F428522

General Info

Members Datasets Scaffolds Average Seq Length
380 216 760 194

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10015374|JGI24740J21852_100153742
Length 195
Sequence MLFSEDVFKRRSELGGSIEVICGSMFSGKTEELIRRLKRAQIARFNVEIFKPKTDTRYDEAAVVSHDATSIPSVPVEHSSAILLMLNSDVQVVGIDEAQFFDEELPHICTLLANRGIRVIVAGLDMDFKGNPFGPMPALMAMAESVTKVHAVCVRCGSPALYSYRLASNETRILLGEKESYEPRCRQCYNEDGSI

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
121 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
122 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
145 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
191 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
192 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
193 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
198 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
199 2738541302 Pedobacter sp. CF074 Isolate Unclassified
200 2739367651 Pedobacter sp. OK291 Isolate Unclassified
201 2739367656 Pedobacter sp. CF523 Isolate Unclassified
202 2739367663 Pedobacter sp. YR510 Isolate Unclassified
203 2818991437 Pedobacter terrae 518 Isolate Unclassified
204 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
205 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
206 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
207 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
208 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
209 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
210 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
211 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
212 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
213 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
214 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
215 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
216 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0.26
Isolates 5.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 0
Rhizoplane 0.53
Rhizosphere 82.11
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015374 3300001979 Bacteria 2796
2 JGI24736J21556_1002859 3300001904 Bacteria 3027
3 JGI24736J21556_1010082 3300001904 Bacteria 1549
4 JGI24737J22298_10002035 3300001990 Bacteria 7231
5 JGI24737J22298_10025508 3300001990 Bacteria 1869
6 JGI24735J21928_10000009 3300002067 Bacteria 247425
7 JGI24735J21928_10004322 3300002067 Bacteria 4782
8 JGI25162J39368_1000047 3300002737 Viruses 167507
9 JGI25162J39368_1000629 3300002737 Bacteria 25079
10 JGI25164J39214_1001512 3300002772 Bacteria 5224
11 JGI25150J39212_1000001 3300002774 Bacteria 1318726
12 JGI25151J46595_10000001 3300003187 Bacteria 887211
13 JGI25165J46597_1001516 3300003214 Bacteria 11746
14 JGI25153J46596_10000001 3300003215 Bacteria 748985
15 rootH1_10016431 3300003316 Bacteria 17515
16 rootH1_10133809 3300003316 Bacteria 10911
17 rootH2_10110333 3300003320 Bacteria 2810
18 rootH2_10236642 3300003320 Bacteria 1789
19 rootL2_10378943 3300003322 Bacteria 1744
20 rootH1_10013272 3300003323 Bacteria 21197
21 rootH1_10013301 3300003323 Bacteria 24681
22 Ga0055536_1000001 3300003781 Bacteria 630663
23 Ga0055530_10005264 3300003791 Bacteria 6226
24 Ga0058862_12601524 3300004803 Bacteria 719
25 Ga0065714_10064604 3300005288 Bacteria 29598
26 Ga0070658_10000435 3300005327 Bacteria 36388
27 Ga0070658_10130885 3300005327 Bacteria 2091
28 Ga0070676_10000428 3300005328 Bacteria 19934
29 Ga0070683_100077225 3300005329 Bacteria 3114
30 Ga0068869_100366706 3300005334 Bacteria 1177
31 Ga0070680_100069028 3300005336 Bacteria 2902
32 Ga0070680_100277248 3300005336 Bacteria 1420
33 Ga0070682_100151137 3300005337 Bacteria 1593
34 Ga0070660_100091014 3300005339 Bacteria 2406
35 Ga0070661_100989185 3300005344 Bacteria 697
36 Ga0070673_100002752 3300005364 Bacteria 10800
