F428522
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 380 | 216 | 760 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300001979|JGI24740J21852_10015374|JGI24740J21852_100153742 |
| Length | 195 |
| Sequence | MLFSEDVFKRRSELGGSIEVICGSMFSGKTEELIRRLKRAQIARFNVEIFKPKTDTRYDEAAVVSHDATSIPSVPVEHSSAILLMLNSDVQVVGIDEAQFFDEELPHICTLLANRGIRVIVAGLDMDFKGNPFGPMPALMAMAESVTKVHAVCVRCGSPALYSYRLASNETRILLGEKESYEPRCRQCYNEDGSI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 76 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 121 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 122 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 123 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 124 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 125 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 127 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 128 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 134 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 135 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 136 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 137 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 145 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 148 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 149 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 150 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 181 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 182 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 183 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 187 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 188 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 189 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 190 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 191 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 192 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 195 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 196 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 197 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 198 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 199 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 200 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 201 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 202 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 203 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 204 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 205 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 206 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 207 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 208 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 209 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 210 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 211 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 212 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 213 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 214 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 215 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 216 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.47 |
| Metatranscriptomes | 0.26 |
| Isolates | 5.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.21 |
| Nodule | 0 |
| Rhizoplane | 0.53 |
| Rhizosphere | 82.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10015374 | 3300001979 | Bacteria | 2796 |
| 2 | JGI24736J21556_1002859 | 3300001904 | Bacteria | 3027 |
| 3 | JGI24736J21556_1010082 | 3300001904 | Bacteria | 1549 |
| 4 | JGI24737J22298_10002035 | 3300001990 | Bacteria | 7231 |
| 5 | JGI24737J22298_10025508 | 3300001990 | Bacteria | 1869 |
| 6 | JGI24735J21928_10000009 | 3300002067 | Bacteria | 247425 |
| 7 | JGI24735J21928_10004322 | 3300002067 | Bacteria | 4782 |
| 8 | JGI25162J39368_1000047 | 3300002737 | Viruses | 167507 |
| 9 | JGI25162J39368_1000629 | 3300002737 | Bacteria | 25079 |
| 10 | JGI25164J39214_1001512 | 3300002772 | Bacteria | 5224 |
| 11 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 12 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 13 | JGI25165J46597_1001516 | 3300003214 | Bacteria | 11746 |
| 14 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 15 | rootH1_10016431 | 3300003316 | Bacteria | 17515 |
| 16 | rootH1_10133809 | 3300003316 | Bacteria | 10911 |
| 17 | rootH2_10110333 | 3300003320 | Bacteria | 2810 |
| 18 | rootH2_10236642 | 3300003320 | Bacteria | 1789 |
| 19 | rootL2_10378943 | 3300003322 | Bacteria | 1744 |
| 20 | rootH1_10013272 | 3300003323 | Bacteria | 21197 |
| 21 | rootH1_10013301 | 3300003323 | Bacteria | 24681 |
| 22 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 23 | Ga0055530_10005264 | 3300003791 | Bacteria | 6226 |
| 24 | Ga0058862_12601524 | 3300004803 | Bacteria | 719 |
| 25 | Ga0065714_10064604 | 3300005288 | Bacteria | 29598 |
| 26 | Ga0070658_10000435 | 3300005327 | Bacteria | 36388 |
| 27 | Ga0070658_10130885 | 3300005327 | Bacteria | 2091 |
