F428527
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 380 | 257 | 368 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300002737|JGI25162J39368_1000470|JGI25162J39368_100047014 |
| Length | 224 |
| Sequence | MLLMRVPEGTDMSQTHAKLEKNIGLMAILVAVAVSFGGLAEIVPLMFQAETIKPLPGIKPYPALELAGRDVYVREGCYNCHSQMVRTLRFETERYGHYSLAGESVYDHPFQWGSKRTGPDLARVGLRGYSDDWHRAHLHNPRDVVPESNMPAYPWLADNQLDGAEVAQHMRALKRIGDPYSEADIEGAAKAVEGKTELDAVIAYLQGLGTHVSQTDLQAAEGVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 4 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 5 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 6 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 7 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 8 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 9 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 10 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 11 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 12 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 16 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 17 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 93 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 156 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 172 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 176 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 177 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 180 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 181 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 182 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 183 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 184 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 185 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 186 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 242 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 247 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 254 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 256 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.84 |
| Metatranscriptomes | 0 |
| Isolates | 3.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.26 |
| Nodule | 0 |
| Rhizoplane | 3.95 |
| Rhizosphere | 79.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2377386 | 2162886007 | Bacteria | 918 |
| 2 | JGI24739J22299_10014635 | 3300001989 | Bacteria | 2851 |
| 3 | JGI24735J21928_10000458 | 3300002067 | Bacteria | 14366 |
| 4 | JGI25162J39368_1000470 | 3300002737 | Bacteria | 31129 |
| 5 | JGI25162J39368_1001981 | 3300002737 | Bacteria | 9175 |
| 6 | JGI25157J39369_1000585 | 3300002741 | Bacteria | 21521 |
| 7 | JGI25157J39369_1001417 | 3300002741 | Bacteria | 9136 |
| 8 | JGI25163J39215_1000551 | 3300002771 | Bacteria | 10874 |
| 9 | JGI25164J39214_1000075 | 3300002772 | Bacteria | 97713 |
| 10 | JGI25151J46595_10043215 | 3300003187 | Bacteria | 1615 |
| 11 | JGI25165J46597_1000178 | 3300003214 | Bacteria | 97713 |
| 12 | Ga0055538_1003074 | 3300003751 | Bacteria | 2203 |
| 13 | Ga0055533_1003461 | 3300003756 | Bacteria | 3162 |
| 14 | Ga0055535_1000144 | 3300003761 | Bacteria | 75043 |
| 15 | Ga0055542_1000213 | 3300003762 | Bacteria | 70811 |
| 16 | Ga0055542_1000594 | 3300003762 | Bacteria | 31129 |
| 17 | Ga0055529_1000153 | 3300003763 | Bacteria | 97713 |
| 18 | Ga0055526_1012727 | 3300003771 | Bacteria | 3638 |
| 19 | Ga0055536_1008655 | 3300003781 | Bacteria | 4333 |
| 20 | Ga0065704_10071131 | 3300005289 | Bacteria | 12938 |
| 21 | Ga0065704_10099761 | 3300005289 | Bacteria | 2298 |
| 22 | Ga0065715_10045182 | 3300005293 | Bacteria | 1564 |
| 23 | Ga0070658_10085761 | 3300005327 | Bacteria | 2590 |
| 24 | Ga0070676_10006852 | 3300005328 | Bacteria | 6102 |
| 25 | Ga0070670_100094968 | 3300005331 | Bacteria | 2564 |
| 26 | Ga0070666_10020164 | 3300005335 | Bacteria | 4308 |
| 27 | Ga0070666_10031365 | 3300005335 | Bacteria | 3508 |
| 28 | Ga0070666_10116460 | 3300005335 | Bacteria | 1851 |
| 29 | Ga0068868_100198851 | 3300005338 | Bacteria | 1670 |
| 30 | Ga0068868_100291875 | 3300005338 | Bacteria | 1383 |
| 31 | Ga0070689_100016568 | 3300005340 | Bacteria | 5395 |
| 32 | Ga0070661_100378938 | 3300005344 | Bacteria | 1115 |
| 33 | Ga0070661_100470019 | 3300005344 | Bacteria | 1003 |
| 34 | Ga0070668_100118478 | 3300005347 | Bacteria | 2114 |
| 35 | Ga0070668_100405678 | 3300005347 | Bacteria | 1164 |
| 36 | Ga0070675_100096928 | 3300005354 | Bacteria | 2479 |
| 37 | Ga0070671_100160002 | 3300005355 | Bacteria | 1903 |
| 38 | Ga0070674_100159014 | 3300005356 | Bacteria | 1712 |
| 39 | Ga0070674_100718263 | 3300005356 | Bacteria | 856 |
| 40 | Ga0070667_100010104 | 3300005367 | Bacteria | 7808 |
| 41 | Ga0070667_100087529 | 3300005367 | Bacteria | 2673 |
| 42 | Ga0070667_100270111 | 3300005367 | Bacteria | 1524 |
| 43 | Ga0070714_100018328 | 3300005435 | Bacteria | 5685 |
| 44 | Ga0070713_100000918 | 3300005436 | Bacteria | 18806 |
| 45 | Ga0070711_100080773 | 3300005439 | Bacteria | 2316 |
| 46 | Ga0070711_100084602 | 3300005439 | Bacteria | 2269 |
| 47 | Ga0070663_100015214 | 3300005455 | Bacteria | 4959 |
| 48 | Ga0070663_100233814 | 3300005455 | Bacteria | 1448 |
| 49 | Ga0070662_100040689 | 3300005457 | Bacteria | 3311 |
| 50 | Ga0070662_100680817 | 3300005457 | Bacteria | 869 |
| 51 | Ga0068867_100100529 | 3300005459 | Bacteria | 2208 |
| 52 | Ga0068867_100229226 | 3300005459 | Bacteria | 1501 |
| 53 | Ga0068867_100683637 | 3300005459 | Bacteria | 904 |
| 54 | Ga0070685_10070461 | 3300005466 | Bacteria | 2070 |
| 55 | Ga0068853_100324667 | 3300005539 | Bacteria | 1427 |
| 56 | Ga0070672_100256636 | 3300005543 | Bacteria | 1473 |
| 57 | Ga0070693_100005200 | 3300005547 | Bacteria | 6228 |
| 58 | Ga0070665_100000469 | 3300005548 | Bacteria | 58193 |
| 59 | Ga0070665_100176040 | 3300005548 | Bacteria | 2140 |
| 60 | Ga0070665_100702055 | 3300005548 | Bacteria | 1025 |
| 61 | Ga0068855_100356046 | 3300005563 | Bacteria | 1611 |
| 62 | Ga0070664_100106619 | 3300005564 | Bacteria | 2441 |
| 63 | Ga0068856_100989395 | 3300005614 | Bacteria | 859 |
| 64 | Ga0068856_101556766 | 3300005614 | Bacteria | 674 |
| 65 | Ga0068852_100023333 | 3300005616 | Bacteria | 4978 |
| 66 | Ga0068852_100253984 | 3300005616 | Bacteria | 1685 |
| 67 | Ga0068859_100313294 | 3300005617 | Bacteria | 1663 |
| 68 | Ga0068864_100399561 | 3300005618 | Bacteria | 1306 |
| 69 | Ga0068864_100802452 | 3300005618 | Bacteria | 925 |
| 70 | Ga0068861_100042796 | 3300005719 | Bacteria | 3396 |
| 71 | Ga0068861_100320377 | 3300005719 | Bacteria | 1350 |
| 72 | Ga0068851_10011672 | 3300005834 | Bacteria | 4124 |
| 73 | Ga0068851_10019177 | 3300005834 | Bacteria | 3303 |