37 Ga0070659_100010674 3300005366 Bacteria 6765
38 Ga0070663_100013905 3300005455 Bacteria 5149
39 Ga0070662_100002133 3300005457 Bacteria 12133
40 Ga0070662_100780028 3300005457 Bacteria 812
41 Ga0070681_10088820 3300005458 Bacteria 3042
42 Ga0070681_10123834 3300005458 Bacteria 2518
43 Ga0070681_10455385 3300005458 Bacteria 1192
44 Ga0068867_100170886 3300005459 Bacteria 1721
45 Ga0070679_100031962 3300005530 Bacteria 5205
46 Ga0070684_100501809 3300005535 Bacteria 1124
47 Ga0068853_100018769 3300005539 Bacteria 5727
48 Ga0068853_100030162 3300005539 Bacteria 4579
49 Ga0068853_100040282 3300005539 Bacteria 3986
50 Ga0068853_100049163 3300005539 Bacteria 3623
51 Ga0070665_100000147 3300005548 Bacteria 129683
52 Ga0068855_100045273 3300005563 Bacteria 5204
53 Ga0068855_100056817 3300005563 Bacteria 4589
54 Ga0068855_100121022 3300005563 Bacteria 2996
55 Ga0068855_100262331 3300005563 Bacteria 1924
56 Ga0068855_100311418 3300005563 Bacteria 1742
57 Ga0068857_100200244 3300005577 Bacteria 1820
58 Ga0068854_100068659 3300005578 Viruses 2585
59 Ga0068856_100001297 3300005614 Bacteria 26299
60 Ga0068856_100012281 3300005614 Bacteria 8295
61 Ga0068852_100000913 3300005616 Bacteria 19584
62 Ga0068852_100046465 3300005616 Bacteria 3700
63 Ga0068852_100117472 3300005616 Bacteria 2429
64 Ga0068852_100267316 3300005616 Bacteria 1644
65 Ga0068852_100426948 3300005616 Bacteria 1308
66 Ga0068852_100891740 3300005616 Bacteria 906
67 Ga0068851_10489702 3300005834 Bacteria 736
68 Ga0068870_10031540 3300005840 Bacteria 2686
69 Ga0075366_10000167 3300006195 Bacteria 28115
70 Ga0075366_10386053 3300006195 Bacteria 861
71 Ga0097621_100000551 3300006237 Bacteria 26354
72 Ga0068871_100000072 3300006358 Bacteria 56289
73 Ga0068865_100000309 3300006881 Bacteria 26968
74 Ga0105244_10032026 3300009036 Bacteria 2788
75 Ga0105244_10245524 3300009036 Bacteria 835
76 Ga0105240_10002371 3300009093 Bacteria 30384
77 Ga0105240_10006635 3300009093 Bacteria 16984
78 Ga0105240_10051777 3300009093 Bacteria 5165
79 Ga0105240_10140980 3300009093 Bacteria 2882
80 Ga0105240_10183135 3300009093 Bacteria 2470
81 Ga0105240_10310093 3300009093 Bacteria 1802
82 Ga0105245_10033730 3300009098 Bacteria 4537
83 Ga0105243_10056273 3300009148 Bacteria 3127
84 Ga0105241_10000781 3300009174 Bacteria 24157
85 Ga0105241_10009308 3300009174 Bacteria 7222
86 Ga0105241_10048513 3300009174 Bacteria 3232
87 Ga0105241_10247125 3300009174 Bacteria 1511
88 Ga0105241_10287944 3300009174 Bacteria 1405
89 Ga0105241_10410294 3300009174 Bacteria 1190
90 Ga0105242_10002511 3300009176 Bacteria 14394
91 Ga0105237_10000254 3300009545 Bacteria 75712
92 Ga0105237_10008947 3300009545 Bacteria 10781
93 Ga0105237_10010582 3300009545 Bacteria 9799
94 Ga0105237_10025020 3300009545 Bacteria 6107
95 Ga0105237_10154547 3300009545 Bacteria 2291
96 Ga0105237_10824996 3300009545 Bacteria 934
97 Ga0105238_10006406 3300009551 Bacteria 11710
98 Ga0105238_10143489 3300009551 Bacteria 2364
99 Ga0105238_10824879 3300009551 Bacteria 944
100 Ga0105239_10000015 3300010375 Bacteria 319892
101 Ga0105239_10000040 3300010375 Bacteria 201445
102 Ga0105239_10001808 3300010375 Bacteria 28085
103 Ga0105239_10011518 3300010375 Viruses 9865
104 Ga0105239_10031682 3300010375 Bacteria 5811
105 Ga0105239_10057870 3300010375 Bacteria 4252
106 Ga0105239_10069315 3300010375 Viruses 3875
107 Ga0105239_10288805 3300010375 Bacteria 1847
108 Ga0105239_10318104 3300010375 Bacteria 1754
109 Ga0105239_10554115 3300010375 Bacteria 1309
110 Ga0105246_10111882 3300011119 Bacteria 2007
111 Ga0105246_10760359 3300011119 Bacteria 856
112 Ga0157373_10000509 3300013100 Bacteria 30602
113 Ga0157373_10016566 3300013100 Bacteria 5374
114 Ga0157371_10000276 3300013102 Bacteria 69547
115 Ga0157371_10000421 3300013102 Bacteria 52219
116 Ga0157371_10001599 3300013102 Bacteria 23231