| 28 | Ga0070676_10000428 | 3300005328 | Bacteria | 19934 |
| 29 | Ga0070683_100077225 | 3300005329 | Bacteria | 3114 |
| 30 | Ga0068869_100366706 | 3300005334 | Bacteria | 1177 |
| 31 | Ga0070680_100069028 | 3300005336 | Bacteria | 2902 |
| 32 | Ga0070680_100277248 | 3300005336 | Bacteria | 1420 |
| 33 | Ga0070682_100151137 | 3300005337 | Bacteria | 1593 |
| 34 | Ga0070660_100091014 | 3300005339 | Bacteria | 2406 |
| 35 | Ga0070661_100989185 | 3300005344 | Bacteria | 697 |
| 36 | Ga0070673_100002752 | 3300005364 | Bacteria | 10800 |
| 37 | Ga0070659_100010674 | 3300005366 | Bacteria | 6765 |
| 38 | Ga0070663_100013905 | 3300005455 | Bacteria | 5149 |
| 39 | Ga0070662_100002133 | 3300005457 | Bacteria | 12133 |
| 40 | Ga0070662_100780028 | 3300005457 | Bacteria | 812 |
| 41 | Ga0070681_10088820 | 3300005458 | Bacteria | 3042 |
| 42 | Ga0070681_10123834 | 3300005458 | Bacteria | 2518 |
| 43 | Ga0070681_10455385 | 3300005458 | Bacteria | 1192 |
| 44 | Ga0068867_100170886 | 3300005459 | Bacteria | 1721 |
| 45 | Ga0070679_100031962 | 3300005530 | Bacteria | 5205 |
| 46 | Ga0070684_100501809 | 3300005535 | Bacteria | 1124 |
| 47 | Ga0068853_100018769 | 3300005539 | Bacteria | 5727 |
| 48 | Ga0068853_100030162 | 3300005539 | Bacteria | 4579 |
| 49 | Ga0068853_100040282 | 3300005539 | Bacteria | 3986 |
| 50 | Ga0068853_100049163 | 3300005539 | Bacteria | 3623 |
| 51 | Ga0070665_100000147 | 3300005548 | Bacteria | 129683 |
| 52 | Ga0068855_100045273 | 3300005563 | Bacteria | 5204 |
| 53 | Ga0068855_100056817 | 3300005563 | Bacteria | 4589 |
| 54 | Ga0068855_100121022 | 3300005563 | Bacteria | 2996 |
| 55 | Ga0068855_100262331 | 3300005563 | Bacteria | 1924 |
| 56 | Ga0068855_100311418 | 3300005563 | Bacteria | 1742 |
| 57 | Ga0068857_100200244 | 3300005577 | Bacteria | 1820 |
| 58 | Ga0068854_100068659 | 3300005578 | Viruses | 2585 |
| 59 | Ga0068856_100001297 | 3300005614 | Bacteria | 26299 |
| 60 | Ga0068856_100012281 | 3300005614 | Bacteria | 8295 |
| 61 | Ga0068852_100000913 | 3300005616 | Bacteria | 19584 |
| 62 | Ga0068852_100046465 | 3300005616 | Bacteria | 3700 |
| 63 | Ga0068852_100117472 | 3300005616 | Bacteria | 2429 |
| 64 | Ga0068852_100267316 | 3300005616 | Bacteria | 1644 |
| 65 | Ga0068852_100426948 | 3300005616 | Bacteria | 1308 |
| 66 | Ga0068852_100891740 | 3300005616 | Bacteria | 906 |
| 67 | Ga0068851_10489702 | 3300005834 | Bacteria | 736 |
| 68 | Ga0068870_10031540 | 3300005840 | Bacteria | 2686 |
| 69 | Ga0075366_10000167 | 3300006195 | Bacteria | 28115 |
| 70 | Ga0075366_10386053 | 3300006195 | Bacteria | 861 |
| 71 | Ga0097621_100000551 | 3300006237 | Bacteria | 26354 |
| 72 | Ga0068871_100000072 | 3300006358 | Bacteria | 56289 |
| 73 | Ga0068865_100000309 | 3300006881 | Bacteria | 26968 |
| 74 | Ga0105244_10032026 | 3300009036 | Bacteria | 2788 |
| 75 | Ga0105244_10245524 | 3300009036 | Bacteria | 835 |
| 76 | Ga0105240_10002371 | 3300009093 | Bacteria | 30384 |
| 77 | Ga0105240_10006635 | 3300009093 | Bacteria | 16984 |
| 78 | Ga0105240_10051777 | 3300009093 | Bacteria | 5165 |
| 79 | Ga0105240_10140980 | 3300009093 | Bacteria | 2882 |
| 80 | Ga0105240_10183135 | 3300009093 | Bacteria | 2470 |
| 81 | Ga0105240_10310093 | 3300009093 | Bacteria | 1802 |
| 82 | Ga0105245_10033730 | 3300009098 | Bacteria | 4537 |
| 83 | Ga0105243_10056273 | 3300009148 | Bacteria | 3127 |
| 84 | Ga0105241_10000781 | 3300009174 | Bacteria | 24157 |
| 85 | Ga0105241_10009308 | 3300009174 | Bacteria | 7222 |
| 86 | Ga0105241_10048513 | 3300009174 | Bacteria | 3232 |
| 87 | Ga0105241_10247125 | 3300009174 | Bacteria | 1511 |
| 88 | Ga0105241_10287944 | 3300009174 | Bacteria | 1405 |
| 89 | Ga0105241_10410294 | 3300009174 | Bacteria | 1190 |
| 90 | Ga0105242_10002511 | 3300009176 | Bacteria | 14394 |
| 91 | Ga0105237_10000254 | 3300009545 | Bacteria | 75712 |
| 92 | Ga0105237_10008947 | 3300009545 | Bacteria | 10781 |
| 93 | Ga0105237_10010582 | 3300009545 | Bacteria | 9799 |
| 94 | Ga0105237_10025020 | 3300009545 | Bacteria | 6107 |
| 95 | Ga0105237_10154547 | 3300009545 | Bacteria | 2291 |
| 96 | Ga0105237_10824996 | 3300009545 | Bacteria | 934 |
| 97 | Ga0105238_10006406 | 3300009551 | Bacteria | 11710 |
| 98 | Ga0105238_10143489 | 3300009551 | Bacteria | 2364 |
| 99 | Ga0105238_10824879 | 3300009551 | Bacteria | 944 |
| 100 | Ga0105239_10000015 | 3300010375 | Bacteria | 319892 |
| 101 | Ga0105239_10000040 | 3300010375 | Bacteria | 201445 |
| 102 | Ga0105239_10001808 | 3300010375 | Bacteria | 28085 |
| 103 | Ga0105239_10011518 | 3300010375 | Viruses | 9865 |
| 104 | Ga0105239_10031682 | 3300010375 | Bacteria | 5811 |
| 105 | Ga0105239_10057870 | 3300010375 | Bacteria | 4252 |
| 106 | Ga0105239_10069315 | 3300010375 | Viruses | 3875 |
| 107 | Ga0105239_10288805 | 3300010375 | Bacteria | 1847 |
| 108 | Ga0105239_10318104 | 3300010375 | Bacteria | 1754 |
| 109 | Ga0105239_10554115 | 3300010375 | Bacteria | 1309 |
| 110 | Ga0105246_10111882 | 3300011119 | Bacteria | 2007 |
| 111 | Ga0105246_10760359 | 3300011119 | Bacteria | 856 |