| 74 | Ga0068863_100838011 | 3300005841 | Bacteria | 918 |
| 75 | Ga0068858_100000797 | 3300005842 | Bacteria | 32972 |
| 76 | Ga0068858_100367256 | 3300005842 | Bacteria | 1380 |
| 77 | Ga0068860_101087774 | 3300005843 | Bacteria | 819 |
| 78 | Ga0068862_100151167 | 3300005844 | Bacteria | 2067 |
| 79 | Ga0075364_10000769 | 3300006051 | Bacteria | 16847 |
| 80 | Ga0070712_100150602 | 3300006175 | Bacteria | 1786 |
| 81 | Ga0097621_100150784 | 3300006237 | Bacteria | 1994 |
| 82 | Ga0097621_100155830 | 3300006237 | Bacteria | 1960 |
| 83 | Ga0068871_100008412 | 3300006358 | Bacteria | 7421 |
| 84 | Ga0068871_100095942 | 3300006358 | Bacteria | 2477 |
| 85 | Ga0075428_100588341 | 3300006844 | Bacteria | 1189 |
| 86 | Ga0075430_100243043 | 3300006846 | Bacteria | 1492 |
| 87 | Ga0075429_100235487 | 3300006880 | Bacteria | 1604 |
| 88 | Ga0068865_100001018 | 3300006881 | Bacteria | 16121 |
| 89 | Ga0068865_100044710 | 3300006881 | Bacteria | 3032 |
| 90 | Ga0068865_100154423 | 3300006881 | Bacteria | 1744 |
| 91 | Ga0097620_100313284 | 3300006931 | Bacteria | 1663 |
| 92 | Ga0105250_10165904 | 3300009092 | Bacteria | 923 |
| 93 | Ga0105240_10018953 | 3300009093 | Bacteria | 9214 |
| 94 | Ga0114129_10702534 | 3300009147 | Bacteria | 1299 |
| 95 | Ga0105242_10050594 | 3300009176 | Bacteria | 3383 |
| 96 | Ga0105242_10429185 | 3300009176 | Bacteria | 1240 |
| 97 | Ga0105237_10327528 | 3300009545 | Bacteria | 1536 |
| 98 | Ga0105238_10038862 | 3300009551 | Bacteria | 4832 |
| 99 | Ga0105238_10043722 | 3300009551 | Bacteria | 4532 |
| 100 | Ga0105238_10062658 | 3300009551 | Bacteria | 3719 |
| 101 | Ga0105239_10013435 | 3300010375 | Bacteria | 9097 |
| 102 | Ga0105239_10295740 | 3300010375 | Bacteria | 1823 |
| 103 | Ga0105239_10430420 | 3300010375 | Bacteria | 1496 |
| 104 | Ga0105239_10846974 | 3300010375 | Bacteria | 1048 |
| 105 | Ga0105246_10108046 | 3300011119 | Bacteria | 2039 |
| 106 | Ga0157370_10314476 | 3300013104 | Bacteria | 1445 |
| 107 | Ga0157369_10083411 | 3300013105 | Bacteria | 3418 |
| 108 | Ga0157369_10414176 | 3300013105 | Bacteria | 1397 |
| 109 | Ga0157369_10515516 | 3300013105 | Bacteria | 1237 |
| 110 | Ga0157374_10091172 | 3300013296 | Bacteria | 2906 |
| 111 | Ga0157378_10569865 | 3300013297 | Bacteria | 1140 |
| 112 | Ga0163162_10104785 | 3300013306 | Bacteria | 2923 |
| 113 | Ga0157372_10004902 | 3300013307 | Bacteria | 14227 |
| 114 | Ga0157372_10216759 | 3300013307 | Bacteria | 2218 |
| 115 | Ga0157372_10284370 | 3300013307 | Bacteria | 1923 |
| 116 | Ga0157375_10271814 | 3300013308 | Bacteria | 1857 |
| 117 | Ga0157380_10342708 | 3300014326 | Bacteria | 1395 |
| 118 | Ga0157380_10371318 | 3300014326 | Bacteria | 1346 |
| 119 | Ga0157379_10353455 | 3300014968 | Bacteria | 1346 |
| 120 | Ga0157379_11299647 | 3300014968 | Bacteria | 702 |
| 121 | Ga0157376_10062349 | 3300014969 | Bacteria | 3137 |
| 122 | Ga0157376_10079140 | 3300014969 | Bacteria | 2817 |
| 123 | Ga0157376_10158092 | 3300014969 | Bacteria | 2052 |
| 124 | Ga0157376_10342276 | 3300014969 | Bacteria | 1429 |
| 125 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 126 | Ga0209760_100219 | 3300025207 | Bacteria | 25038 |
| 127 | Ga0209784_100104 | 3300025224 | Bacteria | 98272 |
| 128 | Ga0209674_100033 | 3300025226 | Bacteria | 423450 |
| 129 | Ga0209674_101242 | 3300025226 | Bacteria | 7215 |
| 130 | Ga0209672_100759 | 3300025228 | Bacteria | 15556 |
| 131 | Ga0209672_109176 | 3300025228 | Bacteria | 1413 |
| 132 | Ga0207427_100070 | 3300025231 | Bacteria | 160908 |
| 133 | Ga0209437_100059 | 3300025233 | Bacteria | 355048 |
| 134 | Ga0209437_100214 | 3300025233 | Bacteria | 107034 |
| 135 | Ga0209258_100034 | 3300025242 | Bacteria | 437372 |
| 136 | Ga0209258_100858 | 3300025242 | Bacteria | 16181 |
| 137 | Ga0209258_102669 | 3300025242 | Bacteria | 4398 |
| 138 | Ga0209646_1000879 | 3300025246 | Bacteria | 9964 |
| 139 | Ga0209646_1004944 | 3300025246 | Bacteria | 2379 |
| 140 | Ga0209026_1000017 | 3300025250 | Bacteria | 385214 |
| 141 | Ga0209026_1000176 | 3300025250 | Bacteria | 97745 |
| 142 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 143 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 144 | Ga0209759_1000581 | 3300025256 | Bacteria | 35995 |
| 145 | Ga0209759_1006107 | 3300025256 | Bacteria | 4101 |
| 146 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 147 | Ga0209233_1009776 | 3300025261 | Bacteria | 2904 |
| 148 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 149 | Ga0209455_1003352 | 3300025272 | Bacteria | 5722 |
| 150 | Ga0209673_1016419 | 3300025273 | Bacteria | 2770 |
| 151 | Ga0209676_1000063 | 3300025292 | Bacteria | 322025 |
| 152 | Ga0207680_10000780 | 3300025903 | Bacteria | 15064 |
| 153 | Ga0207680_10009306 | 3300025903 | Bacteria | 4868 |
| 154 | Ga0207647_10003302 | 3300025904 | Bacteria | 12119 |
| 155 | Ga0207695_10062111 | 3300025913 | Bacteria | 3859 |
| 156 | Ga0207671_10028449 | 3300025914 | Bacteria | 4176 |
| 157 | Ga0207671_10157421 | 3300025914 | Bacteria | 1758 |
| 158 | Ga0207671_10247821 | 3300025914 | Bacteria | 1400 |
| 159 | Ga0207671_10507584 | 3300025914 | Bacteria | 961 |
| 160 | Ga0207693_10056699 | 3300025915 | Bacteria | 3071 |
| 161 | Ga0207693_10529351 | 3300025915 | Bacteria | 919 |
| 162 | Ga0207663_10119339 | 3300025916 | Bacteria | 1803 |
| 163 | Ga0207662_10291270 | 3300025918 | Bacteria | 1083 |
| 164 | Ga0207649_10020581 | 3300025920 | Bacteria | 3785 |
| 165 | Ga0207649_10038031 | 3300025920 | Bacteria | 2911 |
| 166 | Ga0207649_10144890 | 3300025920 | Bacteria | 1629 |
| 167 | Ga0207681_10458477 | 3300025923 | Bacteria | 1038 |
| 168 | Ga0207694_10001234 | 3300025924 | Bacteria | 22148 |
| 169 | Ga0207694_10020682 | 3300025924 | Bacteria | 4982 |
| 170 | Ga0207694_10182954 | 3300025924 | Bacteria | 1700 |
| 171 | Ga0207650_10026663 | 3300025925 | Bacteria | 4125 |
| 172 | Ga0207700_10001904 | 3300025928 | Bacteria | 11863 |
| 173 | Ga0207664_10062212 | 3300025929 | Bacteria | 2980 |
| 174 | Ga0207644_10058862 | 3300025931 | Bacteria | 2777 |
| 175 | Ga0207644_10283601 | 3300025931 | Bacteria | 1330 |
| 176 | Ga0207644_10315740 | 3300025931 | Bacteria | 1262 |
| 177 | Ga0207706_10031331 | 3300025933 | Bacteria | 4738 |
| 178 | Ga0207706_10751433 | 3300025933 | Bacteria | 831 |
| 179 | Ga0207686_10051966 | 3300025934 | Bacteria | 2555 |
| 180 | Ga0207686_10403661 | 3300025934 | Bacteria | 1042 |
| 181 | Ga0207670_10010231 | 3300025936 | Bacteria | 5395 |
| 182 | Ga0207669_10445216 | 3300025937 | Bacteria | 1025 |
| 183 | Ga0207704_10011862 | 3300025938 | Bacteria | 4308 |
| 184 | Ga0207704_10537852 | 3300025938 | Bacteria | 947 |