117 Ga0157371_10004145 3300013102 Bacteria 12781
118 Ga0157371_10009252 3300013102 Bacteria 7773
119 Ga0157370_10002639 3300013104 Bacteria 21536
120 Ga0157370_10030626 3300013104 Bacteria 5271
121 Ga0157370_10138407 3300013104 Bacteria 2268
122 Ga0157370_10237536 3300013104 Unclassified 1687
123 Ga0157370_10427128 3300013104 Bacteria 1219
124 Ga0157369_10000040 3300013105 Bacteria 183469
125 Ga0157369_10001134 3300013105 Bacteria 33314
126 Ga0157369_10016243 3300013105 Bacteria 8377
127 Ga0157374_10006987 3300013296 Bacteria 9608
128 Ga0157374_10013535 3300013296 Bacteria 7122
129 Ga0157374_10335139 3300013296 Bacteria 1501
130 Ga0157374_10783125 3300013296 Unclassified 969
131 Ga0157378_10007635 3300013297 Bacteria 9439
132 Ga0163162_10000163 3300013306 Bacteria 61153
133 Ga0163162_10001293 3300013306 Bacteria 23397
134 Ga0163162_10015565 3300013306 Bacteria 7434
135 Ga0163162_10283535 3300013306 Bacteria 1788
136 Ga0163162_10295780 3300013306 Viruses 1751
137 Ga0163162_10358815 3300013306 Bacteria 1590
138 Ga0157372_10000099 3300013307 Bacteria 89946
139 Ga0157372_10001816 3300013307 Bacteria 23157
140 Ga0157372_10006898 3300013307 Bacteria 12086
141 Ga0157372_10063132 3300013307 Bacteria 4152
142 Ga0157372_10172594 3300013307 Bacteria 2502
143 Ga0157372_11464027 3300013307 Bacteria 787
144 Ga0157375_10151111 3300013308 Bacteria 2458
145 Ga0157375_10427748 3300013308 Bacteria 1490
146 Ga0157380_10000026 3300014326 Bacteria 106290
147 Ga0182008_10000131 3300014497 Bacteria 56984
148 Ga0182008_10006954 3300014497 Bacteria 6280
149 Ga0182008_10017239 3300014497 Bacteria 3748
150 Ga0157377_10010524 3300014745 Bacteria 4578
151 Ga0157376_10181102 3300014969 Bacteria 1926
152 Ga0182006_1000302 3300015261 Bacteria 43116
153 Ga0182006_1000644 3300015261 Bacteria 24744
154 Ga0182006_1001419 3300015261 Bacteria 14489
155 Ga0182006_1002630 3300015261 Bacteria 9693
156 Ga0182007_10000003 3300015262 Bacteria 548244
157 Ga0182007_10014088 3300015262 Unclassified 3027
158 Ga0183373_1001 3300015682 Bacteria 1410374
159 Ga0163161_10000284 3300017792 Bacteria 44309
160 Ga0163161_10001539 3300017792 Bacteria 17026
161 Ga0163161_10003354 3300017792 Bacteria 11229
162 Ga0163161_10011746 3300017792 Bacteria 6073
163 Ga0163161_10020222 3300017792 Viruses 4670
164 Ga0163161_10069331 3300017792 Bacteria 2577
165 Ga0213872_10004103 3300021361 Bacteria 7839
166 Ga0207427_100323 3300025231 Bacteria 32232
167 Ga0209437_100089 3300025233 Bacteria 250476
168 Ga0209437_100093 3300025233 Bacteria 239733
169 Ga0207425_1000002 3300025245 Bacteria 1362590
170 Ga0209026_1000663 3300025250 Bacteria 21055
171 Ga0209026_1004173 3300025250 Bacteria 4418
172 Ga0209129_1000002 3300025258 Bacteria 1359086
173 Ga0209129_1002040 3300025258 Viruses 10435
174 Ga0209233_1000089 3300025261 Bacteria 316381
175 Ga0209233_1002681 3300025261 Bacteria 6446
176 Ga0209455_1002014 3300025272 Bacteria 8315
177 Ga0209676_1000008 3300025292 Bacteria 991778
178 Ga0209025_1000004 3300025294 Bacteria 1361782
179 Ga0209758_1000006 3300025297 Bacteria 1359562
180 Ga0209050_1000055 3300025298 Bacteria 339254
181 Ga0207656_10000062 3300025321 Bacteria 42595
182 Ga0207655_1025137 3300025728 Bacteria 2898
183 Ga0207647_10000223 3300025904 Bacteria 46793
184 Ga0207647_10000258 3300025904 Bacteria 43440
185 Ga0207647_10079288 3300025904 Bacteria 1972
186 Ga0207645_10001313 3300025907 Bacteria 20428
187 Ga0207643_10041820 3300025908 Bacteria 2583
188 Ga0207705_10000043 3300025909 Bacteria 181491
189 Ga0207654_10005994 3300025911 Bacteria 6116
190 Ga0207654_10082208 3300025911 Bacteria 1942
191 Ga0207654_10670895 3300025911 Bacteria 743
192 Ga0207707_10100045 3300025912 Bacteria 2534
193 Ga0207707_10264579 3300025912 Bacteria 1491
194 Ga0207707_10396113 3300025912 Bacteria 1186