| 112 | Ga0157373_10000509 | 3300013100 | Bacteria | 30602 |
| 113 | Ga0157373_10016566 | 3300013100 | Bacteria | 5374 |
| 114 | Ga0157371_10000276 | 3300013102 | Bacteria | 69547 |
| 115 | Ga0157371_10000421 | 3300013102 | Bacteria | 52219 |
| 116 | Ga0157371_10001599 | 3300013102 | Bacteria | 23231 |
| 117 | Ga0157371_10004145 | 3300013102 | Bacteria | 12781 |
| 118 | Ga0157371_10009252 | 3300013102 | Bacteria | 7773 |
| 119 | Ga0157370_10002639 | 3300013104 | Bacteria | 21536 |
| 120 | Ga0157370_10030626 | 3300013104 | Bacteria | 5271 |
| 121 | Ga0157370_10138407 | 3300013104 | Bacteria | 2268 |
| 122 | Ga0157370_10237536 | 3300013104 | Unclassified | 1687 |
| 123 | Ga0157370_10427128 | 3300013104 | Bacteria | 1219 |
| 124 | Ga0157369_10000040 | 3300013105 | Bacteria | 183469 |
| 125 | Ga0157369_10001134 | 3300013105 | Bacteria | 33314 |
| 126 | Ga0157369_10016243 | 3300013105 | Bacteria | 8377 |
| 127 | Ga0157374_10006987 | 3300013296 | Bacteria | 9608 |
| 128 | Ga0157374_10013535 | 3300013296 | Bacteria | 7122 |
| 129 | Ga0157374_10335139 | 3300013296 | Bacteria | 1501 |
| 130 | Ga0157374_10783125 | 3300013296 | Unclassified | 969 |
| 131 | Ga0157378_10007635 | 3300013297 | Bacteria | 9439 |
| 132 | Ga0163162_10000163 | 3300013306 | Bacteria | 61153 |
| 133 | Ga0163162_10001293 | 3300013306 | Bacteria | 23397 |
| 134 | Ga0163162_10015565 | 3300013306 | Bacteria | 7434 |
| 135 | Ga0163162_10283535 | 3300013306 | Bacteria | 1788 |
| 136 | Ga0163162_10295780 | 3300013306 | Viruses | 1751 |
| 137 | Ga0163162_10358815 | 3300013306 | Bacteria | 1590 |
| 138 | Ga0157372_10000099 | 3300013307 | Bacteria | 89946 |
| 139 | Ga0157372_10001816 | 3300013307 | Bacteria | 23157 |
| 140 | Ga0157372_10006898 | 3300013307 | Bacteria | 12086 |
| 141 | Ga0157372_10063132 | 3300013307 | Bacteria | 4152 |
| 142 | Ga0157372_10172594 | 3300013307 | Bacteria | 2502 |
| 143 | Ga0157372_11464027 | 3300013307 | Bacteria | 787 |
| 144 | Ga0157375_10151111 | 3300013308 | Bacteria | 2458 |
| 145 | Ga0157375_10427748 | 3300013308 | Bacteria | 1490 |
| 146 | Ga0157380_10000026 | 3300014326 | Bacteria | 106290 |
| 147 | Ga0182008_10000131 | 3300014497 | Bacteria | 56984 |
| 148 | Ga0182008_10006954 | 3300014497 | Bacteria | 6280 |
| 149 | Ga0182008_10017239 | 3300014497 | Bacteria | 3748 |
| 150 | Ga0157377_10010524 | 3300014745 | Bacteria | 4578 |
| 151 | Ga0157376_10181102 | 3300014969 | Bacteria | 1926 |
| 152 | Ga0182006_1000302 | 3300015261 | Bacteria | 43116 |
| 153 | Ga0182006_1000644 | 3300015261 | Bacteria | 24744 |
| 154 | Ga0182006_1001419 | 3300015261 | Bacteria | 14489 |
| 155 | Ga0182006_1002630 | 3300015261 | Bacteria | 9693 |
| 156 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 157 | Ga0182007_10014088 | 3300015262 | Unclassified | 3027 |
| 158 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 159 | Ga0163161_10000284 | 3300017792 | Bacteria | 44309 |
| 160 | Ga0163161_10001539 | 3300017792 | Bacteria | 17026 |
| 161 | Ga0163161_10003354 | 3300017792 | Bacteria | 11229 |
| 162 | Ga0163161_10011746 | 3300017792 | Bacteria | 6073 |
| 163 | Ga0163161_10020222 | 3300017792 | Viruses | 4670 |
| 164 | Ga0163161_10069331 | 3300017792 | Bacteria | 2577 |
| 165 | Ga0213872_10004103 | 3300021361 | Bacteria | 7839 |
| 166 | Ga0207427_100323 | 3300025231 | Bacteria | 32232 |
| 167 | Ga0209437_100089 | 3300025233 | Bacteria | 250476 |
| 168 | Ga0209437_100093 | 3300025233 | Bacteria | 239733 |
| 169 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 170 | Ga0209026_1000663 | 3300025250 | Bacteria | 21055 |
| 171 | Ga0209026_1004173 | 3300025250 | Bacteria | 4418 |
| 172 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 173 | Ga0209129_1002040 | 3300025258 | Viruses | 10435 |
| 174 | Ga0209233_1000089 | 3300025261 | Bacteria | 316381 |
| 175 | Ga0209233_1002681 | 3300025261 | Bacteria | 6446 |
| 176 | Ga0209455_1002014 | 3300025272 | Bacteria | 8315 |
| 177 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 178 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 179 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 180 | Ga0209050_1000055 | 3300025298 | Bacteria | 339254 |
| 181 | Ga0207656_10000062 | 3300025321 | Bacteria | 42595 |
| 182 | Ga0207655_1025137 | 3300025728 | Bacteria | 2898 |
| 183 | Ga0207647_10000223 | 3300025904 | Bacteria | 46793 |
| 184 | Ga0207647_10000258 | 3300025904 | Bacteria | 43440 |
| 185 | Ga0207647_10079288 | 3300025904 | Bacteria | 1972 |
| 186 | Ga0207645_10001313 | 3300025907 | Bacteria | 20428 |
| 187 | Ga0207643_10041820 | 3300025908 | Bacteria | 2583 |
| 188 | Ga0207705_10000043 | 3300025909 | Bacteria | 181491 |
| 189 | Ga0207654_10005994 | 3300025911 | Bacteria | 6116 |
| 190 | Ga0207654_10082208 | 3300025911 | Bacteria | 1942 |
| 191 | Ga0207654_10670895 | 3300025911 | Bacteria | 743 |
| 192 | Ga0207707_10100045 | 3300025912 | Bacteria | 2534 |
| 193 | Ga0207707_10264579 | 3300025912 | Bacteria | 1491 |
| 194 | Ga0207707_10396113 | 3300025912 | Bacteria | 1186 |