| 185 | Ga0207691_10016420 | 3300025940 | Bacteria | 7028 |
| 186 | Ga0207711_10420295 | 3300025941 | Bacteria | 1243 |
| 187 | Ga0207689_10145203 | 3300025942 | Bacteria | 1955 |
| 188 | Ga0207661_10170636 | 3300025944 | Bacteria | 1894 |
| 189 | Ga0207679_10148045 | 3300025945 | Bacteria | 1907 |
| 190 | Ga0207667_10059416 | 3300025949 | Bacteria | 4004 |
| 191 | Ga0207667_10540373 | 3300025949 | Bacteria | 1179 |
| 192 | Ga0207651_10122047 | 3300025960 | Bacteria | 1978 |
| 193 | Ga0207712_10000390 | 3300025961 | Bacteria | 38119 |
| 194 | Ga0207668_10164767 | 3300025972 | Bacteria | 1731 |
| 195 | Ga0207668_10242401 | 3300025972 | Bacteria | 1459 |
| 196 | Ga0207658_10012464 | 3300025986 | Bacteria | 5808 |
| 197 | Ga0207658_10217478 | 3300025986 | Bacteria | 1605 |
| 198 | Ga0207658_10294134 | 3300025986 | Bacteria | 1397 |
| 199 | Ga0207658_10332695 | 3300025986 | Bacteria | 1318 |
| 200 | Ga0207658_10683837 | 3300025986 | Bacteria | 926 |
| 201 | Ga0207658_10785777 | 3300025986 | Bacteria | 864 |
| 202 | Ga0207703_10000536 | 3300026035 | Bacteria | 39195 |
| 203 | Ga0207703_10350992 | 3300026035 | Bacteria | 1358 |
| 204 | Ga0207639_10057822 | 3300026041 | Bacteria | 2980 |
| 205 | Ga0207639_10093611 | 3300026041 | Bacteria | 2410 |
| 206 | Ga0207678_10002378 | 3300026067 | Bacteria | 17075 |
| 207 | Ga0207678_10015234 | 3300026067 | Bacteria | 6765 |
| 208 | Ga0207678_10358885 | 3300026067 | Bacteria | 1257 |
| 209 | Ga0207702_10673317 | 3300026078 | Bacteria | 1018 |
| 210 | Ga0207641_10251184 | 3300026088 | Bacteria | 1652 |
| 211 | Ga0207648_10049354 | 3300026089 | Bacteria | 3682 |
| 212 | Ga0207648_10053647 | 3300026089 | Bacteria | 3523 |
| 213 | Ga0207648_10153246 | 3300026089 | Bacteria | 2034 |
| 214 | Ga0207676_10301986 | 3300026095 | Bacteria | 1462 |
| 215 | Ga0207675_100020520 | 3300026118 | Bacteria | 6159 |
| 216 | Ga0207683_10004840 | 3300026121 | Bacteria | 11594 |
| 217 | Ga0207683_10018561 | 3300026121 | Bacteria | 5936 |
| 218 | Ga0209969_1001749 | 3300027360 | Bacteria | 2995 |
| 219 | Ga0209995_1020127 | 3300027471 | Bacteria | 1103 |
| 220 | Ga0209982_1007562 | 3300027552 | Bacteria | 1588 |
| 221 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 222 | Ga0268264_10058349 | 3300028381 | Bacteria | 3232 |
| 223 | Ga0268264_10293409 | 3300028381 | Bacteria | 1528 |
| 224 | Ga0268264_10340797 | 3300028381 | Bacteria | 1424 |
| 225 | Ga0268264_10971368 | 3300028381 | Bacteria | 855 |
| 226 | Ga0307515_10048284 | 3300028794 | Bacteria | 6440 |
| 227 | Ga0265338_10431864 | 3300028800 | Bacteria | 935 |
| 228 | Ga0314311_1137376 | 3300030733 | Bacteria | 1385 |
| 229 | Ga0307508_10221720 | 3300031616 | Bacteria | 1491 |
| 230 | Ga0316575_10013864 | 3300031665 | Bacteria | 3017 |
| 231 | Ga0316576_10024953 | 3300031727 | Bacteria | 4181 |
| 232 | Ga0316576_10062282 | 3300031727 | Bacteria | 2736 |
| 233 | Ga0307413_10130284 | 3300031824 | Bacteria | 1720 |
| 234 | Ga0307413_10172562 | 3300031824 | Bacteria | 1532 |
| 235 | Ga0307410_10079523 | 3300031852 | Bacteria | 2298 |
| 236 | Ga0307407_10702053 | 3300031903 | Bacteria | 762 |
| 237 | Ga0307412_10212033 | 3300031911 | Bacteria | 1479 |
| 238 | Ga0307412_10754439 | 3300031911 | Bacteria | 840 |
| 239 | Ga0307416_100078567 | 3300032002 | Bacteria | 2777 |
| 240 | Ga0307416_100942341 | 3300032002 | Bacteria | 965 |
| 241 | Ga0307414_10001626 | 3300032004 | Bacteria | 11693 |
| 242 | Ga0307414_10004708 | 3300032004 | Bacteria | 7445 |
| 243 | Ga0307414_10045003 | 3300032004 | Bacteria | 3019 |
| 244 | Ga0307414_10051007 | 3300032004 | Bacteria | 2869 |
| 245 | Ga0307414_10056897 | 3300032004 | Bacteria | 2746 |
| 246 | Ga0307414_10304278 | 3300032004 | Bacteria | 1350 |
| 247 | Ga0307411_10055234 | 3300032005 | Bacteria | 2612 |
| 248 | Ga0373959_0069515 | 3300034820 | Bacteria | 793 |
| 249 | Ga0373955_0170902 | 3300035172 | Bacteria | 1286 |
| 250 | Ga0316574_0009877 | 3300035398 | Bacteria | 5366 |
| 251 | Ga0373933_0401992 | 3300035724 | Bacteria | 893 |
| 252 | Ga0373937_0026049 | 3300036401 | Bacteria | 5283 |
| 253 | Ga0373937_0198291 | 3300036401 | Bacteria | 1887 |
| 254 | Ga0395900_0645189 | 3300037418 | Bacteria | 996 |
| 255 | Ga0395905_0269843 | 3300037471 | Bacteria | 1587 |
| 256 | Ga0395905_0391263 | 3300037471 | Bacteria | 1285 |
| 257 | Ga0439436_0035284 | 3300041404 | Bacteria | 1445 |
| 258 | Ga0439436_0042165 | 3300041404 | Bacteria | 1305 |
| 259 | Ga0439439_0101428 | 3300041406 | Bacteria | 792 |
| 260 | Ga0439465_0006794 | 3300041413 | Bacteria | 3635 |
| 261 | Ga0439465_0011245 | 3300041413 | Bacteria | 2810 |
| 262 | Ga0451797_1386712 | 3300041453 | Bacteria | 1770 |
| 263 | Ga0451837_0154854 | 3300041494 | Bacteria | 4997 |
| 264 | Ga0451843_0069898 | 3300041509 | Bacteria | 934 |
| 265 | Ga0451843_0281983 | 3300041509 | Bacteria | 1147 |
| 266 | Ga0439431_0138647 | 3300041997 | Bacteria | 686 |
| 267 | Ga0439448_0062161 | 3300042005 | Bacteria | 1235 |
| 268 | Ga0439449_0017697 | 3300042007 | Bacteria | 2676 |
| 269 | Ga0439452_028913 | 3300042010 | Bacteria | 1379 |
| 270 | Ga0439462_0066145 | 3300042015 | Bacteria | 980 |
| 271 | Ga0450898_048276 | 3300042134 | Bacteria | 818 |
| 272 | Ga0450899_005502 | 3300042135 | Bacteria | 1363 |
| 273 | Ga0450905_007896 | 3300042142 | Bacteria | 1454 |
| 274 | Ga0439458_0063550 | 3300042157 | Bacteria | 925 |
| 275 | Ga0451577_0121488 | 3300042876 | Bacteria | 2340 |
| 276 | Ga0451577_0298352 | 3300042876 | Bacteria | 1460 |
| 277 | Ga0453684_0000159 | 3300044712 | Bacteria | 300297 |
| 278 | Ga0451576_0000120 | 3300045051 | Bacteria | 199365 |
| 279 | Ga0466967_0183488 | 3300045976 | Bacteria | 1975 |
| 280 | Ga0495638_0000152 | 3300046460 | Bacteria | 109586 |
| 281 | Ga0495638_0000378 | 3300046460 | Bacteria | 55320 |
| 282 | Ga0495650_0000112 | 3300046471 | Bacteria | 197339 |
| 283 | Ga0495664_0328994 | 3300046477 | Bacteria | 921 |
| 284 | Ga0495606_0001622 | 3300046507 | Bacteria | 29369 |
| 285 | Ga0495618_0273185 | 3300046514 | Bacteria | 1056 |
| 286 | Ga0495630_0285616 | 3300046517 | Bacteria | 1261 |
| 287 | Ga0495587_0191147 | 3300046536 | Bacteria | 1159 |
| 288 | Ga0495598_0107317 | 3300046537 | Bacteria | 931 |
| 289 | Ga0495621_0246166 | 3300046539 | Bacteria | 729 |
| 290 | Ga0495622_0002547 | 3300046557 | Bacteria | 8806 |
| 291 | Ga0495656_0006378 | 3300046615 | Bacteria | 4137 |
| 292 | Ga0495656_0032075 | 3300046615 | Bacteria | 2135 |
| 293 | Ga0495656_0140638 | 3300046615 | Bacteria | 1157 |
| 294 | Ga0495625_0016670 | 3300046660 | Bacteria | 5773 |
| 295 | Ga0495659_0068754 | 3300046664 | Bacteria | 1323 |