195 Ga0207695_10000053 3300025913 Bacteria 396740
196 Ga0207695_10005297 3300025913 Bacteria 17193
197 Ga0207695_10007657 3300025913 Bacteria 13682
198 Ga0207695_10095756 3300025913 Bacteria 2972
199 Ga0207695_10158081 3300025913 Bacteria 2200
200 Ga0207695_10430518 3300025913 Bacteria 1203
201 Ga0207695_10603445 3300025913 Bacteria 979
202 Ga0207671_10001672 3300025914 Bacteria 25198
203 Ga0207671_10008435 3300025914 Bacteria 8738
204 Ga0207671_10010120 3300025914 Bacteria 7816
205 Ga0207671_10016508 3300025914 Viruses 5735
206 Ga0207671_10371491 3300025914 Bacteria 1136
207 Ga0207660_10059222 3300025917 Bacteria 2749
208 Ga0207657_10100159 3300025919 Bacteria 2406
209 Ga0207652_10022178 3300025921 Bacteria 5249
210 Ga0207652_10034060 3300025921 Bacteria 4291
211 Ga0207694_10075636 3300025924 Bacteria 2636
212 Ga0207687_10139282 3300025927 Bacteria 1839
213 Ga0207690_10006810 3300025932 Bacteria 6777
214 Ga0207706_10001583 3300025933 Bacteria 22590
215 Ga0207709_10113785 3300025935 Bacteria 1814
216 Ga0207704_10000220 3300025938 Bacteria 28668
217 Ga0207689_10290802 3300025942 Bacteria 1353
218 Ga0207667_10003729 3300025949 Bacteria 18793
219 Ga0207667_10019284 3300025949 Bacteria 7620
220 Ga0207667_10021986 3300025949 Bacteria 7058
221 Ga0207667_10047113 3300025949 Bacteria 4564
222 Ga0207667_10199030 3300025949 Bacteria 2055
223 Ga0207651_10111637 3300025960 Bacteria 2053
224 Ga0207640_10078207 3300025981 Viruses 2251
225 Ga0207639_10009010 3300026041 Bacteria 6871
226 Ga0207639_10225352 3300026041 Bacteria 1622
227 Ga0207639_10670358 3300026041 Bacteria 960
228 Ga0207678_10007480 3300026067 Bacteria 9654
229 Ga0207702_10001182 3300026078 Bacteria 26545
230 Ga0207702_10042934 3300026078 Bacteria 3794
231 Ga0207702_10180135 3300026078 Bacteria 1945
232 Ga0207648_10209659 3300026089 Bacteria 1729
233 Ga0207674_10472985 3300026116 Bacteria 1211
234 Ga0207674_10744139 3300026116 Bacteria 946
235 Ga0207698_10000512 3300026142 Bacteria 22530
236 Ga0207698_10167670 3300026142 Bacteria 1929
237 Ga0207698_10611662 3300026142 Bacteria 1075
238 Ga0207698_11038884 3300026142 Bacteria 831
239 Ga0268266_10000030 3300028379 Bacteria 417120
240 Ga0307517_10010112 3300028786 Bacteria 13257
241 Ga0307515_10000172 3300028794 Bacteria 159265
242 Ga0265338_10234167 3300028800 Bacteria 1364
243 Ga0316177_1116163 3300030731 Bacteria 7914
244 Ga0316176_1033433 3300030732 Bacteria 3850
245 Ga0316183_1095896 3300030742 Bacteria 133299
246 Ga0316181_1136427 3300030744 Bacteria 28129
247 Ga0307509_10119241 3300031507 Bacteria 2620
248 Ga0316578_10004762 3300031728 Bacteria 6466
249 Ga0307516_10240779 3300031730 Bacteria 1508
250 Ga0316577_10134449 3300031733 Unclassified 1392
251 Ga0307407_10000010 3300031903 Bacteria 186970
252 Ga0307409_100003194 3300031995 Bacteria 8814
253 Ga0307416_100000014 3300032002 Bacteria 249053
254 Ga0307414_10004174 3300032004 Bacteria 7805
255 Ga0307414_10011293 3300032004 Bacteria 5232
256 Ga0307414_10141427 3300032004 Bacteria 1884
257 Ga0307414_10153403 3300032004 Bacteria 1820
258 Ga0307411_10005034 3300032005 Bacteria 6430
259 Ga0307411_10133213 3300032005 Bacteria 1820
260 Ga0316585_10022194 3300032137 Unclassified 1952
261 Ga0307507_10000883 3300033179 Bacteria 66623
262 Ga0307510_10034601 3300033180 Bacteria 5655
263 Ga0316582_0015211 3300036647 Unclassified 4392
264 Ga0316582_0144542 3300036647 Bacteria 1605
265 Ga0316584_0042221 3300036712 Bacteria 3400
266 Ga0395899_0001786 3300037312 Bacteria 17821
267 Ga0395900_0000115 3300037418 Bacteria 138474
268 Ga0395900_0055382 3300037418 Bacteria 4084
269 Ga0395898_0057584 3300037466 Bacteria 3787
270 Ga0395905_0000045 3300037471 Bacteria 241370
271 Ga0395905_0000971 3300037471 Bacteria 36768
272 Ga0316581_0210261 3300037588 Bacteria 598
273 Ga0395901_0000706 3300038443 Bacteria 38128