| 195 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 196 | Ga0207695_10005297 | 3300025913 | Bacteria | 17193 |
| 197 | Ga0207695_10007657 | 3300025913 | Bacteria | 13682 |
| 198 | Ga0207695_10095756 | 3300025913 | Bacteria | 2972 |
| 199 | Ga0207695_10158081 | 3300025913 | Bacteria | 2200 |
| 200 | Ga0207695_10430518 | 3300025913 | Bacteria | 1203 |
| 201 | Ga0207695_10603445 | 3300025913 | Bacteria | 979 |
| 202 | Ga0207671_10001672 | 3300025914 | Bacteria | 25198 |
| 203 | Ga0207671_10008435 | 3300025914 | Bacteria | 8738 |
| 204 | Ga0207671_10010120 | 3300025914 | Bacteria | 7816 |
| 205 | Ga0207671_10016508 | 3300025914 | Viruses | 5735 |
| 206 | Ga0207671_10371491 | 3300025914 | Bacteria | 1136 |
| 207 | Ga0207660_10059222 | 3300025917 | Bacteria | 2749 |
| 208 | Ga0207657_10100159 | 3300025919 | Bacteria | 2406 |
| 209 | Ga0207652_10022178 | 3300025921 | Bacteria | 5249 |
| 210 | Ga0207652_10034060 | 3300025921 | Bacteria | 4291 |
| 211 | Ga0207694_10075636 | 3300025924 | Bacteria | 2636 |
| 212 | Ga0207687_10139282 | 3300025927 | Bacteria | 1839 |
| 213 | Ga0207690_10006810 | 3300025932 | Bacteria | 6777 |
| 214 | Ga0207706_10001583 | 3300025933 | Bacteria | 22590 |
| 215 | Ga0207709_10113785 | 3300025935 | Bacteria | 1814 |
| 216 | Ga0207704_10000220 | 3300025938 | Bacteria | 28668 |
| 217 | Ga0207689_10290802 | 3300025942 | Bacteria | 1353 |
| 218 | Ga0207667_10003729 | 3300025949 | Bacteria | 18793 |
| 219 | Ga0207667_10019284 | 3300025949 | Bacteria | 7620 |
| 220 | Ga0207667_10021986 | 3300025949 | Bacteria | 7058 |
| 221 | Ga0207667_10047113 | 3300025949 | Bacteria | 4564 |
| 222 | Ga0207667_10199030 | 3300025949 | Bacteria | 2055 |
| 223 | Ga0207651_10111637 | 3300025960 | Bacteria | 2053 |
| 224 | Ga0207640_10078207 | 3300025981 | Viruses | 2251 |
| 225 | Ga0207639_10009010 | 3300026041 | Bacteria | 6871 |
| 226 | Ga0207639_10225352 | 3300026041 | Bacteria | 1622 |
| 227 | Ga0207639_10670358 | 3300026041 | Bacteria | 960 |
| 228 | Ga0207678_10007480 | 3300026067 | Bacteria | 9654 |
| 229 | Ga0207702_10001182 | 3300026078 | Bacteria | 26545 |
| 230 | Ga0207702_10042934 | 3300026078 | Bacteria | 3794 |
| 231 | Ga0207702_10180135 | 3300026078 | Bacteria | 1945 |
| 232 | Ga0207648_10209659 | 3300026089 | Bacteria | 1729 |
| 233 | Ga0207674_10472985 | 3300026116 | Bacteria | 1211 |
| 234 | Ga0207674_10744139 | 3300026116 | Bacteria | 946 |
| 235 | Ga0207698_10000512 | 3300026142 | Bacteria | 22530 |
| 236 | Ga0207698_10167670 | 3300026142 | Bacteria | 1929 |
| 237 | Ga0207698_10611662 | 3300026142 | Bacteria | 1075 |
| 238 | Ga0207698_11038884 | 3300026142 | Bacteria | 831 |
| 239 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 240 | Ga0307517_10010112 | 3300028786 | Bacteria | 13257 |
| 241 | Ga0307515_10000172 | 3300028794 | Bacteria | 159265 |
| 242 | Ga0265338_10234167 | 3300028800 | Bacteria | 1364 |
| 243 | Ga0316177_1116163 | 3300030731 | Bacteria | 7914 |
| 244 | Ga0316176_1033433 | 3300030732 | Bacteria | 3850 |
| 245 | Ga0316183_1095896 | 3300030742 | Bacteria | 133299 |
| 246 | Ga0316181_1136427 | 3300030744 | Bacteria | 28129 |
| 247 | Ga0307509_10119241 | 3300031507 | Bacteria | 2620 |
| 248 | Ga0316578_10004762 | 3300031728 | Bacteria | 6466 |
| 249 | Ga0307516_10240779 | 3300031730 | Bacteria | 1508 |
| 250 | Ga0316577_10134449 | 3300031733 | Unclassified | 1392 |
| 251 | Ga0307407_10000010 | 3300031903 | Bacteria | 186970 |
| 252 | Ga0307409_100003194 | 3300031995 | Bacteria | 8814 |
| 253 | Ga0307416_100000014 | 3300032002 | Bacteria | 249053 |
| 254 | Ga0307414_10004174 | 3300032004 | Bacteria | 7805 |
| 255 | Ga0307414_10011293 | 3300032004 | Bacteria | 5232 |
| 256 | Ga0307414_10141427 | 3300032004 | Bacteria | 1884 |
| 257 | Ga0307414_10153403 | 3300032004 | Bacteria | 1820 |
| 258 | Ga0307411_10005034 | 3300032005 | Bacteria | 6430 |
| 259 | Ga0307411_10133213 | 3300032005 | Bacteria | 1820 |
| 260 | Ga0316585_10022194 | 3300032137 | Unclassified | 1952 |
| 261 | Ga0307507_10000883 | 3300033179 | Bacteria | 66623 |
| 262 | Ga0307510_10034601 | 3300033180 | Bacteria | 5655 |
| 263 | Ga0316582_0015211 | 3300036647 | Unclassified | 4392 |
| 264 | Ga0316582_0144542 | 3300036647 | Bacteria | 1605 |
| 265 | Ga0316584_0042221 | 3300036712 | Bacteria | 3400 |
| 266 | Ga0395899_0001786 | 3300037312 | Bacteria | 17821 |
| 267 | Ga0395900_0000115 | 3300037418 | Bacteria | 138474 |
| 268 | Ga0395900_0055382 | 3300037418 | Bacteria | 4084 |
| 269 | Ga0395898_0057584 | 3300037466 | Bacteria | 3787 |
| 270 | Ga0395905_0000045 | 3300037471 | Bacteria | 241370 |
| 271 | Ga0395905_0000971 | 3300037471 | Bacteria | 36768 |
| 272 | Ga0316581_0210261 | 3300037588 | Bacteria | 598 |
| 273 | Ga0395901_0000706 | 3300038443 | Bacteria | 38128 |
| 274 | Ga0395901_0003779 | 3300038443 | Bacteria | 15252 |
| 275 | Ga0400490_60660 | 3300038726 | Bacteria | 8428 |
| 276 | Ga0400483_165199 | 3300039062 | Unclassified | 1339 |
| 277 | Ga0436365_0215343 | 3300039437 | Bacteria | 1046 |
| 278 | Ga0436361_1219998 | 3300039447 | Bacteria | 14535 |