| 296 | Ga0495657_0131694 | 3300046675 | Bacteria | 1566 |
| 297 | Ga0495670_0141528 | 3300046691 | Bacteria | 1258 |
| 298 | Ga0495649_0001164 | 3300046694 | Bacteria | 20425 |
| 299 | Ga0495636_0001496 | 3300047318 | Bacteria | 8857 |
| 300 | Ga0495636_0004599 | 3300047318 | Bacteria | 5408 |
| 301 | Ga0495636_0030994 | 3300047318 | Bacteria | 2190 |
| 302 | Ga0495636_0050217 | 3300047318 | Bacteria | 1745 |
| 303 | Ga0495684_0162372 | 3300047471 | Bacteria | 1666 |
| 304 | Ga0496100_0251246 | 3300048903 | Bacteria | 1308 |
| 305 | Ga0496101_0213588 | 3300048904 | Bacteria | 1495 |
| 306 | Ga0496106_0534394 | 3300048909 | Bacteria | 941 |
| 307 | Ga0496109_0035762 | 3300048912 | Bacteria | 4483 |
| 308 | Ga0496110_0211899 | 3300048913 | Bacteria | 1761 |
| 309 | Ga0496112_0597498 | 3300048915 | Bacteria | 1035 |
| 310 | Ga0496113_0002905 | 3300048916 | Bacteria | 10101 |
| 311 | Ga0496113_0021691 | 3300048916 | Bacteria | 4533 |
| 312 | Ga0496114_0005982 | 3300048917 | Bacteria | 9577 |
| 313 | Ga0496114_0380767 | 3300048917 | Bacteria | 1249 |
| 314 | Ga0496115_0000008 | 3300048918 | Bacteria | 237485 |
| 315 | Ga0496115_0005931 | 3300048918 | Bacteria | 8914 |
| 316 | Ga0496115_0013455 | 3300048918 | Bacteria | 6190 |
| 317 | Ga0496115_0322743 | 3300048918 | Bacteria | 1263 |
| 318 | Ga0496125_0133667 | 3300048928 | Bacteria | 1740 |
| 319 | Ga0496126_0006571 | 3300048929 | Bacteria | 12952 |
| 320 | Ga0496126_0023762 | 3300048929 | Bacteria | 5935 |
| 321 | Ga0496126_0029021 | 3300048929 | Bacteria | 5260 |
| 322 | Ga0496126_0083326 | 3300048929 | Bacteria | 2822 |
| 323 | Ga0495678_014368 | 3300049459 | Bacteria | 3683 |
| 324 | Ga0495682_0154028 | 3300049460 | Bacteria | 819 |
| 325 | Ga0501299_003824 | 3300049522 | Bacteria | 2208 |
| 326 | Ga0501032_0015623 | 3300049569 | Bacteria | 5353 |
| 327 | Ga0501033_0032227 | 3300049570 | Bacteria | 3935 |
| 328 | Ga0501034_0000275 | 3300049571 | Bacteria | 92805 |
| 329 | Ga0501034_0010873 | 3300049571 | Bacteria | 9453 |
| 330 | Ga0501034_0523238 | 3300049571 | Bacteria | 1098 |
| 331 | Ga0501036_0074264 | 3300049572 | Bacteria | 2875 |
| 332 | Ga0501037_0045703 | 3300049573 | Bacteria | 3213 |
| 333 | Ga0501040_0076238 | 3300049576 | Bacteria | 2318 |
| 334 | Ga0501043_0000694 | 3300049579 | Bacteria | 29789 |
| 335 | Ga0501043_0106107 | 3300049579 | Bacteria | 2206 |
| 336 | Ga0501046_0039140 | 3300049580 | Bacteria | 3799 |
| 337 | Ga0501047_0384725 | 3300049581 | Bacteria | 1237 |
| 338 | Ga0501047_0495216 | 3300049581 | Bacteria | 1049 |
| 339 | Ga0501048_0177524 | 3300049582 | Bacteria | 1509 |
| 340 | Ga0501067_0011911 | 3300049583 | Bacteria | 4818 |
| 341 | Ga0501068_0222967 | 3300049584 | Bacteria | 1198 |
| 342 | Ga0501069_0038030 | 3300049585 | Bacteria | 2655 |
| 343 | Ga0501070_0103813 | 3300049586 | Bacteria | 2350 |
| 344 | Ga0501071_0007818 | 3300049587 | Bacteria | 7051 |
| 345 | Ga0501073_0121514 | 3300049589 | Bacteria | 1810 |
| 346 | Ga0501074_0007488 | 3300049590 | Bacteria | 7897 |
| 347 | Ga0501249_006351 | 3300049679 | Bacteria | 2429 |
| 348 | Ga0501252_004844 | 3300049682 | Bacteria | 1446 |
| 349 | Ga0501257_085411 | 3300049686 | Bacteria | 817 |
| 350 | Ga0501225_0014773 | 3300049705 | Bacteria | 2178 |
| 351 | Ga0501225_0053339 | 3300049705 | Bacteria | 1128 |
| 352 | Ga0501079_0112148 | 3300049741 | Bacteria | 2119 |
| 353 | Ga0501080_0066411 | 3300049742 | Bacteria | 3354 |
| 354 | Ga0501080_0394761 | 3300049742 | Bacteria | 1245 |
| 355 | Ga0501080_0456848 | 3300049742 | Bacteria | 1144 |
| 356 | Ga0501083_0083684 | 3300049744 | Bacteria | 2113 |
| 357 | Ga0501271_005002 | 3300049768 | Bacteria | 1278 |
| 358 | Ga0501035_0011489 | 3300049822 | Bacteria | 8205 |
| 359 | Ga0501035_0556431 | 3300049822 | Bacteria | 939 |
| 360 | Ga0501045_0085611 | 3300049824 | Bacteria | 2326 |
| 361 | Ga0501226_005248 | 3300049853 | Bacteria | 1481 |
| 362 | nmdc:mga00v17_25_c1 | 3300050491 | Bacteria | 101679 |
| 363 | nmdc:mga09592_382982_c1 | 3300050508 | Bacteria | 1216 |
| 364 | nmdc:mga0qj67_735599_c1 | 3300050509 | Bacteria | 783 |
| 365 | Ga0500651_0055225 | 3300053093 | Bacteria | 2488 |
| 366 | Ga0500568_0006939 | 3300053139 | Bacteria | 5617 |
| 367 | Ga0500620_104601 | 3300053155 | Bacteria | 990 |
| 368 | Ga0501084_0013044 | 3300054114 | Bacteria | 6878 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0556431 | Ga0501035_0556431_25_534 | 169 |
| 2 | 3300005331 | Ga0070670_100094968 | Ga0070670_1000949683 | 179 |
| 3 | 3300005335 | Ga0070666_10031365 | Ga0070666_100313655 | 179 |
| 4 | 3300005338 | Ga0068868_100198851 | Ga0068868_1001988513 | 179 |
| 5 | 3300005344 | Ga0070661_100470019 | Ga0070661_1004700192 | 179 |
| 6 | 3300005367 | Ga0070667_100087529 | Ga0070667_1000875294 | 179 |
| 7 | 3300005455 | Ga0070663_100233814 | Ga0070663_1002338142 | 179 |
| 8 | 3300005457 | Ga0070662_100040689 | Ga0070662_1000406894 | 179 |
| 9 | 3300005548 | Ga0070665_100000469 | Ga0070665_1000004698 | 179 |
| 10 | 3300005563 | Ga0068855_100356046 | Ga0068855_1003560462 | 179 |
| 11 | 3300005614 | Ga0068856_100989395 | Ga0068856_1009893952 | 179 |
| 12 | 3300005614 | Ga0068856_101556766 | Ga0068856_1015567661 | 179 |
| 13 | 3300005616 | Ga0068852_100253984 | Ga0068852_1002539842 | 179 |
| 14 | 3300005834 | Ga0068851_10019177 | Ga0068851_100191774 | 179 |
| 15 | 3300005842 | Ga0068858_100000797 | Ga0068858_10000079726 | 179 |
| 16 | 3300006881 | Ga0068865_100044710 | Ga0068865_1000447102 | 179 |
| 17 | 3300009093 | Ga0105240_10018953 | Ga0105240_1001895311 | 179 |
| 18 | 3300009545 | Ga0105237_10327528 | Ga0105237_103275283 | 179 |
| 19 | 3300009551 | Ga0105238_10038862 | Ga0105238_100388623 | 179 |
| 20 | 3300010375 | Ga0105239_10846974 | Ga0105239_108469742 | 179 |
| 21 | 3300013105 | Ga0157369_10083411 | Ga0157369_100834115 | 179 |
| 22 | 3300013307 | Ga0157372_10216759 | Ga0157372_102167592 | 179 |
| 23 | 3300014969 | Ga0157376_10342276 | Ga0157376_103422762 | 179 |
| 24 | 3300025903 | Ga0207680_10000780 | Ga0207680_1000078011 | 179 |
| 25 | 3300025913 | Ga0207695_10062111 | Ga0207695_100621113 | 179 |
| 26 | 3300025914 | Ga0207671_10028449 | Ga0207671_100284495 | 179 |
| 27 | 3300025920 | Ga0207649_10144890 | Ga0207649_101448902 | 179 |
| 28 | 3300025924 | Ga0207694_10001234 | Ga0207694_100012343 | 179 |
| 29 | 3300025925 | Ga0207650_10026663 | Ga0207650_100266634 | 179 |
| 30 | 3300025931 | Ga0207644_10283601 | Ga0207644_102836013 | 179 |
| 31 | 3300025933 | Ga0207706_10031331 | Ga0207706_100313315 | 179 |
| 32 | 3300025934 | Ga0207686_10403661 | Ga0207686_104036612 | 179 |
| 33 | 3300025949 | Ga0207667_10059416 | Ga0207667_100594162 | 179 |