274 Ga0395901_0003779 3300038443 Bacteria 15252
275 Ga0400490_60660 3300038726 Bacteria 8428
276 Ga0400483_165199 3300039062 Unclassified 1339
277 Ga0436365_0215343 3300039437 Bacteria 1046
278 Ga0436361_1219998 3300039447 Bacteria 14535
279 Ga0439448_0014754 3300042005 Bacteria 2359
280 Ga0451577_0336510 3300042876 Bacteria 1369
281 Ga0451577_0495631 3300042876 Bacteria 1109
282 Ga0453683_0005220 3300044673 Bacteria 9094
283 Ga0453683_0298270 3300044673 Bacteria 1031
284 Ga0466966_0016544 3300044684 Bacteria 4870
285 Ga0453684_0038469 3300044712 Bacteria 6539
286 Ga0453684_0225438 3300044712 Bacteria 2167
287 Ga0453684_0525720 3300044712 Bacteria 1306
288 Ga0453684_0724456 3300044712 Bacteria 1079
289 Ga0451576_0003451 3300045051 Bacteria 21678
290 Ga0451576_0148677 3300045051 Bacteria 2443
291 Ga0451576_0220122 3300045051 Bacteria 1982
292 Ga0495650_0000023 3300046471 Bacteria 527763
293 Ga0495650_0031730 3300046471 Bacteria 2373
294 Ga0495650_0077358 3300046471 Bacteria 1291
295 Ga0495605_0151911 3300046474 Bacteria 1033
296 Ga0495585_0000065 3300046492 Bacteria 108945
297 Ga0495596_0048556 3300046500 Bacteria 1664
298 Ga0495583_0024400 3300046506 Bacteria 3039
299 Ga0495606_0000264 3300046507 Bacteria 92733
300 Ga0495606_0007322 3300046507 Bacteria 9927
301 Ga0495606_0067810 3300046507 Bacteria 2258
302 Ga0495606_0110208 3300046507 Viruses 1662
303 Ga0495610_0000889 3300046512 Bacteria 27794
304 Ga0495610_0001152 3300046512 Bacteria 24038
305 Ga0495610_0001292 3300046512 Bacteria 22302
306 Ga0495616_0000999 3300046513 Bacteria 20246
307 Ga0495616_0007744 3300046513 Bacteria 6416
308 Ga0495631_0002396 3300046518 Bacteria 10595
309 Ga0495637_0047176 3300046520 Bacteria 1820
310 Ga0495648_0009331 3300046524 Bacteria 7621
311 Ga0495648_0019949 3300046524 Bacteria 4691
312 Ga0495648_0024152 3300046524 Viruses 4149
313 Ga0495663_0244647 3300046525 Bacteria 635
314 Ga0495652_0177216 3300046529 Bacteria 1640
315 Ga0495609_0003263 3300046538 Bacteria 9376
316 Ga0495609_0020253 3300046538 Bacteria 3074
317 Ga0495633_0000015 3300046558 Bacteria 254484
318 Ga0495633_0060574 3300046558 Bacteria 1773
319 Ga0495668_0000041 3300046616 Bacteria 229462
320 Ga0495668_0217381 3300046616 Bacteria 1046
321 Ga0495625_0000211 3300046660 Bacteria 92222
322 Ga0495625_0001551 3300046660 Bacteria 27391
323 Ga0495625_0009144 3300046660 Bacteria 8337
324 Ga0495625_0015341 3300046660 Bacteria 6070
325 Ga0495625_0048697 3300046660 Bacteria 3050
326 Ga0495625_0222932 3300046660 Bacteria 1234
327 Ga0495661_0001542 3300046665 Bacteria 19060
328 Ga0495661_0020819 3300046665 Bacteria 4277
329 Ga0495658_0110802 3300046683 Bacteria 1650
330 Ga0495671_0165984 3300046692 Bacteria 1074
331 Ga0495649_0000090 3300046694 Bacteria 78509
332 Ga0495660_0046107 3300046810 Bacteria 2391
333 Ga0495683_0064293 3300047323 Bacteria 1812
334 Ga0495687_005319 3300047443 Bacteria 8254
335 Ga0495687_032146 3300047443 Bacteria 2399
336 Ga0495681_0055983 3300047470 Bacteria 1837
337 Ga0495686_0000237 3300047472 Bacteria 100373
338 Ga0495686_0043223 3300047472 Bacteria 2859
339 Ga0495686_0078396 3300047472 Bacteria 2022
340 Ga0495686_0099284 3300047472 Bacteria 1757
341 Ga0495686_0250672 3300047472 Bacteria 995
342 Ga0496115_0046089 3300048918 Bacteria 3483
343 Ga0496122_0007821 3300048925 Bacteria 11746
344 Ga0496123_0022423 3300048926 Bacteria 4867
345 Ga0495678_027019 3300049459 Bacteria 2440
346 Ga0495682_0027561 3300049460 Bacteria 2107
347 Ga0501034_0010085 3300049571 Bacteria 9858
348 Ga0501198_013362 3300049649 Bacteria 1242
349 Ga0501249_057815 3300049679 Bacteria 896
350 nmdc:mga0k408_1133_c2 3300050493 Bacteria 11255
351 nmdc:mga0k408_12383_c1 3300050493 Bacteria 4663
352 Ga0500635_0000344 3300053080 Bacteria 15391
353 Ga0500608_006397 3300053122 Bacteria 4791