| 279 | Ga0439448_0014754 | 3300042005 | Bacteria | 2359 |
| 280 | Ga0451577_0336510 | 3300042876 | Bacteria | 1369 |
| 281 | Ga0451577_0495631 | 3300042876 | Bacteria | 1109 |
| 282 | Ga0453683_0005220 | 3300044673 | Bacteria | 9094 |
| 283 | Ga0453683_0298270 | 3300044673 | Bacteria | 1031 |
| 284 | Ga0466966_0016544 | 3300044684 | Bacteria | 4870 |
| 285 | Ga0453684_0038469 | 3300044712 | Bacteria | 6539 |
| 286 | Ga0453684_0225438 | 3300044712 | Bacteria | 2167 |
| 287 | Ga0453684_0525720 | 3300044712 | Bacteria | 1306 |
| 288 | Ga0453684_0724456 | 3300044712 | Bacteria | 1079 |
| 289 | Ga0451576_0003451 | 3300045051 | Bacteria | 21678 |
| 290 | Ga0451576_0148677 | 3300045051 | Bacteria | 2443 |
| 291 | Ga0451576_0220122 | 3300045051 | Bacteria | 1982 |
| 292 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 293 | Ga0495650_0031730 | 3300046471 | Bacteria | 2373 |
| 294 | Ga0495650_0077358 | 3300046471 | Bacteria | 1291 |
| 295 | Ga0495605_0151911 | 3300046474 | Bacteria | 1033 |
| 296 | Ga0495585_0000065 | 3300046492 | Bacteria | 108945 |
| 297 | Ga0495596_0048556 | 3300046500 | Bacteria | 1664 |
| 298 | Ga0495583_0024400 | 3300046506 | Bacteria | 3039 |
| 299 | Ga0495606_0000264 | 3300046507 | Bacteria | 92733 |
| 300 | Ga0495606_0007322 | 3300046507 | Bacteria | 9927 |
| 301 | Ga0495606_0067810 | 3300046507 | Bacteria | 2258 |
| 302 | Ga0495606_0110208 | 3300046507 | Viruses | 1662 |
| 303 | Ga0495610_0000889 | 3300046512 | Bacteria | 27794 |
| 304 | Ga0495610_0001152 | 3300046512 | Bacteria | 24038 |
| 305 | Ga0495610_0001292 | 3300046512 | Bacteria | 22302 |
| 306 | Ga0495616_0000999 | 3300046513 | Bacteria | 20246 |
| 307 | Ga0495616_0007744 | 3300046513 | Bacteria | 6416 |
| 308 | Ga0495631_0002396 | 3300046518 | Bacteria | 10595 |
| 309 | Ga0495637_0047176 | 3300046520 | Bacteria | 1820 |
| 310 | Ga0495648_0009331 | 3300046524 | Bacteria | 7621 |
| 311 | Ga0495648_0019949 | 3300046524 | Bacteria | 4691 |
| 312 | Ga0495648_0024152 | 3300046524 | Viruses | 4149 |
| 313 | Ga0495663_0244647 | 3300046525 | Bacteria | 635 |
| 314 | Ga0495652_0177216 | 3300046529 | Bacteria | 1640 |
| 315 | Ga0495609_0003263 | 3300046538 | Bacteria | 9376 |
| 316 | Ga0495609_0020253 | 3300046538 | Bacteria | 3074 |
| 317 | Ga0495633_0000015 | 3300046558 | Bacteria | 254484 |
| 318 | Ga0495633_0060574 | 3300046558 | Bacteria | 1773 |
| 319 | Ga0495668_0000041 | 3300046616 | Bacteria | 229462 |
| 320 | Ga0495668_0217381 | 3300046616 | Bacteria | 1046 |
| 321 | Ga0495625_0000211 | 3300046660 | Bacteria | 92222 |
| 322 | Ga0495625_0001551 | 3300046660 | Bacteria | 27391 |
| 323 | Ga0495625_0009144 | 3300046660 | Bacteria | 8337 |
| 324 | Ga0495625_0015341 | 3300046660 | Bacteria | 6070 |
| 325 | Ga0495625_0048697 | 3300046660 | Bacteria | 3050 |
| 326 | Ga0495625_0222932 | 3300046660 | Bacteria | 1234 |
| 327 | Ga0495661_0001542 | 3300046665 | Bacteria | 19060 |
| 328 | Ga0495661_0020819 | 3300046665 | Bacteria | 4277 |
| 329 | Ga0495658_0110802 | 3300046683 | Bacteria | 1650 |
| 330 | Ga0495671_0165984 | 3300046692 | Bacteria | 1074 |
| 331 | Ga0495649_0000090 | 3300046694 | Bacteria | 78509 |
| 332 | Ga0495660_0046107 | 3300046810 | Bacteria | 2391 |
| 333 | Ga0495683_0064293 | 3300047323 | Bacteria | 1812 |
| 334 | Ga0495687_005319 | 3300047443 | Bacteria | 8254 |
| 335 | Ga0495687_032146 | 3300047443 | Bacteria | 2399 |
| 336 | Ga0495681_0055983 | 3300047470 | Bacteria | 1837 |
| 337 | Ga0495686_0000237 | 3300047472 | Bacteria | 100373 |
| 338 | Ga0495686_0043223 | 3300047472 | Bacteria | 2859 |
| 339 | Ga0495686_0078396 | 3300047472 | Bacteria | 2022 |
| 340 | Ga0495686_0099284 | 3300047472 | Bacteria | 1757 |
| 341 | Ga0495686_0250672 | 3300047472 | Bacteria | 995 |
| 342 | Ga0496115_0046089 | 3300048918 | Bacteria | 3483 |
| 343 | Ga0496122_0007821 | 3300048925 | Bacteria | 11746 |
| 344 | Ga0496123_0022423 | 3300048926 | Bacteria | 4867 |
| 345 | Ga0495678_027019 | 3300049459 | Bacteria | 2440 |
| 346 | Ga0495682_0027561 | 3300049460 | Bacteria | 2107 |
| 347 | Ga0501034_0010085 | 3300049571 | Bacteria | 9858 |
| 348 | Ga0501198_013362 | 3300049649 | Bacteria | 1242 |
| 349 | Ga0501249_057815 | 3300049679 | Bacteria | 896 |
| 350 | nmdc:mga0k408_1133_c2 | 3300050493 | Bacteria | 11255 |
| 351 | nmdc:mga0k408_12383_c1 | 3300050493 | Bacteria | 4663 |
| 352 | Ga0500635_0000344 | 3300053080 | Bacteria | 15391 |
| 353 | Ga0500608_006397 | 3300053122 | Bacteria | 4791 |
| 354 | Ga0500608_116695 | 3300053122 | Bacteria | 1216 |
| 355 | Ga0500614_003073 | 3300053123 | Bacteria | 3627 |
| 356 | Ga0500618_000050 | 3300053125 | Bacteria | 105238 |
| 357 | Ga0500561_0027768 | 3300053137 | Bacteria | 1399 |
| 358 | Ga0500616_0056997 | 3300053153 | Viruses | 2038 |
| 359 | Ga0500624_001985 | 3300053157 | Viruses | 2901 |
| 360 | Ga0500634_0175399 | 3300053161 | Bacteria | 971 |
| 361 | 2586208990 | 2585427687 | Bacteria | 5544917 |
| 362 | 2599479279 | 2599185184 | Bacteria | 6430550 |