| 34 | 3300025961 | Ga0207712_10000390 | Ga0207712_1000039012 | 179 |
| 35 | 3300025986 | Ga0207658_10012464 | Ga0207658_100124646 | 179 |
| 36 | 3300025986 | Ga0207658_10217478 | Ga0207658_102174783 | 179 |
| 37 | 3300026035 | Ga0207703_10000536 | Ga0207703_1000053615 | 179 |
| 38 | 3300026041 | Ga0207639_10057822 | Ga0207639_100578224 | 179 |
| 39 | 3300026067 | Ga0207678_10002378 | Ga0207678_1000237811 | 179 |
| 40 | 3300026089 | Ga0207648_10153246 | Ga0207648_101532463 | 179 |
| 41 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007844 | 179 |
| 42 | 3300014968 | Ga0157379_10353455 | Ga0157379_103534552 | 180 |
| 43 | 3300036401 | Ga0373937_0198291 | Ga0373937_0198291_65_670 | 187 |
| 44 | 3300014968 | Ga0157379_11299647 | Ga0157379_112996471 | 190 |
| 45 | 3300025273 | Ga0209673_1016419 | Ga0209673_10164193 | 190 |
| 46 | 3300041997 | Ga0439431_0138647 | Ga0439431_0138647_14_586 | 190 |
| 47 | 3300050509 | nmdc:mga0qj67_735599_c1 | nmdc:mga0qj67_735599_c1_145_750 | 190 |
| 48 | 3300049742 | Ga0501080_0394761 | Ga0501080_0394761_341_958 | 193 |
| 49 | 3300031727 | Ga0316576_10062282 | Ga0316576_100622822 | 195 |
| 50 | 3300035398 | Ga0316574_0009877 | Ga0316574_0009877_4436_5047 | 195 |
| 51 | 3300049522 | Ga0501299_003824 | Ga0501299_003824_240_833 | 195 |
| 52 | iso_pu_bacteria | 2739367700 | 2739732565 | 200 |
| 53 | iso_pu_bacteria | 2884411467 | 2884412670 | 200 |
| 54 | iso_pu_bacteria | 2928963466 | 2928965297 | 200 |
| 55 | 3300005328 | Ga0070676_10006852 | Ga0070676_100068522 | 201 |
| 56 | 3300005335 | Ga0070666_10020164 | Ga0070666_100201643 | 201 |
| 57 | 3300005347 | Ga0070668_100118478 | Ga0070668_1001184782 | 201 |
| 58 | 3300005347 | Ga0070668_100405678 | Ga0070668_1004056782 | 201 |
| 59 | 3300005367 | Ga0070667_100010104 | Ga0070667_1000101049 | 201 |
| 60 | 3300005367 | Ga0070667_100270111 | Ga0070667_1002701111 | 201 |
| 61 | 3300005439 | Ga0070711_100084602 | Ga0070711_1000846022 | 201 |
| 62 | 3300005459 | Ga0068867_100683637 | Ga0068867_1006836372 | 201 |
| 63 | 3300005539 | Ga0068853_100324667 | Ga0068853_1003246673 | 201 |
| 64 | 3300005547 | Ga0070693_100005200 | Ga0070693_1000052007 | 201 |
| 65 | 3300005548 | Ga0070665_100176040 | Ga0070665_1001760403 | 201 |
| 66 | 3300005616 | Ga0068852_100023333 | Ga0068852_1000233332 | 201 |
| 67 | 3300005719 | Ga0068861_100042796 | Ga0068861_1000427962 | 201 |
| 68 | 3300005834 | Ga0068851_10011672 | Ga0068851_100116723 | 201 |
| 69 | 3300005841 | Ga0068863_100838011 | Ga0068863_1008380111 | 201 |
| 70 | 3300005843 | Ga0068860_101087774 | Ga0068860_1010877741 | 201 |
| 71 | 3300006237 | Ga0097621_100155830 | Ga0097621_1001558302 | 201 |
| 72 | 3300006358 | Ga0068871_100008412 | Ga0068871_1000084129 | 201 |
| 73 | 3300006358 | Ga0068871_100095942 | Ga0068871_1000959422 | 201 |
| 74 | 3300006881 | Ga0068865_100154423 | Ga0068865_1001544232 | 201 |
| 75 | 3300009551 | Ga0105238_10043722 | Ga0105238_100437227 | 201 |
| 76 | 3300010375 | Ga0105239_10295740 | Ga0105239_102957403 | 201 |
| 77 | 3300011119 | Ga0105246_10108046 | Ga0105246_101080463 | 201 |
| 78 | 3300013104 | Ga0157370_10314476 | Ga0157370_103144761 | 201 |
| 79 | 3300013105 | Ga0157369_10414176 | Ga0157369_104141762 | 201 |
| 80 | 3300013296 | Ga0157374_10091172 | Ga0157374_100911724 | 201 |
| 81 | 3300013297 | Ga0157378_10569865 | Ga0157378_105698653 | 201 |
| 82 | 3300013307 | Ga0157372_10004902 | Ga0157372_1000490211 | 201 |
| 83 | 3300013307 | Ga0157372_10284370 | Ga0157372_102843703 | 201 |
| 84 | 3300014969 | Ga0157376_10079140 | Ga0157376_100791402 | 201 |
| 85 | 3300014969 | Ga0157376_10158092 | Ga0157376_101580923 | 201 |
| 86 | 3300025914 | Ga0207671_10157421 | Ga0207671_101574212 | 201 |
| 87 | 3300025914 | Ga0207671_10507584 | Ga0207671_105075842 | 201 |
| 88 | 3300025915 | Ga0207693_10529351 | Ga0207693_105293512 | 201 |
| 89 | 3300025920 | Ga0207649_10020581 | Ga0207649_100205814 | 201 |
| 90 | 3300025931 | Ga0207644_10315740 | Ga0207644_103157401 | 201 |
| 91 | 3300025938 | Ga0207704_10011862 | Ga0207704_100118623 | 201 |
| 92 | 3300025938 | Ga0207704_10537852 | Ga0207704_105378521 | 201 |
| 93 | 3300025941 | Ga0207711_10420295 | Ga0207711_104202952 | 201 |
| 94 | 3300025942 | Ga0207689_10145203 | Ga0207689_101452032 | 201 |
| 95 | 3300025945 | Ga0207679_10148045 | Ga0207679_101480452 | 201 |
| 96 | 3300025949 | Ga0207667_10540373 | Ga0207667_105403733 | 201 |
| 97 | 3300025960 | Ga0207651_10122047 | Ga0207651_101220472 | 201 |
| 98 | 3300025972 | Ga0207668_10164767 | Ga0207668_101647673 | 201 |
| 99 | 3300025972 | Ga0207668_10242401 | Ga0207668_102424012 | 201 |
| 100 | 3300025986 | Ga0207658_10332695 | Ga0207658_103326952 | 201 |
| 101 | 3300026041 | Ga0207639_10093611 | Ga0207639_100936113 | 201 |
| 102 | 3300026078 | Ga0207702_10673317 | Ga0207702_106733173 | 201 |
| 103 | 3300026088 | Ga0207641_10251184 | Ga0207641_102511843 | 201 |
| 104 | 3300026118 | Ga0207675_100020520 | Ga0207675_1000205207 | 201 |
| 105 | 3300028381 | Ga0268264_10293409 | Ga0268264_102934092 | 201 |
| 106 | 3300028381 | Ga0268264_10971368 | Ga0268264_109713682 | 201 |
| 107 | 3300031616 | Ga0307508_10221720 | Ga0307508_102217202 | 201 |
| 108 | 3300031727 | Ga0316576_10024953 | Ga0316576_100249536 | 201 |
| 109 | 3300034820 | Ga0373959_0069515 | Ga0373959_0069515_96_701 | 201 |
| 110 | 3300042005 | Ga0439448_0062161 | Ga0439448_0062161_416_1021 | 201 |
| 111 | 3300042876 | Ga0451577_0121488 | Ga0451577_0121488_1533_2150 | 201 |
| 112 | 3300042876 | Ga0451577_0298352 | Ga0451577_0298352_658_1263 | 201 |
| 113 | 3300046517 | Ga0495630_0285616 | Ga0495630_0285616_254_859 | 201 |
| 114 | 3300046539 | Ga0495621_0246166 | Ga0495621_0246166_103_708 | 201 |
| 115 | 3300048916 | Ga0496113_0002905 | Ga0496113_0002905_9340_9972 | 201 |
| 116 | 3300048918 | Ga0496115_0013455 | Ga0496115_0013455_5440_6045 | 201 |
| 117 | 3300049569 | Ga0501032_0015623 | Ga0501032_0015623_1423_2028 | 201 |
| 118 | 3300049570 | Ga0501033_0032227 | Ga0501033_0032227_2240_2845 | 201 |
| 119 | 3300049571 | Ga0501034_0010873 | Ga0501034_0010873_5615_6220 | 201 |
| 120 | 3300049571 | Ga0501034_0523238 | Ga0501034_0523238_214_819 | 201 |
| 121 | 3300049572 | Ga0501036_0074264 | Ga0501036_0074264_2051_2656 | 201 |
| 122 | 3300049573 | Ga0501037_0045703 | Ga0501037_0045703_1081_1686 | 201 |
| 123 | 3300049576 | Ga0501040_0076238 | Ga0501040_0076238_1134_1739 | 201 |
| 124 | 3300049579 | Ga0501043_0106107 | Ga0501043_0106107_179_784 | 201 |
| 125 | 3300049580 | Ga0501046_0039140 | Ga0501046_0039140_453_1058 | 201 |
| 126 | 3300049581 | Ga0501047_0495216 | Ga0501047_0495216_29_634 | 201 |
| 127 | 3300049582 | Ga0501048_0177524 | Ga0501048_0177524_371_976 | 201 |