354 Ga0500608_116695 3300053122 Bacteria 1216
355 Ga0500614_003073 3300053123 Bacteria 3627
356 Ga0500618_000050 3300053125 Bacteria 105238
357 Ga0500561_0027768 3300053137 Bacteria 1399
358 Ga0500616_0056997 3300053153 Viruses 2038
359 Ga0500624_001985 3300053157 Viruses 2901
360 Ga0500634_0175399 3300053161 Bacteria 971
361 2586208990 2585427687 Bacteria 5544917
362 2599479279 2599185184 Bacteria 6430550
363 2738851987 2738541302 Bacteria 5944758
364 2739590867 2739367651 Bacteria 6359826
365 2739616976 2739367656 Bacteria 5152243
366 2739647279 2739367663 Bacteria 5040914
367 2819546531 2818991437 Bacteria 5805520
368 2842725226 2842722452 Bacteria 6263924
369 2842912501 2842909656 Bacteria 6185908
370 2849286889 2849281842 Bacteria 6065644
371 2857629704 2857627736 Bacteria 5625397
372 2896346713 2896344016 Bacteria 3811746
373 2904446690 2904445276 Bacteria 5310396
374 2919442872 2919437846 Bacteria 6199444
375 2928082410 2928078545 Bacteria 6534839
376 2928149006 2928147474 Bacteria 6512076
377 2932087536 2932082852 Bacteria 6563563
378 2946002148 2945997725 Bacteria 6404843
379 2954019048 2954016120 Bacteria 6446024
380 2977235926 2977232053 Bacteria 5485925
381 JGI24740J21852_10015374
382 JGI24736J21556_1002859
383 JGI24736J21556_1010082
384 JGI24737J22298_10002035
385 JGI24737J22298_10025508
386 JGI24735J21928_10000009
387 JGI24735J21928_10004322
388 JGI25162J39368_1000047
389 JGI25162J39368_1000629
390 JGI25164J39214_1001512
391 JGI25150J39212_1000001
392 JGI25151J46595_10000001
393 JGI25165J46597_1001516
394 JGI25153J46596_10000001
395 rootH1_10016431
396 rootH1_10133809
397 rootH2_10110333
398 rootH2_10236642
399 rootL2_10378943
400 rootH1_10013272
401 rootH1_10013301
402 Ga0055536_1000001
403 Ga0055530_10005264
404 Ga0058862_12601524
405 Ga0065714_10064604
406 Ga0070658_10000435
407 Ga0070658_10130885
408 Ga0070676_10000428
409 Ga0070683_100077225
410 Ga0068869_100366706
411 Ga0070680_100069028
412 Ga0070680_100277248
413 Ga0070682_100151137
414 Ga0070660_100091014
415 Ga0070661_100989185
416 Ga0070673_100002752
417 Ga0070659_100010674
418 Ga0070663_100013905
419 Ga0070662_100002133
420 Ga0070662_100780028
421 Ga0070681_10088820
422 Ga0070681_10123834
423 Ga0070681_10455385
424 Ga0068867_100170886
425 Ga0070679_100031962
426 Ga0070684_100501809
427 Ga0068853_100018769
428 Ga0068853_100030162
429 Ga0068853_100040282
430 Ga0068853_100049163
431 Ga0070665_100000147
432 Ga0068855_100045273
433 Ga0068855_100056817
434 Ga0068855_100121022
435 Ga0068855_100262331
436 Ga0068855_100311418
437 Ga0068857_100200244
438 Ga0068854_100068659
439 Ga0068856_100001297
440 Ga0068856_100012281
441 Ga0068852_100000913
442 Ga0068852_100046465
443 Ga0068852_100117472
444 Ga0068852_100267316
445 Ga0068852_100426948
446 Ga0068852_100891740
447 Ga0068851_10489702
448 Ga0068870_10031540
449 Ga0075366_10000167
450 Ga0075366_10386053
451 Ga0097621_100000551
452 Ga0068871_100000072
453 Ga0068865_100000309
454 Ga0105244_10032026
455 Ga0105244_10245524
456 Ga0105240_10002371
457 Ga0105240_10006635
458 Ga0105240_10051777
459 Ga0105240_10140980
460 Ga0105240_10183135
461 Ga0105240_10310093
462 Ga0105245_10033730
463 Ga0105243_10056273
464 Ga0105241_10000781
465 Ga0105241_10009308
466 Ga0105241_10048513
467 Ga0105241_10247125
468 Ga0105241_10287944
469 Ga0105241_10410294
470 Ga0105242_10002511
471 Ga0105237_10000254
472 Ga0105237_10008947
473 Ga0105237_10010582
474 Ga0105237_10025020
475 Ga0105237_10154547
476 Ga0105237_10824996
477 Ga0105238_10006406
478 Ga0105238_10143489
479 Ga0105238_10824879
480 Ga0105239_10000015
481 Ga0105239_10000040
482 Ga0105239_10001808
483 Ga0105239_10011518
484 Ga0105239_10031682
485 Ga0105239_10057870
486 Ga0105239_10069315
487 Ga0105239_10288805
488 Ga0105239_10318104
489 Ga0105239_10554115
490 Ga0105246_10111882
491 Ga0105246_10760359