| 363 | 2738851987 | 2738541302 | Bacteria | 5944758 |
| 364 | 2739590867 | 2739367651 | Bacteria | 6359826 |
| 365 | 2739616976 | 2739367656 | Bacteria | 5152243 |
| 366 | 2739647279 | 2739367663 | Bacteria | 5040914 |
| 367 | 2819546531 | 2818991437 | Bacteria | 5805520 |
| 368 | 2842725226 | 2842722452 | Bacteria | 6263924 |
| 369 | 2842912501 | 2842909656 | Bacteria | 6185908 |
| 370 | 2849286889 | 2849281842 | Bacteria | 6065644 |
| 371 | 2857629704 | 2857627736 | Bacteria | 5625397 |
| 372 | 2896346713 | 2896344016 | Bacteria | 3811746 |
| 373 | 2904446690 | 2904445276 | Bacteria | 5310396 |
| 374 | 2919442872 | 2919437846 | Bacteria | 6199444 |
| 375 | 2928082410 | 2928078545 | Bacteria | 6534839 |
| 376 | 2928149006 | 2928147474 | Bacteria | 6512076 |
| 377 | 2932087536 | 2932082852 | Bacteria | 6563563 |
| 378 | 2946002148 | 2945997725 | Bacteria | 6404843 |
| 379 | 2954019048 | 2954016120 | Bacteria | 6446024 |
| 380 | 2977235926 | 2977232053 | Bacteria | 5485925 |
| 381 | JGI24740J21852_10015374 | |||
| 382 | JGI24736J21556_1002859 | |||
| 383 | JGI24736J21556_1010082 | |||
| 384 | JGI24737J22298_10002035 | |||
| 385 | JGI24737J22298_10025508 | |||
| 386 | JGI24735J21928_10000009 | |||
| 387 | JGI24735J21928_10004322 | |||
| 388 | JGI25162J39368_1000047 | |||
| 389 | JGI25162J39368_1000629 | |||
| 390 | JGI25164J39214_1001512 | |||
| 391 | JGI25150J39212_1000001 | |||
| 392 | JGI25151J46595_10000001 | |||
| 393 | JGI25165J46597_1001516 | |||
| 394 | JGI25153J46596_10000001 | |||
| 395 | rootH1_10016431 | |||
| 396 | rootH1_10133809 | |||
| 397 | rootH2_10110333 | |||
| 398 | rootH2_10236642 | |||
| 399 | rootL2_10378943 | |||
| 400 | rootH1_10013272 | |||
| 401 | rootH1_10013301 | |||
| 402 | Ga0055536_1000001 | |||
| 403 | Ga0055530_10005264 | |||
| 404 | Ga0058862_12601524 | |||
| 405 | Ga0065714_10064604 | |||
| 406 | Ga0070658_10000435 | |||
| 407 | Ga0070658_10130885 | |||
| 408 | Ga0070676_10000428 | |||
| 409 | Ga0070683_100077225 | |||
| 410 | Ga0068869_100366706 | |||
| 411 | Ga0070680_100069028 | |||
| 412 | Ga0070680_100277248 | |||
| 413 | Ga0070682_100151137 | |||
| 414 | Ga0070660_100091014 | |||
| 415 | Ga0070661_100989185 | |||
| 416 | Ga0070673_100002752 | |||
| 417 | Ga0070659_100010674 | |||
| 418 | Ga0070663_100013905 | |||
| 419 | Ga0070662_100002133 | |||
| 420 | Ga0070662_100780028 | |||
| 421 | Ga0070681_10088820 | |||
| 422 | Ga0070681_10123834 | |||
| 423 | Ga0070681_10455385 | |||
| 424 | Ga0068867_100170886 | |||
| 425 | Ga0070679_100031962 | |||
| 426 | Ga0070684_100501809 | |||
| 427 | Ga0068853_100018769 | |||
| 428 | Ga0068853_100030162 | |||
| 429 | Ga0068853_100040282 | |||
| 430 | Ga0068853_100049163 | |||
| 431 | Ga0070665_100000147 | |||
| 432 | Ga0068855_100045273 | |||
| 433 | Ga0068855_100056817 | |||
| 434 | Ga0068855_100121022 | |||
| 435 | Ga0068855_100262331 | |||
| 436 | Ga0068855_100311418 | |||
| 437 | Ga0068857_100200244 | |||
| 438 | Ga0068854_100068659 | |||
| 439 | Ga0068856_100001297 | |||
| 440 | Ga0068856_100012281 | |||
| 441 | Ga0068852_100000913 | |||
| 442 | Ga0068852_100046465 | |||
| 443 | Ga0068852_100117472 | |||
| 444 | Ga0068852_100267316 | |||
| 445 | Ga0068852_100426948 | |||
| 446 | Ga0068852_100891740 | |||
| 447 | Ga0068851_10489702 | |||
| 448 | Ga0068870_10031540 | |||
| 449 | Ga0075366_10000167 | |||
| 450 | Ga0075366_10386053 | |||
| 451 | Ga0097621_100000551 | |||
| 452 | Ga0068871_100000072 | |||
| 453 | Ga0068865_100000309 | |||
| 454 | Ga0105244_10032026 | |||
| 455 | Ga0105244_10245524 | |||
| 456 | Ga0105240_10002371 | |||
| 457 | Ga0105240_10006635 | |||
| 458 | Ga0105240_10051777 | |||
| 459 | Ga0105240_10140980 | |||
| 460 | Ga0105240_10183135 | |||
| 461 | Ga0105240_10310093 | |||
| 462 | Ga0105245_10033730 | |||
| 463 | Ga0105243_10056273 | |||
| 464 | Ga0105241_10000781 | |||
| 465 | Ga0105241_10009308 | |||
| 466 | Ga0105241_10048513 | |||
| 467 | Ga0105241_10247125 | |||
| 468 | Ga0105241_10287944 | |||
| 469 | Ga0105241_10410294 | |||
| 470 | Ga0105242_10002511 | |||
| 471 | Ga0105237_10000254 | |||
| 472 | Ga0105237_10008947 | |||
| 473 | Ga0105237_10010582 | |||
| 474 | Ga0105237_10025020 | |||
| 475 | Ga0105237_10154547 | |||
| 476 | Ga0105237_10824996 | |||
| 477 | Ga0105238_10006406 | |||
| 478 | Ga0105238_10143489 | |||
| 479 | Ga0105238_10824879 | |||
| 480 | Ga0105239_10000015 | |||
| 481 | Ga0105239_10000040 | |||
| 482 | Ga0105239_10001808 | |||
| 483 | Ga0105239_10011518 | |||
| 484 | Ga0105239_10031682 | |||
| 485 | Ga0105239_10057870 | |||
| 486 | Ga0105239_10069315 | |||
| 487 | Ga0105239_10288805 | |||
| 488 | Ga0105239_10318104 | |||
| 489 | Ga0105239_10554115 | |||
| 490 | Ga0105246_10111882 | |||
| 491 | Ga0105246_10760359 | |||
| 492 | Ga0157373_10000509 | |||
| 493 | Ga0157373_10016566 | |||
| 494 | Ga0157371_10000276 | |||
| 495 | Ga0157371_10000421 | |||
| 496 | Ga0157371_10001599 | |||
| 497 | Ga0157371_10004145 | |||
| 498 | Ga0157371_10009252 | |||
| 499 | Ga0157370_10002639 | |||
| 500 | Ga0157370_10030626 | |||