| 128 | 3300049583 | Ga0501067_0011911 | Ga0501067_0011911_1812_2417 | 201 |
| 129 | 3300049584 | Ga0501068_0222967 | Ga0501068_0222967_233_838 | 201 |
| 130 | 3300049585 | Ga0501069_0038030 | Ga0501069_0038030_482_1087 | 201 |
| 131 | 3300049586 | Ga0501070_0103813 | Ga0501070_0103813_1513_2118 | 201 |
| 132 | 3300049587 | Ga0501071_0007818 | Ga0501071_0007818_597_1202 | 201 |
| 133 | 3300049589 | Ga0501073_0121514 | Ga0501073_0121514_636_1241 | 201 |
| 134 | 3300049590 | Ga0501074_0007488 | Ga0501074_0007488_1228_1833 | 201 |
| 135 | 3300049741 | Ga0501079_0112148 | Ga0501079_0112148_1295_1900 | 201 |
| 136 | 3300049742 | Ga0501080_0066411 | Ga0501080_0066411_1942_2547 | 201 |
| 137 | 3300049742 | Ga0501080_0456848 | Ga0501080_0456848_361_966 | 201 |
| 138 | 3300049744 | Ga0501083_0083684 | Ga0501083_0083684_1276_1881 | 201 |
| 139 | 3300049822 | Ga0501035_0011489 | Ga0501035_0011489_2074_2679 | 201 |
| 140 | 3300049824 | Ga0501045_0085611 | Ga0501045_0085611_1091_1696 | 201 |
| 141 | 3300053093 | Ga0500651_0055225 | Ga0500651_0055225_1138_1743 | 201 |
| 142 | 3300053139 | Ga0500568_0006939 | Ga0500568_0006939_668_1273 | 201 |
| 143 | 3300053155 | Ga0500620_104601 | Ga0500620_104601_41_646 | 201 |
| 144 | 3300054114 | Ga0501084_0013044 | Ga0501084_0013044_174_779 | 201 |
| 145 | 3300005327 | Ga0070658_10085761 | Ga0070658_100857612 | 202 |
| 146 | 3300005335 | Ga0070666_10116460 | Ga0070666_101164603 | 202 |
| 147 | 3300005338 | Ga0068868_100291875 | Ga0068868_1002918752 | 202 |
| 148 | 3300005439 | Ga0070711_100080773 | Ga0070711_1000807732 | 202 |
| 149 | 3300005459 | Ga0068867_100100529 | Ga0068867_1001005295 | 202 |
| 150 | 3300005548 | Ga0070665_100702055 | Ga0070665_1007020553 | 202 |
| 151 | 3300005617 | Ga0068859_100313294 | Ga0068859_1003132942 | 202 |
| 152 | 3300005618 | Ga0068864_100802452 | Ga0068864_1008024521 | 202 |
| 153 | 3300005842 | Ga0068858_100367256 | Ga0068858_1003672561 | 202 |
| 154 | 3300006237 | Ga0097621_100150784 | Ga0097621_1001507842 | 202 |
| 155 | 3300006844 | Ga0075428_100588341 | Ga0075428_1005883413 | 202 |
| 156 | 3300006846 | Ga0075430_100243043 | Ga0075430_1002430432 | 202 |
| 157 | 3300006880 | Ga0075429_100235487 | Ga0075429_1002354872 | 202 |
| 158 | 3300006881 | Ga0068865_100001018 | Ga0068865_10000101812 | 202 |
| 159 | 3300006931 | Ga0097620_100313284 | Ga0097620_1003132842 | 202 |
| 160 | 3300009147 | Ga0114129_10702534 | Ga0114129_107025343 | 202 |
| 161 | 3300009176 | Ga0105242_10050594 | Ga0105242_100505945 | 202 |
| 162 | 3300025903 | Ga0207680_10009306 | Ga0207680_100093065 | 202 |
| 163 | 3300025914 | Ga0207671_10247821 | Ga0207671_102478212 | 202 |
| 164 | 3300025916 | Ga0207663_10119339 | Ga0207663_101193393 | 202 |
| 165 | 3300025924 | Ga0207694_10020682 | Ga0207694_100206822 | 202 |
| 166 | 3300025933 | Ga0207706_10751433 | Ga0207706_107514331 | 202 |
| 167 | 3300025934 | Ga0207686_10051966 | Ga0207686_100519663 | 202 |
| 168 | 3300025986 | Ga0207658_10683837 | Ga0207658_106838372 | 202 |
| 169 | 3300026035 | Ga0207703_10350992 | Ga0207703_103509922 | 202 |
| 170 | 3300026089 | Ga0207648_10049354 | Ga0207648_100493542 | 202 |
| 171 | 3300026095 | Ga0207676_10301986 | Ga0207676_103019862 | 202 |
| 172 | 3300026121 | Ga0207683_10004840 | Ga0207683_1000484012 | 202 |
| 173 | 3300031665 | Ga0316575_10013864 | Ga0316575_100138643 | 202 |
| 174 | 3300035172 | Ga0373955_0170902 | Ga0373955_0170902_247_861 | 202 |
| 175 | 3300035724 | Ga0373933_0401992 | Ga0373933_0401992_120_734 | 202 |
| 176 | 3300036401 | Ga0373937_0026049 | Ga0373937_0026049_977_1591 | 202 |
| 177 | 3300044712 | Ga0453684_0000159 | Ga0453684_0000159_64272_64880 | 202 |
| 178 | 3300045051 | Ga0451576_0000120 | Ga0451576_0000120_64272_64880 | 202 |
| 179 | 3300046477 | Ga0495664_0328994 | Ga0495664_0328994_141_755 | 202 |
| 180 | 3300046536 | Ga0495587_0191147 | Ga0495587_0191147_143_757 | 202 |
| 181 | 3300046675 | Ga0495657_0131694 | Ga0495657_0131694_681_1295 | 202 |
| 182 | 3300047471 | Ga0495684_0162372 | Ga0495684_0162372_903_1517 | 202 |
| 183 | 3300050508 | nmdc:mga09592_382982_c1 | nmdc:mga09592_382982_c1_340_948 | 202 |
| 184 | iso_pu_bacteria | 2643221581 | 2643914655 | 202 |
| 185 | iso_pu_bacteria | 2923516293 | 2923517083 | 202 |
| 186 | 3300003771 | Ga0055526_1012727 | Ga0055526_10127272 | 203 |
| 187 | 3300005354 | Ga0070675_100096928 | Ga0070675_1000969283 | 203 |
| 188 | 3300028381 | Ga0268264_10340797 | Ga0268264_103407973 | 203 |
| 189 | 3300046514 | Ga0495618_0273185 | Ga0495618_0273185_106_756 | 203 |
| 190 | iso_pu_bacteria | 2687453130 | 2687584446 | 203 |
| 191 | iso_pu_bacteria | 2895498888 | 2895499810 | 203 |
| 192 | iso_pu_bacteria | 2895511927 | 2895512785 | 203 |
| 193 | iso_pu_bacteria | 2895522137 | 2895522800 | 203 |
| 194 | iso_pu_bacteria | 2895525241 | 2895525426 | 203 |
| 195 | 3300001989 | JGI24739J22299_10014635 | JGI24739J22299_100146353 | 204 |
| 196 | 3300002067 | JGI24735J21928_10000458 | JGI24735J21928_1000045812 | 204 |
| 197 | 3300002737 | JGI25162J39368_1000470 | JGI25162J39368_100047014 | 204 |
| 198 | 3300002737 | JGI25162J39368_1001981 | JGI25162J39368_10019818 | 204 |
| 199 | 3300002741 | JGI25157J39369_1000585 | JGI25157J39369_100058510 | 204 |
| 200 | 3300002771 | JGI25163J39215_1000551 | JGI25163J39215_10005512 | 204 |
| 201 | 3300002772 | JGI25164J39214_1000075 | JGI25164J39214_100007516 | 204 |
| 202 | 3300003187 | JGI25151J46595_10043215 | JGI25151J46595_100432152 | 204 |
| 203 | 3300003214 | JGI25165J46597_1000178 | JGI25165J46597_100017876 | 204 |
| 204 | 3300003751 | Ga0055538_1003074 | Ga0055538_10030744 | 204 |
| 205 | 3300003756 | Ga0055533_1003461 | Ga0055533_10034615 | 204 |
| 206 | 3300003761 | Ga0055535_1000144 | Ga0055535_100014453 | 204 |
| 207 | 3300003762 | Ga0055542_1000213 | Ga0055542_100021310 | 204 |
| 208 | 3300003762 | Ga0055542_1000594 | Ga0055542_100059414 | 204 |
| 209 | 3300003763 | Ga0055529_1000153 | Ga0055529_100015376 | 204 |
| 210 | 3300005293 | Ga0065715_10045182 | Ga0065715_100451822 | 204 |
| 211 | 3300005340 | Ga0070689_100016568 | Ga0070689_1000165686 | 204 |
| 212 | 3300005356 | Ga0070674_100718263 | Ga0070674_1007182632 | 204 |
| 213 | 3300005455 | Ga0070663_100015214 | Ga0070663_1000152144 | 204 |
| 214 | 3300005466 | Ga0070685_10070461 | Ga0070685_100704613 | 204 |
| 215 | 3300005844 | Ga0068862_100151167 | Ga0068862_1001511672 | 204 |
| 216 | 3300009551 | Ga0105238_10062658 | Ga0105238_100626585 | 204 |
| 217 | 3300010375 | Ga0105239_10430420 | Ga0105239_104304203 | 204 |
| 218 | 3300013105 | Ga0157369_10515516 | Ga0157369_105155163 | 204 |