492 Ga0157373_10000509
493 Ga0157373_10016566
494 Ga0157371_10000276
495 Ga0157371_10000421
496 Ga0157371_10001599
497 Ga0157371_10004145
498 Ga0157371_10009252
499 Ga0157370_10002639
500 Ga0157370_10030626
501 Ga0157370_10138407
502 Ga0157370_10237536
503 Ga0157370_10427128
504 Ga0157369_10000040
505 Ga0157369_10001134
506 Ga0157369_10016243
507 Ga0157374_10006987
508 Ga0157374_10013535
509 Ga0157374_10335139
510 Ga0157374_10783125
511 Ga0157378_10007635
512 Ga0163162_10000163
513 Ga0163162_10001293
514 Ga0163162_10015565
515 Ga0163162_10283535
516 Ga0163162_10295780
517 Ga0163162_10358815
518 Ga0157372_10000099
519 Ga0157372_10001816
520 Ga0157372_10006898
521 Ga0157372_10063132
522 Ga0157372_10172594
523 Ga0157372_11464027
524 Ga0157375_10151111
525 Ga0157375_10427748
526 Ga0157380_10000026
527 Ga0182008_10000131
528 Ga0182008_10006954
529 Ga0182008_10017239
530 Ga0157377_10010524
531 Ga0157376_10181102
532 Ga0182006_1000302
533 Ga0182006_1000644
534 Ga0182006_1001419
535 Ga0182006_1002630
536 Ga0182007_10000003
537 Ga0182007_10014088
538 Ga0183373_1001
539 Ga0163161_10000284
540 Ga0163161_10001539
541 Ga0163161_10003354
542 Ga0163161_10011746
543 Ga0163161_10020222
544 Ga0163161_10069331
545 Ga0213872_10004103
546 Ga0207427_100323
547 Ga0209437_100089
548 Ga0209437_100093
549 Ga0207425_1000002
550 Ga0209026_1000663
551 Ga0209026_1004173
552 Ga0209129_1000002
553 Ga0209129_1002040
554 Ga0209233_1000089
555 Ga0209233_1002681
556 Ga0209455_1002014
557 Ga0209676_1000008
558 Ga0209025_1000004
559 Ga0209758_1000006
560 Ga0209050_1000055
561 Ga0207656_10000062
562 Ga0207655_1025137
563 Ga0207647_10000223
564 Ga0207647_10000258
565 Ga0207647_10079288
566 Ga0207645_10001313
567 Ga0207643_10041820
568 Ga0207705_10000043
569 Ga0207654_10005994
570 Ga0207654_10082208
571 Ga0207654_10670895
572 Ga0207707_10100045
573 Ga0207707_10264579
574 Ga0207707_10396113
575 Ga0207695_10000053
576 Ga0207695_10005297
577 Ga0207695_10007657
578 Ga0207695_10095756
579 Ga0207695_10158081
580 Ga0207695_10430518
581 Ga0207695_10603445
582 Ga0207671_10001672
583 Ga0207671_10008435
584 Ga0207671_10010120
585 Ga0207671_10016508
586 Ga0207671_10371491
587 Ga0207660_10059222
588 Ga0207657_10100159
589 Ga0207652_10022178
590 Ga0207652_10034060
591 Ga0207694_10075636
592 Ga0207687_10139282
593 Ga0207690_10006810
594 Ga0207706_10001583
595 Ga0207709_10113785
596 Ga0207704_10000220
597 Ga0207689_10290802
598 Ga0207667_10003729
599 Ga0207667_10019284
600 Ga0207667_10021986
601 Ga0207667_10047113
602 Ga0207667_10199030
603 Ga0207651_10111637
604 Ga0207640_10078207
605 Ga0207639_10009010
606 Ga0207639_10225352
607 Ga0207639_10670358
608 Ga0207678_10007480
609 Ga0207702_10001182
610 Ga0207702_10042934
611 Ga0207702_10180135
612 Ga0207648_10209659
613 Ga0207674_10472985
614 Ga0207674_10744139
615 Ga0207698_10000512
616 Ga0207698_10167670
617 Ga0207698_10611662
618 Ga0207698_11038884
619 Ga0268266_10000030
620 Ga0307517_10010112
621 Ga0307515_10000172
622 Ga0265338_10234167
623 Ga0316177_1116163
624 Ga0316176_1033433
625 Ga0316183_1095896
626 Ga0316181_1136427
627 Ga0307509_10119241
628 Ga0316578_10004762
629 Ga0307516_10240779
630 Ga0316577_10134449
631 Ga0307407_10000010
632 Ga0307409_100003194
633 Ga0307416_100000014
634 Ga0307414_10004174
635 Ga0307414_10011293
636 Ga0307414_10141427
637 Ga0307414_10153403
638 Ga0307411_10005034
639 Ga0307411_10133213
640 Ga0316585_10022194
641 Ga0307507_10000883
642 Ga0307510_10034601
643 Ga0316582_0015211
644 Ga0316582_0144542
645 Ga0316584_0042221
646 Ga0395899_0001786
647 Ga0395900_0000115
648 Ga0395900_0055382
649 Ga0395898_0057584
650 Ga0395905_0000045
651 Ga0395905_0000971
652 Ga0316581_0210261
653 Ga0395901_0000706
654 Ga0395901_0003779
655 Ga0400490_60660
656 Ga0400483_165199
657 Ga0436365_0215343
658 Ga0436361_1219998
