495629_0015473
603 Ga0495651_0014759
604 Ga0495651_0129261
605 Ga0495653_0000063
606 Ga0495582_0059338
607 Ga0495664_0000004
608 Ga0495608_0000005
609 Ga0495618_0010849
610 Ga0495628_0000001
611 Ga0495630_0025370
612 Ga0495630_0040099
613 Ga0495652_0000002
614 Ga0495652_0204119
615 Ga0495640_0000001
616 Ga0495640_0062373
617 Ga0495587_0000001
618 Ga0495645_0000002
619 Ga0495667_0000039
620 Ga0495667_0071226
621 Ga0495656_0005165
622 Ga0495634_0015722
623 Ga0495634_0133348
624 Ga0495635_0000002
625 Ga0495659_0018301
626 Ga0495657_0000042
627 Ga0495599_0000013
628 Ga0495623_0000604
629 Ga0495646_0000009
630 Ga0495600_0000035
631 Ga0495604_0000020
632 Ga0495674_0000002
633 Ga0495674_0069161
634 Ga0495680_0002330
635 Ga0495675_0016473
636 Ga0495684_0000016
637 Ga0495593_0014706
638 Ga0495602_0036620
639 Ga0495602_0294746
640 Ga0496100_0013927
641 Ga0496101_0024030
642 Ga0496102_0095653
643 Ga0496104_0000406
644 Ga0496104_0091653
645 Ga0496104_0094284
646 Ga0496105_0026574
647 Ga0496105_0195962
648 Ga0496106_0127264
649 Ga0496106_0139967
650 Ga0496106_0159761
651 Ga0496108_0123671
652 Ga0496108_0239742
653 Ga0496109_0043766
654 Ga0496109_0191296
655 Ga0496109_0219471
656 Ga0496110_0030423
657 Ga0496110_0085613
658 Ga0496110_0093117
659 Ga0496110_0119865
660 Ga0496111_0053689
661 Ga0496112_0122737
662 Ga0496112_0129757
663 Ga0496114_0018547
664 Ga0496114_0188864
665 Ga0496115_0046163
666 Ga0496115_0056128
667 Ga0501031_0029599
668 Ga0501033_0016164
669 Ga0501034_0124998
670 Ga0501034_0515699
671 Ga0501036_0081616
672 Ga0501037_0022070
673 Ga0501037_0178039
674 Ga0501039_0016654
675 Ga0501042_0103515
676 Ga0501043_0036153
677 Ga0501043_0100993
678 Ga0501043_0266249
679 Ga0501046_0011557
680 Ga0501047_0166219
681 Ga0501047_0235218
682 Ga0501048_0010417
683 Ga0501067_0005882
684 Ga0501068_0019656
685 Ga0501068_0159588
686 Ga0501069_0004753
687 Ga0501070_0029517
688 Ga0501071_0190814
689 Ga0501072_0287563
690 Ga0501073_0028129
691 Ga0501074_0016242
692 Ga0501076_0110337
693 Ga0501077_0187255
694 Ga0501080_0123775
695 Ga0501083_0049048
696 Ga0501035_0107772
697 Ga0501044_0054477
698 Ga0501045_0011023
699 Ga0501045_0129453
700 nmdc:mga03683_86715_c1
701 nmdc:mga03n38_33182_c1
702 nmdc:mga00v17_238549_c1
703 nmdc:mga00v17_242057_c1
704 nmdc:mga00v17_65626_c1
705 nmdc:mga00v17_80918_c1
706 nmdc:mga0yw44_111304_c1
707 nmdc:mga0yw44_22335_c1
708 nmdc:mga0yw44_316329_c1
709 nmdc:mga0yw44_74853_c2
710 nmdc:mga0k408_31803_c1
711 nmdc:mga0k408_56621_c2
712 nmdc:mga0k408_87670_c1
713 nmdc:mga0k408_93807_c2
714 nmdc:mga06z11_205692_c1
715 nmdc:mga06z11_24570_c1
716 nmdc:mga06z11_33475_c1
717 nmdc:mga04h51_13753_c1
718 nmdc:mga07m45_56706_c1
719 nmdc:mga05p37_444916_c1
720 nmdc:mga09592_138496_c1
721 nmdc:mga09592_199559_c1
722 nmdc:mga09592_96730_c1
723 nmdc:mga0qj67_132633_c1
724 nmdc:mga0qj67_148685_c1
725 nmdc:mga0qj67_190929_c1
726 nmdc:mga0qj67_19_c1
727 nmdc:mga06r32_111910_c1
728 nmdc:mga06r32_304167_c1
729 nmdc:mga06r32_550889_c1
730 nmdc:mga0n895_186049_c1
731 nmdc:mga0n895_361750_c1
732 nmdc:mga0n895_517762_c1
733 nmdc:mga0rr50_148925_c1
734 nmdc:mga0rr50_296548_c1
735 nmdc:mga08x19_93538_c1
736 nmdc:mga08x19_98465_c1
737 nmdc:mga0a205_147774_c1
738 nmdc:mga0sz30_24547_c1
739 Ga0495601_0000018
740 Ga0495601_0003815
741 Ga0495612_0000017
742 Ga0495595_0000010
743 Ga0495595_0020867
744 Ga0495619_0000014
745 Ga0495619_0097708
746 Ga0495619_0278571
747 Ga0500642_0132051
748 Ga0500616_0015381
749 Ga0501084_0023624
750 Ga0501084_0128083
751 Ga0501082_0015352
752 Ga0501082_0106746
753 Ga0501082_0272110
754 Ga0530510_0025338
755 2834645674
756 2881102037
757 2941484857
758 8003405420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

102

375

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9554 34 327
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9522 34 327
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9495 31 330
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9488 32 330
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9464 31 330
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9378 130 247 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9326 131 252 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9306 31 330 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9276 130 252 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9253 31 330 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A537U4L1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9731 60 330
AF-A0A537U4L1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.966 60 330
AF-A0A0Q4Y6X1-F1-model_v4 ABC transporter substrate-binding protein 0.9629 56 330
AF-A0A4V2HUY2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9629 94 330
AF-A0A4Q7NEM1-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9608 27 330

Map