| 501 | Ga0157370_10138407 | |||
| 502 | Ga0157370_10237536 | |||
| 503 | Ga0157370_10427128 | |||
| 504 | Ga0157369_10000040 | |||
| 505 | Ga0157369_10001134 | |||
| 506 | Ga0157369_10016243 | |||
| 507 | Ga0157374_10006987 | |||
| 508 | Ga0157374_10013535 | |||
| 509 | Ga0157374_10335139 | |||
| 510 | Ga0157374_10783125 | |||
| 511 | Ga0157378_10007635 | |||
| 512 | Ga0163162_10000163 | |||
| 513 | Ga0163162_10001293 | |||
| 514 | Ga0163162_10015565 | |||
| 515 | Ga0163162_10283535 | |||
| 516 | Ga0163162_10295780 | |||
| 517 | Ga0163162_10358815 | |||
| 518 | Ga0157372_10000099 | |||
| 519 | Ga0157372_10001816 | |||
| 520 | Ga0157372_10006898 | |||
| 521 | Ga0157372_10063132 | |||
| 522 | Ga0157372_10172594 | |||
| 523 | Ga0157372_11464027 | |||
| 524 | Ga0157375_10151111 | |||
| 525 | Ga0157375_10427748 | |||
| 526 | Ga0157380_10000026 | |||
| 527 | Ga0182008_10000131 | |||
| 528 | Ga0182008_10006954 | |||
| 529 | Ga0182008_10017239 | |||
| 530 | Ga0157377_10010524 | |||
| 531 | Ga0157376_10181102 | |||
| 532 | Ga0182006_1000302 | |||
| 533 | Ga0182006_1000644 | |||
| 534 | Ga0182006_1001419 | |||
| 535 | Ga0182006_1002630 | |||
| 536 | Ga0182007_10000003 | |||
| 537 | Ga0182007_10014088 | |||
| 538 | Ga0183373_1001 | |||
| 539 | Ga0163161_10000284 | |||
| 540 | Ga0163161_10001539 | |||
| 541 | Ga0163161_10003354 | |||
| 542 | Ga0163161_10011746 | |||
| 543 | Ga0163161_10020222 | |||
| 544 | Ga0163161_10069331 | |||
| 545 | Ga0213872_10004103 | |||
| 546 | Ga0207427_100323 | |||
| 547 | Ga0209437_100089 | |||
| 548 | Ga0209437_100093 | |||
| 549 | Ga0207425_1000002 | |||
| 550 | Ga0209026_1000663 | |||
| 551 | Ga0209026_1004173 | |||
| 552 | Ga0209129_1000002 | |||
| 553 | Ga0209129_1002040 | |||
| 554 | Ga0209233_1000089 | |||
| 555 | Ga0209233_1002681 | |||
| 556 | Ga0209455_1002014 | |||
| 557 | Ga0209676_1000008 | |||
| 558 | Ga0209025_1000004 | |||
| 559 | Ga0209758_1000006 | |||
| 560 | Ga0209050_1000055 | |||
| 561 | Ga0207656_10000062 | |||
| 562 | Ga0207655_1025137 | |||
| 563 | Ga0207647_10000223 | |||
| 564 | Ga0207647_10000258 | |||
| 565 | Ga0207647_10079288 | |||
| 566 | Ga0207645_10001313 | |||
| 567 | Ga0207643_10041820 | |||
| 568 | Ga0207705_10000043 | |||
| 569 | Ga0207654_10005994 | |||
| 570 | Ga0207654_10082208 | |||
| 571 | Ga0207654_10670895 | |||
| 572 | Ga0207707_10100045 | |||
| 573 | Ga0207707_10264579 | |||
| 574 | Ga0207707_10396113 | |||
| 575 | Ga0207695_10000053 | |||
| 576 | Ga0207695_10005297 | |||
| 577 | Ga0207695_10007657 | |||
| 578 | Ga0207695_10095756 | |||
| 579 | Ga0207695_10158081 | |||
| 580 | Ga0207695_10430518 | |||
| 581 | Ga0207695_10603445 | |||
| 582 | Ga0207671_10001672 | |||
| 583 | Ga0207671_10008435 | |||
| 584 | Ga0207671_10010120 | |||
| 585 | Ga0207671_10016508 | |||
| 586 | Ga0207671_10371491 | |||
| 587 | Ga0207660_10059222 | |||
| 588 | Ga0207657_10100159 | |||
| 589 | Ga0207652_10022178 | |||
| 590 | Ga0207652_10034060 | |||
| 591 | Ga0207694_10075636 | |||
| 592 | Ga0207687_10139282 | |||
| 593 | Ga0207690_10006810 | |||
| 594 | Ga0207706_10001583 | |||
| 595 | Ga0207709_10113785 | |||
| 596 | Ga0207704_10000220 | |||
| 597 | Ga0207689_10290802 | |||
| 598 | Ga0207667_10003729 | |||
| 599 | Ga0207667_10019284 | |||
| 600 | Ga0207667_10021986 | |||
| 601 | Ga0207667_10047113 | |||
| 602 | Ga0207667_10199030 | |||
| 603 | Ga0207651_10111637 | |||
| 604 | Ga0207640_10078207 | |||
| 605 | Ga0207639_10009010 | |||
| 606 | Ga0207639_10225352 | |||
| 607 | Ga0207639_10670358 | |||
| 608 | Ga0207678_10007480 | |||
| 609 | Ga0207702_10001182 | |||
| 610 | Ga0207702_10042934 | |||
| 611 | Ga0207702_10180135 | |||
| 612 | Ga0207648_10209659 | |||
| 613 | Ga0207674_10472985 | |||
| 614 | Ga0207674_10744139 | |||
| 615 | Ga0207698_10000512 | |||
| 616 | Ga0207698_10167670 | |||
| 617 | Ga0207698_10611662 | |||
| 618 | Ga0207698_11038884 | |||
| 619 | Ga0268266_10000030 | |||
| 620 | Ga0307517_10010112 | |||
| 621 | Ga0307515_10000172 | |||
| 622 | Ga0265338_10234167 | |||
| 623 | Ga0316177_1116163 | |||
| 624 | Ga0316176_1033433 | |||
| 625 | Ga0316183_1095896 | |||
| 626 | Ga0316181_1136427 | |||
| 627 | Ga0307509_10119241 | |||
| 628 | Ga0316578_10004762 | |||
| 629 | Ga0307516_10240779 | |||
| 630 | Ga0316577_10134449 | |||
| 631 | Ga0307407_10000010 | |||
| 632 | Ga0307409_100003194 | |||
| 633 | Ga0307416_100000014 | |||
| 634 | Ga0307414_10004174 | |||
| 635 | Ga0307414_10011293 | |||
| 636 | Ga0307414_10141427 | |||
| 637 | Ga0307414_10153403 | |||
| 638 | Ga0307411_10005034 | |||
| 639 | Ga0307411_10133213 | |||
| 640 | Ga0316585_10022194 | |||
| 641 | Ga0307507_10000883 | |||
| 642 | Ga0307510_10034601 | |||
| 643 | Ga0316582_0015211 | |||
| 644 | Ga0316582_0144542 | |||
| 645 | Ga0316584_0042221 | |||
| 646 | Ga0395899_0001786 | |||
| 647 | Ga0395900_0000115 | |||
| 648 | Ga0395900_0055382 | |||
| 649 | Ga0395898_0057584 | |||
| 650 | Ga0395905_0000045 | |||
| 651 | Ga0395905_0000971 | |||
| 652 | Ga0316581_0210261 | |||
| 653 | Ga0395901_0000706 | |||