659 Ga0439448_0014754
660 Ga0451577_0336510
661 Ga0451577_0495631
662 Ga0453683_0005220
663 Ga0453683_0298270
664 Ga0466966_0016544
665 Ga0453684_0038469
666 Ga0453684_0225438
667 Ga0453684_0525720
668 Ga0453684_0724456
669 Ga0451576_0003451
670 Ga0451576_0148677
671 Ga0451576_0220122
672 Ga0495650_0000023
673 Ga0495650_0031730
674 Ga0495650_0077358
675 Ga0495605_0151911
676 Ga0495585_0000065
677 Ga0495596_0048556
678 Ga0495583_0024400
679 Ga0495606_0000264
680 Ga0495606_0007322
681 Ga0495606_0067810
682 Ga0495606_0110208
683 Ga0495610_0000889
684 Ga0495610_0001152
685 Ga0495610_0001292
686 Ga0495616_0000999
687 Ga0495616_0007744
688 Ga0495631_0002396
689 Ga0495637_0047176
690 Ga0495648_0009331
691 Ga0495648_0019949
692 Ga0495648_0024152
693 Ga0495663_0244647
694 Ga0495652_0177216
695 Ga0495609_0003263
696 Ga0495609_0020253
697 Ga0495633_0000015
698 Ga0495633_0060574
699 Ga0495668_0000041
700 Ga0495668_0217381
701 Ga0495625_0000211
702 Ga0495625_0001551
703 Ga0495625_0009144
704 Ga0495625_0015341
705 Ga0495625_0048697
706 Ga0495625_0222932
707 Ga0495661_0001542
708 Ga0495661_0020819
709 Ga0495658_0110802
710 Ga0495671_0165984
711 Ga0495649_0000090
712 Ga0495660_0046107
713 Ga0495683_0064293
714 Ga0495687_005319
715 Ga0495687_032146
716 Ga0495681_0055983
717 Ga0495686_0000237
718 Ga0495686_0043223
719 Ga0495686_0078396
720 Ga0495686_0099284
721 Ga0495686_0250672
722 Ga0496115_0046089
723 Ga0496122_0007821
724 Ga0496123_0022423
725 Ga0495678_027019
726 Ga0495682_0027561
727 Ga0501034_0010085
728 Ga0501198_013362
729 Ga0501249_057815
730 nmdc:mga0k408_1133_c2
731 nmdc:mga0k408_12383_c1
732 Ga0500635_0000344
733 Ga0500608_006397
734 Ga0500608_116695
735 Ga0500614_003073
736 Ga0500618_000050
737 Ga0500561_0027768
738 Ga0500616_0056997
739 Ga0500624_001985
740 Ga0500634_0175399
741 2586208990
742 2599479279
743 2738851987
744 2739590867
745 2739616976
746 2739647279
747 2819546531
748 2842725226
749 2842912501
750 2849286889
751 2857629704
752 2896346713
753 2904446690
754 2919442872
755 2928082410
756 2928149006
757 2932087536
758 2946002148
759 2954019048
760 2977235926

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00265

TK

Thymidine kinase

16

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qq0-assembly1.cif.gz_A-2 thymidine kinase from thermotoga maritima in complex with thymidine + appnhp 0.9621 16 189
1xbt-assembly2.cif.gz_H crystal structure of human thymidine kinase 1 0.9619 16 188
2wvj-assembly2.cif.gz_G mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine 0.9593 16 188
1w4r-assembly2.cif.gz_E structure of a type ii thymidine kinase with bound dttp 0.9585 16 188
1w4r-assembly2.cif.gz_H structure of a type ii thymidine kinase with bound dttp 0.9571 16 188
ID Description Score Start End Superfamily
af_Q2FWD9_1_141_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9814 16 148 3.40.50.300
2qpoC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9614 16 147 3.40.50.300
2wvjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9593 16 148 3.40.50.300
2wvjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9436 16 148 3.40.50.300
af_P27158_18_121_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9391 16 119 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4V6JSZ1-F1-model_v4 deleted 1 22 108
AF-A0A3A4R914-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9947 16 136 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A7C2B3U8-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9944 14 155 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A2M7NCF7-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9939 48 189 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897
AF-A0A558BN94-F1-model_v4 Thymidine kinase (EC 2.7.1.21) 0.9933 25 188 GO:0004797
GO:0005524
GO:0005829
GO:0046104
GO:0071897

Map