| 219 | 3300013306 | Ga0163162_10104785 | Ga0163162_101047853 | 204 |
| 220 | 3300014969 | Ga0157376_10062349 | Ga0157376_100623492 | 204 |
| 221 | 3300015687 | Ga0183368_1003 | Ga0183368_1003172 | 204 |
| 222 | 3300025207 | Ga0209760_100219 | Ga0209760_10021912 | 204 |
| 223 | 3300025224 | Ga0209784_100104 | Ga0209784_10010415 | 204 |
| 224 | 3300025226 | Ga0209674_100033 | Ga0209674_100033185 | 204 |
| 225 | 3300025228 | Ga0209672_100759 | Ga0209672_1007599 | 204 |
| 226 | 3300025228 | Ga0209672_109176 | Ga0209672_1091763 | 204 |
| 227 | 3300025231 | Ga0207427_100070 | Ga0207427_10007072 | 204 |
| 228 | 3300025233 | Ga0209437_100059 | Ga0209437_100059130 | 204 |
| 229 | 3300025233 | Ga0209437_100214 | Ga0209437_10021490 | 204 |
| 230 | 3300025242 | Ga0209258_100034 | Ga0209258_10003417 | 204 |
| 231 | 3300025242 | Ga0209258_100858 | Ga0209258_1008587 | 204 |
| 232 | 3300025242 | Ga0209258_102669 | Ga0209258_1026694 | 204 |
| 233 | 3300025246 | Ga0209646_1000879 | Ga0209646_10008795 | 204 |
| 234 | 3300025246 | Ga0209646_1004944 | Ga0209646_10049443 | 204 |
| 235 | 3300025250 | Ga0209026_1000176 | Ga0209026_100017672 | 204 |
| 236 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001687 | 204 |
| 237 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002786 | 204 |
| 238 | 3300025256 | Ga0209759_1000581 | Ga0209759_100058115 | 204 |
| 239 | 3300025256 | Ga0209759_1006107 | Ga0209759_10061073 | 204 |
| 240 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021544 | 204 |
| 241 | 3300025261 | Ga0209233_1009776 | Ga0209233_10097763 | 204 |
| 242 | 3300025272 | Ga0209455_1000019 | Ga0209455_100001915 | 204 |
| 243 | 3300025272 | Ga0209455_1003352 | Ga0209455_10033522 | 204 |
| 244 | 3300025904 | Ga0207647_10003302 | Ga0207647_1000330211 | 204 |
| 245 | 3300025920 | Ga0207649_10038031 | Ga0207649_100380311 | 204 |
| 246 | 3300025924 | Ga0207694_10182954 | Ga0207694_101829543 | 204 |
| 247 | 3300025936 | Ga0207670_10010231 | Ga0207670_100102312 | 204 |
| 248 | 3300025986 | Ga0207658_10294134 | Ga0207658_102941343 | 204 |
| 249 | 3300026067 | Ga0207678_10015234 | Ga0207678_100152347 | 204 |
| 250 | 3300026067 | Ga0207678_10358885 | Ga0207678_103588852 | 204 |
| 251 | 3300027360 | Ga0209969_1001749 | Ga0209969_10017492 | 204 |
| 252 | 3300027471 | Ga0209995_1020127 | Ga0209995_10201272 | 204 |
| 253 | 3300027552 | Ga0209982_1007562 | Ga0209982_10075622 | 204 |
| 254 | 3300028381 | Ga0268264_10058349 | Ga0268264_100583492 | 204 |
| 255 | 3300028800 | Ga0265338_10431864 | Ga0265338_104318642 | 204 |
| 256 | 3300031824 | Ga0307413_10130284 | Ga0307413_101302842 | 204 |
| 257 | 3300032004 | Ga0307414_10045003 | Ga0307414_100450032 | 204 |
| 258 | 3300032004 | Ga0307414_10056897 | Ga0307414_100568975 | 204 |
| 259 | 3300045976 | Ga0466967_0183488 | Ga0466967_0183488_493_1137 | 204 |
| 260 | 3300046460 | Ga0495638_0000152 | Ga0495638_0000152_19606_20280 | 204 |
| 261 | 3300046460 | Ga0495638_0000378 | Ga0495638_0000378_6763_7437 | 204 |
| 262 | 3300046471 | Ga0495650_0000112 | Ga0495650_0000112_6767_7441 | 204 |
| 263 | 3300046507 | Ga0495606_0001622 | Ga0495606_0001622_13968_14609 | 204 |
| 264 | 3300046557 | Ga0495622_0002547 | Ga0495622_0002547_3908_4582 | 204 |
| 265 | 3300046660 | Ga0495625_0016670 | Ga0495625_0016670_284_958 | 204 |
| 266 | 3300046694 | Ga0495649_0001164 | Ga0495649_0001164_6746_7420 | 204 |
| 267 | 3300048909 | Ga0496106_0534394 | Ga0496106_0534394_88_729 | 204 |
| 268 | 3300048918 | Ga0496115_0000008 | Ga0496115_0000008_236388_237029 | 204 |
| 269 | 3300048918 | Ga0496115_0005931 | Ga0496115_0005931_7265_7939 | 204 |
| 270 | 3300048918 | Ga0496115_0322743 | Ga0496115_0322743_575_1216 | 204 |
| 271 | 3300048929 | Ga0496126_0023762 | Ga0496126_0023762_985_1626 | 204 |
| 272 | 3300048929 | Ga0496126_0029021 | Ga0496126_0029021_159_833 | 204 |
| 273 | 3300048929 | Ga0496126_0083326 | Ga0496126_0083326_2113_2754 | 204 |
| 274 | 3300049459 | Ga0495678_014368 | Ga0495678_014368_2018_2692 | 204 |
| 275 | 3300049460 | Ga0495682_0154028 | Ga0495682_0154028_145_786 | 204 |
| 276 | iso_pu_bacteria | 2571042365 | 2572253600 | 204 |
| 277 | 3300005289 | Ga0065704_10099761 | Ga0065704_100997611 | 205 |
| 278 | 3300005543 | Ga0070672_100256636 | Ga0070672_1002566362 | 205 |
| 279 | 3300006051 | Ga0075364_10000769 | Ga0075364_100007697 | 205 |
| 280 | 3300014326 | Ga0157380_10342708 | Ga0157380_103427083 | 205 |
| 281 | 3300025918 | Ga0207662_10291270 | Ga0207662_102912702 | 205 |
| 282 | 3300028794 | Ga0307515_10048284 | Ga0307515_100482845 | 205 |
| 283 | 3300032002 | Ga0307416_100078567 | Ga0307416_1000785673 | 205 |
| 284 | 3300032002 | Ga0307416_100942341 | Ga0307416_1009423412 | 205 |
| 285 | 3300032004 | Ga0307414_10004708 | Ga0307414_100047084 | 205 |
| 286 | 3300032004 | Ga0307414_10051007 | Ga0307414_100510073 | 205 |
| 287 | 3300037471 | Ga0395905_0391263 | Ga0395905_0391263_25_654 | 205 |
| 288 | 3300041509 | Ga0451843_0281983 | Ga0451843_0281983_469_1101 | 205 |
| 289 | 3300042007 | Ga0439449_0017697 | Ga0439449_0017697_332_952 | 205 |
| 290 | 3300042142 | Ga0450905_007896 | Ga0450905_007896_151_783 | 205 |
| 291 | 3300042157 | Ga0439458_0063550 | Ga0439458_0063550_186_833 | 205 |
| 292 | 3300049581 | Ga0501047_0384725 | Ga0501047_0384725_254_880 | 205 |
| 293 | 3300049679 | Ga0501249_006351 | Ga0501249_006351_1337_1960 | 205 |
| 294 | 3300049686 | Ga0501257_085411 | Ga0501257_085411_72_695 | 205 |
| 295 | 3300049705 | Ga0501225_0053339 | Ga0501225_0053339_308_931 | 205 |
| 296 | 3300049853 | Ga0501226_005248 | Ga0501226_005248_452_1075 | 205 |
| 297 | 3300050491 | nmdc:mga00v17_25_c1 | nmdc:mga00v17_25_c1_16236_16868 | 205 |
| 298 | iso_pu_bacteria | 8002869464 | 8002870164 | 205 |
| 299 | 2162886007 | SwRhRL2b_contig_2377386 | SwRhRL2b_0217.00004640 | 206 |
| 300 | 3300002741 | JGI25157J39369_1001417 | JGI25157J39369_10014177 | 206 |
| 301 | 3300003781 | Ga0055536_1008655 | Ga0055536_10086553 | 206 |
| 302 | 3300005289 | Ga0065704_10071131 | Ga0065704_100711311 | 206 |
| 303 | 3300005344 | Ga0070661_100378938 | Ga0070661_1003789383 | 206 |
| 304 | 3300005355 | Ga0070671_100160002 | Ga0070671_1001600022 | 206 |
| 305 | 3300005356 | Ga0070674_100159014 | Ga0070674_1001590143 | 206 |
| 306 | 3300005435 | Ga0070714_100018328 | Ga0070714_1000183285 | 206 |
| 307 | 3300005436 | Ga0070713_100000918 | Ga0070713_10000091815 | 206 |
| 308 | 3300005457 | Ga0070662_100680817 | Ga0070662_1006808171 | 206 |
| 309 | 3300005459 | Ga0068867_100229226 | Ga0068867_1002292261 | 206 |
| 310 | 3300005564 | Ga0070664_100106619 | Ga0070664_1001066192 | 206 |
| 311 | 3300005618 | Ga0068864_100399561 | Ga0068864_1003995612 | 206 |