| 654 | Ga0395901_0003779 | |||
| 655 | Ga0400490_60660 | |||
| 656 | Ga0400483_165199 | |||
| 657 | Ga0436365_0215343 | |||
| 658 | Ga0436361_1219998 | |||
| 659 | Ga0439448_0014754 | |||
| 660 | Ga0451577_0336510 | |||
| 661 | Ga0451577_0495631 | |||
| 662 | Ga0453683_0005220 | |||
| 663 | Ga0453683_0298270 | |||
| 664 | Ga0466966_0016544 | |||
| 665 | Ga0453684_0038469 | |||
| 666 | Ga0453684_0225438 | |||
| 667 | Ga0453684_0525720 | |||
| 668 | Ga0453684_0724456 | |||
| 669 | Ga0451576_0003451 | |||
| 670 | Ga0451576_0148677 | |||
| 671 | Ga0451576_0220122 | |||
| 672 | Ga0495650_0000023 | |||
| 673 | Ga0495650_0031730 | |||
| 674 | Ga0495650_0077358 | |||
| 675 | Ga0495605_0151911 | |||
| 676 | Ga0495585_0000065 | |||
| 677 | Ga0495596_0048556 | |||
| 678 | Ga0495583_0024400 | |||
| 679 | Ga0495606_0000264 | |||
| 680 | Ga0495606_0007322 | |||
| 681 | Ga0495606_0067810 | |||
| 682 | Ga0495606_0110208 | |||
| 683 | Ga0495610_0000889 | |||
| 684 | Ga0495610_0001152 | |||
| 685 | Ga0495610_0001292 | |||
| 686 | Ga0495616_0000999 | |||
| 687 | Ga0495616_0007744 | |||
| 688 | Ga0495631_0002396 | |||
| 689 | Ga0495637_0047176 | |||
| 690 | Ga0495648_0009331 | |||
| 691 | Ga0495648_0019949 | |||
| 692 | Ga0495648_0024152 | |||
| 693 | Ga0495663_0244647 | |||
| 694 | Ga0495652_0177216 | |||
| 695 | Ga0495609_0003263 | |||
| 696 | Ga0495609_0020253 | |||
| 697 | Ga0495633_0000015 | |||
| 698 | Ga0495633_0060574 | |||
| 699 | Ga0495668_0000041 | |||
| 700 | Ga0495668_0217381 | |||
| 701 | Ga0495625_0000211 | |||
| 702 | Ga0495625_0001551 | |||
| 703 | Ga0495625_0009144 | |||
| 704 | Ga0495625_0015341 | |||
| 705 | Ga0495625_0048697 | |||
| 706 | Ga0495625_0222932 | |||
| 707 | Ga0495661_0001542 | |||
| 708 | Ga0495661_0020819 | |||
| 709 | Ga0495658_0110802 | |||
| 710 | Ga0495671_0165984 | |||
| 711 | Ga0495649_0000090 | |||
| 712 | Ga0495660_0046107 | |||
| 713 | Ga0495683_0064293 | |||
| 714 | Ga0495687_005319 | |||
| 715 | Ga0495687_032146 | |||
| 716 | Ga0495681_0055983 | |||
| 717 | Ga0495686_0000237 | |||
| 718 | Ga0495686_0043223 | |||
| 719 | Ga0495686_0078396 | |||
| 720 | Ga0495686_0099284 | |||
| 721 | Ga0495686_0250672 | |||
| 722 | Ga0496115_0046089 | |||
| 723 | Ga0496122_0007821 | |||
| 724 | Ga0496123_0022423 | |||
| 725 | Ga0495678_027019 | |||
| 726 | Ga0495682_0027561 | |||
| 727 | Ga0501034_0010085 | |||
| 728 | Ga0501198_013362 | |||
| 729 | Ga0501249_057815 | |||
| 730 | nmdc:mga0k408_1133_c2 | |||
| 731 | nmdc:mga0k408_12383_c1 | |||
| 732 | Ga0500635_0000344 | |||
| 733 | Ga0500608_006397 | |||
| 734 | Ga0500608_116695 | |||
| 735 | Ga0500614_003073 | |||
| 736 | Ga0500618_000050 | |||
| 737 | Ga0500561_0027768 | |||
| 738 | Ga0500616_0056997 | |||
| 739 | Ga0500624_001985 | |||
| 740 | Ga0500634_0175399 | |||
| 741 | 2586208990 | |||
| 742 | 2599479279 | |||
| 743 | 2738851987 | |||
| 744 | 2739590867 | |||
| 745 | 2739616976 | |||
| 746 | 2739647279 | |||
| 747 | 2819546531 | |||
| 748 | 2842725226 | |||
| 749 | 2842912501 | |||
| 750 | 2849286889 | |||
| 751 | 2857629704 | |||
| 752 | 2896346713 | |||
| 753 | 2904446690 | |||
| 754 | 2919442872 | |||
| 755 | 2928082410 | |||
| 756 | 2928149006 | |||
| 757 | 2932087536 | |||
| 758 | 2946002148 | |||
| 759 | 2954019048 | |||
| 760 | 2977235926 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qq0-assembly1.cif.gz_A-2 | thymidine kinase from thermotoga maritima in complex with thymidine + appnhp | 0.9621 | 16 | 189 |
| 1xbt-assembly2.cif.gz_H | crystal structure of human thymidine kinase 1 | 0.9619 | 16 | 188 |
| 2wvj-assembly2.cif.gz_G | mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine | 0.9593 | 16 | 188 |
| 1w4r-assembly2.cif.gz_E | structure of a type ii thymidine kinase with bound dttp | 0.9585 | 16 | 188 |
| 1w4r-assembly2.cif.gz_H | structure of a type ii thymidine kinase with bound dttp | 0.9571 | 16 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWD9_1_141_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9814 | 16 | 148 | 3.40.50.300 |
| 2qpoC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9614 | 16 | 147 | 3.40.50.300 |
| 2wvjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9593 | 16 | 148 | 3.40.50.300 |
| 2wvjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9436 | 16 | 148 | 3.40.50.300 |
| af_P27158_18_121_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9391 | 16 | 119 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V6JSZ1-F1-model_v4 | deleted | 1 | 22 | 108 |
|
| AF-A0A3A4R914-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9947 | 16 | 136 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-A0A7C2B3U8-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9944 | 14 | 155 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-A0A2M7NCF7-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9939 | 48 | 189 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |
| AF-A0A558BN94-F1-model_v4 | Thymidine kinase (EC 2.7.1.21) | 0.9933 | 25 | 188 |
GO:0004797
GO:0005524 GO:0005829 GO:0046104 GO:0071897 |