| 312 | 3300005719 | Ga0068861_100320377 | Ga0068861_1003203772 | 206 |
| 313 | 3300006175 | Ga0070712_100150602 | Ga0070712_1001506022 | 206 |
| 314 | 3300009092 | Ga0105250_10165904 | Ga0105250_101659042 | 206 |
| 315 | 3300009176 | Ga0105242_10429185 | Ga0105242_104291852 | 206 |
| 316 | 3300010375 | Ga0105239_10013435 | Ga0105239_100134354 | 206 |
| 317 | 3300013308 | Ga0157375_10271814 | Ga0157375_102718142 | 206 |
| 318 | 3300014326 | Ga0157380_10371318 | Ga0157380_103713182 | 206 |
| 319 | 3300025226 | Ga0209674_101242 | Ga0209674_1012424 | 206 |
| 320 | 3300025250 | Ga0209026_1000017 | Ga0209026_1000017194 | 206 |
| 321 | 3300025292 | Ga0209676_1000063 | Ga0209676_1000063247 | 206 |
| 322 | 3300025915 | Ga0207693_10056699 | Ga0207693_100566995 | 206 |
| 323 | 3300025923 | Ga0207681_10458477 | Ga0207681_104584773 | 206 |
| 324 | 3300025928 | Ga0207700_10001904 | Ga0207700_100019046 | 206 |
| 325 | 3300025929 | Ga0207664_10062212 | Ga0207664_100622122 | 206 |
| 326 | 3300025931 | Ga0207644_10058862 | Ga0207644_100588623 | 206 |
| 327 | 3300025937 | Ga0207669_10445216 | Ga0207669_104452161 | 206 |
| 328 | 3300025940 | Ga0207691_10016420 | Ga0207691_100164202 | 206 |
| 329 | 3300025944 | Ga0207661_10170636 | Ga0207661_101706363 | 206 |
| 330 | 3300025986 | Ga0207658_10785777 | Ga0207658_107857771 | 206 |
| 331 | 3300026089 | Ga0207648_10053647 | Ga0207648_100536472 | 206 |
| 332 | 3300026121 | Ga0207683_10018561 | Ga0207683_100185617 | 206 |
| 333 | 3300030733 | Ga0314311_1137376 | Ga0314311_11373762 | 206 |
| 334 | 3300031824 | Ga0307413_10172562 | Ga0307413_101725622 | 206 |
| 335 | 3300031852 | Ga0307410_10079523 | Ga0307410_100795235 | 206 |
| 336 | 3300031903 | Ga0307407_10702053 | Ga0307407_107020531 | 206 |
| 337 | 3300031911 | Ga0307412_10212033 | Ga0307412_102120333 | 206 |
| 338 | 3300031911 | Ga0307412_10754439 | Ga0307412_107544392 | 206 |
| 339 | 3300032004 | Ga0307414_10001626 | Ga0307414_100016267 | 206 |
| 340 | 3300032004 | Ga0307414_10304278 | Ga0307414_103042783 | 206 |
| 341 | 3300032005 | Ga0307411_10055234 | Ga0307411_100552344 | 206 |
| 342 | 3300037418 | Ga0395900_0645189 | Ga0395900_0645189_264_908 | 206 |
| 343 | 3300037471 | Ga0395905_0269843 | Ga0395905_0269843_209_853 | 206 |
| 344 | 3300041404 | Ga0439436_0035284 | Ga0439436_0035284_249_893 | 206 |
| 345 | 3300041404 | Ga0439436_0042165 | Ga0439436_0042165_605_1237 | 206 |
| 346 | 3300041406 | Ga0439439_0101428 | Ga0439439_0101428_144_776 | 206 |
| 347 | 3300041413 | Ga0439465_0006794 | Ga0439465_0006794_2592_3236 | 206 |
| 348 | 3300041413 | Ga0439465_0011245 | Ga0439465_0011245_302_943 | 206 |
| 349 | 3300041453 | Ga0451797_1386712 | Ga0451797_1386712_253_924 | 206 |
| 350 | 3300041494 | Ga0451837_0154854 | Ga0451837_0154854_352_1023 | 206 |
| 351 | 3300041509 | Ga0451843_0069898 | Ga0451843_0069898_149_820 | 206 |
| 352 | 3300042010 | Ga0439452_028913 | Ga0439452_028913_164_808 | 206 |
| 353 | 3300042015 | Ga0439462_0066145 | Ga0439462_0066145_224_868 | 206 |
| 354 | 3300042134 | Ga0450898_048276 | Ga0450898_048276_144_779 | 206 |
| 355 | 3300042135 | Ga0450899_005502 | Ga0450899_005502_164_796 | 206 |
| 356 | 3300046537 | Ga0495598_0107317 | Ga0495598_0107317_75_707 | 206 |
| 357 | 3300046615 | Ga0495656_0006378 | Ga0495656_0006378_2392_3036 | 206 |
| 358 | 3300046615 | Ga0495656_0032075 | Ga0495656_0032075_659_1294 | 206 |
| 359 | 3300046615 | Ga0495656_0140638 | Ga0495656_0140638_381_1016 | 206 |
| 360 | 3300046664 | Ga0495659_0068754 | Ga0495659_0068754_180_815 | 206 |
| 361 | 3300046691 | Ga0495670_0141528 | Ga0495670_0141528_329_964 | 206 |
| 362 | 3300047318 | Ga0495636_0001496 | Ga0495636_0001496_2836_3471 | 206 |
| 363 | 3300047318 | Ga0495636_0004599 | Ga0495636_0004599_155_790 | 206 |
| 364 | 3300047318 | Ga0495636_0030994 | Ga0495636_0030994_876_1511 | 206 |
| 365 | 3300047318 | Ga0495636_0050217 | Ga0495636_0050217_686_1330 | 206 |
| 366 | 3300048903 | Ga0496100_0251246 | Ga0496100_0251246_42_686 | 206 |
| 367 | 3300048904 | Ga0496101_0213588 | Ga0496101_0213588_719_1363 | 206 |
| 368 | 3300048912 | Ga0496109_0035762 | Ga0496109_0035762_1027_1671 | 206 |
| 369 | 3300048913 | Ga0496110_0211899 | Ga0496110_0211899_1005_1649 | 206 |
| 370 | 3300048915 | Ga0496112_0597498 | Ga0496112_0597498_112_756 | 206 |
| 371 | 3300048916 | Ga0496113_0021691 | Ga0496113_0021691_718_1362 | 206 |
| 372 | 3300048917 | Ga0496114_0005982 | Ga0496114_0005982_1508_2128 | 206 |
| 373 | 3300048917 | Ga0496114_0380767 | Ga0496114_0380767_58_702 | 206 |
| 374 | 3300048928 | Ga0496125_0133667 | Ga0496125_0133667_628_1269 | 206 |
| 375 | 3300048929 | Ga0496126_0006571 | Ga0496126_0006571_387_1007 | 206 |
| 376 | 3300049571 | Ga0501034_0000275 | Ga0501034_0000275_20143_20763 | 206 |
| 377 | 3300049579 | Ga0501043_0000694 | Ga0501043_0000694_28473_29120 | 206 |
| 378 | 3300049682 | Ga0501252_004844 | Ga0501252_004844_55_690 | 206 |
| 379 | 3300049705 | Ga0501225_0014773 | Ga0501225_0014773_1395_2030 | 206 |
| 380 | 3300049768 | Ga0501271_005002 | Ga0501271_005002_493_1128 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5djq-assembly4.cif.gz_L | the structure of cbb3 cytochrome oxidase. | 0.6843 | 10 | 201 |
| 8snh-assembly1.cif.gz_F | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.6725 | 7 | 201 |
| 5djq-assembly4.cif.gz_L | the structure of cbb3 cytochrome oxidase. | 0.6649 | 10 | 201 |
| 6xkw-assembly1.cif.gz_o | r. capsulatus ciii2civ bipartite super-complex (sc-2a) with ccoh/cy | 0.6605 | 10 | 201 |
| 8snh-assembly1.cif.gz_F | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.6537 | 7 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mk7E02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7789 | 44 | 201 | 1.10.760.10 |
| 3mk7E02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7564 | 44 | 201 | 1.10.760.10 |
| 2oz1D00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.5364 | 44 | 198 | 1.10.760.10 |
| 2yevE02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.4915 | 47 | 203 | 2.60.40.420 |
| af_A0A1D6KZL1_41_285_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.4904 | 151 | 200 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3P7K5-F1-model_v4 | deleted | 0.983 | 118 | 201 |
|
| AF-A0A1H7CUC5-F1-model_v4 | Cytochrome c oxidase cbb3-type subunit 2 | 0.9712 | 116 | 200 |
GO:0009055
GO:0020037 |
| AF-A0A7C1TLI8-F1-model_v4 | Cytochrome-c oxidase, cbb3-type subunit II | 0.9701 | 127 | 203 |
GO:0009055
GO:0020037 |
| AF-A0A356HDG4-F1-model_v4 | deleted | 0.9627 | 122 | 199 |
|
| AF-A0A090SH65-F1-model_v4 | deleted | 0.9566 | 140 | 200 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar