F428527

General Info

Members Datasets Scaffolds Average Seq Length
380 257 368 205

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000470|JGI25162J39368_100047014
Length 224
Sequence MLLMRVPEGTDMSQTHAKLEKNIGLMAILVAVAVSFGGLAEIVPLMFQAETIKPLPGIKPYPALELAGRDVYVREGCYNCHSQMVRTLRFETERYGHYSLAGESVYDHPFQWGSKRTGPDLARVGLRGYSDDWHRAHLHNPRDVVPESNMPAYPWLADNQLDGAEVAQHMRALKRIGDPYSEADIEGAAKAVEGKTELDAVIAYLQGLGTHVSQTDLQAAEGVE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
4 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
5 2739367700 Dyella sp. YR388 Isolate Unclassified
6 2884411467 Dyella sp. AD56 Isolate Rhizosphere
7 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
8 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
9 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
10 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
11 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
12 2928963466 Dyella japonica 1073 Isolate Unclassified
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
93 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
175 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
176 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
183 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
184 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
240 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
241 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.84
Metatranscriptomes 0
Isolates 3.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.26
Nodule 0
Rhizoplane 3.95
Rhizosphere 79.74
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2377386 2162886007 Bacteria 918
2 JGI24739J22299_10014635 3300001989 Bacteria 2851
3 JGI24735J21928_10000458 3300002067 Bacteria 14366
4 JGI25162J39368_1000470 3300002737 Bacteria 31129
5 JGI25162J39368_1001981 3300002737 Bacteria 9175
6 JGI25157J39369_1000585 3300002741 Bacteria 21521
7 JGI25157J39369_1001417 3300002741 Bacteria 9136
8 JGI25163J39215_1000551 3300002771 Bacteria 10874
9 JGI25164J39214_1000075 3300002772 Bacteria 97713
10 JGI25151J46595_10043215 3300003187 Bacteria 1615
11 JGI25165J46597_1000178 3300003214 Bacteria 97713
12 Ga0055538_1003074 3300003751 Bacteria 2203
13 Ga0055533_1003461 3300003756 Bacteria 3162
14 Ga0055535_1000144 3300003761 Bacteria 75043
15 Ga0055542_1000213 3300003762 Bacteria 70811
16 Ga0055542_1000594 3300003762 Bacteria 31129
17 Ga0055529_1000153 3300003763 Bacteria 97713
18 Ga0055526_1012727 3300003771 Bacteria 3638
19 Ga0055536_1008655 3300003781 Bacteria 4333
20 Ga0065704_10071131 3300005289 Bacteria 12938
21 Ga0065704_10099761 3300005289 Bacteria 2298
22 Ga0065715_10045182 3300005293 Bacteria 1564
23 Ga0070658_10085761 3300005327 Bacteria 2590
24 Ga0070676_10006852 3300005328 Bacteria 6102
25 Ga0070670_100094968 3300005331 Bacteria 2564
26 Ga0070666_10020164 3300005335 Bacteria 4308
27 Ga0070666_10031365 3300005335 Bacteria 3508
28 Ga0070666_10116460 3300005335 Bacteria 1851
29 Ga0068868_100198851 3300005338 Bacteria 1670
30 Ga0068868_100291875 3300005338 Bacteria 1383
31 Ga0070689_100016568 3300005340 Bacteria 5395
32 Ga0070661_100378938 3300005344 Bacteria 1115
33 Ga0070661_100470019 3300005344 Bacteria 1003
34 Ga0070668_100118478 3300005347 Bacteria 2114
35 Ga0070668_100405678 3300005347 Bacteria 1164
36 Ga0070675_100096928 3300005354 Bacteria 2479
37 Ga0070671_100160002 3300005355 Bacteria 1903
38 Ga0070674_100159014 3300005356 Bacteria 1712
39 Ga0070674_100718263 3300005356 Bacteria 856
40 Ga0070667_100010104 3300005367 Bacteria 7808
41 Ga0070667_100087529 3300005367 Bacteria 2673
42 Ga0070667_100270111 3300005367 Bacteria 1524
43 Ga0070714_100018328 3300005435 Bacteria 5685
44 Ga0070713_100000918 3300005436 Bacteria 18806
45 Ga0070711_100080773 3300005439 Bacteria 2316
46 Ga0070711_100084602 3300005439 Bacteria 2269
47 Ga0070663_100015214 3300005455 Bacteria 4959
48 Ga0070663_100233814 3300005455 Bacteria 1448
49 Ga0070662_100040689 3300005457 Bacteria 3311
50 Ga0070662_100680817 3300005457 Bacteria 869
51 Ga0068867_100100529 3300005459 Bacteria 2208
52 Ga0068867_100229226 3300005459 Bacteria 1501
53 Ga0068867_100683637 3300005459 Bacteria 904
54 Ga0070685_10070461 3300005466 Bacteria 2070
55 Ga0068853_100324667 3300005539 Bacteria 1427
56 Ga0070672_100256636 3300005543 Bacteria 1473
57 Ga0070693_100005200 3300005547 Bacteria 6228
58 Ga0070665_100000469 3300005548 Bacteria 58193
59 Ga0070665_100176040 3300005548 Bacteria 2140
60 Ga0070665_100702055 3300005548 Bacteria 1025
61 Ga0068855_100356046 3300005563 Bacteria 1611
62 Ga0070664_100106619 3300005564 Bacteria 2441
63 Ga0068856_100989395 3300005614 Bacteria 859
64 Ga0068856_101556766 3300005614 Bacteria 674
65 Ga0068852_100023333 3300005616 Bacteria 4978
66 Ga0068852_100253984 3300005616 Bacteria 1685
67 Ga0068859_100313294 3300005617 Bacteria 1663
68 Ga0068864_100399561 3300005618 Bacteria 1306
69 Ga0068864_100802452 3300005618 Bacteria 925
70 Ga0068861_100042796 3300005719 Bacteria 3396
71 Ga0068861_100320377 3300005719 Bacteria 1350
72 Ga0068851_10011672 3300005834 Bacteria 4124
73 Ga0068851_10019177 3300005834 Bacteria 3303
74 Ga0068863_100838011 3300005841 Bacteria 918
75 Ga0068858_100000797 3300005842 Bacteria 32972
76 Ga0068858_100367256 3300005842 Bacteria 1380
77 Ga0068860_101087774 3300005843 Bacteria 819
78 Ga0068862_100151167 3300005844 Bacteria 2067
79 Ga0075364_10000769 3300006051 Bacteria 16847
80 Ga0070712_100150602 3300006175 Bacteria 1786
81 Ga0097621_100150784 3300006237 Bacteria 1994
82 Ga0097621_100155830 3300006237 Bacteria 1960
83 Ga0068871_100008412 3300006358 Bacteria 7421
84 Ga0068871_100095942 3300006358 Bacteria 2477
85 Ga0075428_100588341 3300006844 Bacteria 1189
86 Ga0075430_100243043 3300006846 Bacteria 1492
87 Ga0075429_100235487 3300006880 Bacteria 1604
88 Ga0068865_100001018 3300006881 Bacteria 16121
89 Ga0068865_100044710 3300006881 Bacteria 3032
90 Ga0068865_100154423 3300006881 Bacteria 1744
91 Ga0097620_100313284 3300006931 Bacteria 1663
92 Ga0105250_10165904 3300009092 Bacteria 923
93 Ga0105240_10018953 3300009093 Bacteria 9214
94 Ga0114129_10702534 3300009147 Bacteria 1299
95 Ga0105242_10050594 3300009176 Bacteria 3383
96 Ga0105242_10429185 3300009176 Bacteria 1240
97 Ga0105237_10327528 3300009545 Bacteria 1536
98 Ga0105238_10038862 3300009551 Bacteria 4832
99 Ga0105238_10043722 3300009551 Bacteria 4532
100 Ga0105238_10062658 3300009551 Bacteria 3719
101 Ga0105239_10013435 3300010375 Bacteria 9097
102 Ga0105239_10295740 3300010375 Bacteria 1823
103 Ga0105239_10430420 3300010375 Bacteria 1496
104 Ga0105239_10846974 3300010375 Bacteria 1048
105 Ga0105246_10108046 3300011119 Bacteria 2039
106 Ga0157370_10314476 3300013104 Bacteria 1445
107 Ga0157369_10083411 3300013105 Bacteria 3418
108 Ga0157369_10414176 3300013105 Bacteria 1397
109 Ga0157369_10515516 3300013105 Bacteria 1237
110 Ga0157374_10091172 3300013296 Bacteria 2906
111 Ga0157378_10569865 3300013297 Bacteria 1140
112 Ga0163162_10104785 3300013306 Bacteria 2923
113 Ga0157372_10004902 3300013307 Bacteria 14227
114 Ga0157372_10216759 3300013307 Bacteria 2218
115 Ga0157372_10284370 3300013307 Bacteria 1923
116 Ga0157375_10271814 3300013308 Bacteria 1857
117 Ga0157380_10342708 3300014326 Bacteria 1395
118 Ga0157380_10371318 3300014326 Bacteria 1346
119 Ga0157379_10353455 3300014968 Bacteria 1346
120 Ga0157379_11299647 3300014968 Bacteria 702
121 Ga0157376_10062349 3300014969 Bacteria 3137
122 Ga0157376_10079140 3300014969 Bacteria 2817
123 Ga0157376_10158092 3300014969 Bacteria 2052
124 Ga0157376_10342276 3300014969 Bacteria 1429
125 Ga0183368_1003 3300015687 Bacteria 1276390
126 Ga0209760_100219 3300025207 Bacteria 25038
127 Ga0209784_100104 3300025224 Bacteria 98272
128 Ga0209674_100033 3300025226 Bacteria 423450
129 Ga0209674_101242 3300025226 Bacteria 7215
130 Ga0209672_100759 3300025228 Bacteria 15556
131 Ga0209672_109176 3300025228 Bacteria 1413
132 Ga0207427_100070 3300025231 Bacteria 160908
133 Ga0209437_100059 3300025233 Bacteria 355048
134 Ga0209437_100214 3300025233 Bacteria 107034
135 Ga0209258_100034 3300025242 Bacteria 437372
136 Ga0209258_100858 3300025242 Bacteria 16181
137 Ga0209258_102669 3300025242 Bacteria 4398
138 Ga0209646_1000879 3300025246 Bacteria 9964
139 Ga0209646_1004944 3300025246 Bacteria 2379
140 Ga0209026_1000017 3300025250 Bacteria 385214
141 Ga0209026_1000176 3300025250 Bacteria 97745
142 Ga0209148_1000001 3300025254 Bacteria 2545271
143 Ga0209148_1000002 3300025254 Bacteria 2399500
144 Ga0209759_1000581 3300025256 Bacteria 35995
145 Ga0209759_1006107 3300025256 Bacteria 4101
146 Ga0209233_1000002 3300025261 Bacteria 2501366
147 Ga0209233_1009776 3300025261 Bacteria 2904
148 Ga0209455_1000019 3300025272 Bacteria 705658
149 Ga0209455_1003352 3300025272 Bacteria 5722
150 Ga0209673_1016419 3300025273 Bacteria 2770
151 Ga0209676_1000063 3300025292 Bacteria 322025
152 Ga0207680_10000780 3300025903 Bacteria 15064
153 Ga0207680_10009306 3300025903 Bacteria 4868
154 Ga0207647_10003302 3300025904 Bacteria 12119
155 Ga0207695_10062111 3300025913 Bacteria 3859
156 Ga0207671_10028449 3300025914 Bacteria 4176
157 Ga0207671_10157421 3300025914 Bacteria 1758
158 Ga0207671_10247821 3300025914 Bacteria 1400
159 Ga0207671_10507584 3300025914 Bacteria 961
160 Ga0207693_10056699 3300025915 Bacteria 3071
161 Ga0207693_10529351 3300025915 Bacteria 919
162 Ga0207663_10119339 3300025916 Bacteria 1803
163 Ga0207662_10291270 3300025918 Bacteria 1083
164 Ga0207649_10020581 3300025920 Bacteria 3785
165 Ga0207649_10038031 3300025920 Bacteria 2911
166 Ga0207649_10144890 3300025920 Bacteria 1629
167 Ga0207681_10458477 3300025923 Bacteria 1038
168 Ga0207694_10001234 3300025924 Bacteria 22148
169 Ga0207694_10020682 3300025924 Bacteria 4982
170 Ga0207694_10182954 3300025924 Bacteria 1700
171 Ga0207650_10026663 3300025925 Bacteria 4125
172 Ga0207700_10001904 3300025928 Bacteria 11863
173 Ga0207664_10062212 3300025929 Bacteria 2980
174 Ga0207644_10058862 3300025931 Bacteria 2777
175 Ga0207644_10283601 3300025931 Bacteria 1330
176 Ga0207644_10315740 3300025931 Bacteria 1262
177 Ga0207706_10031331 3300025933 Bacteria 4738
178 Ga0207706_10751433 3300025933 Bacteria 831
179 Ga0207686_10051966 3300025934 Bacteria 2555
180 Ga0207686_10403661 3300025934 Bacteria 1042
181 Ga0207670_10010231 3300025936 Bacteria 5395
182 Ga0207669_10445216 3300025937 Bacteria 1025
183 Ga0207704_10011862 3300025938 Bacteria 4308
184 Ga0207704_10537852 3300025938 Bacteria 947
185 Ga0207691_10016420 3300025940 Bacteria 7028
186 Ga0207711_10420295 3300025941 Bacteria 1243
187 Ga0207689_10145203 3300025942 Bacteria 1955
188 Ga0207661_10170636 3300025944 Bacteria 1894
189 Ga0207679_10148045 3300025945 Bacteria 1907
190 Ga0207667_10059416 3300025949 Bacteria 4004
191 Ga0207667_10540373 3300025949 Bacteria 1179
192 Ga0207651_10122047 3300025960 Bacteria 1978
193 Ga0207712_10000390 3300025961 Bacteria 38119
194 Ga0207668_10164767 3300025972 Bacteria 1731
195 Ga0207668_10242401 3300025972 Bacteria 1459
196 Ga0207658_10012464 3300025986 Bacteria 5808
197 Ga0207658_10217478 3300025986 Bacteria 1605
198 Ga0207658_10294134 3300025986 Bacteria 1397
199 Ga0207658_10332695 3300025986 Bacteria 1318
200 Ga0207658_10683837 3300025986 Bacteria 926
201 Ga0207658_10785777 3300025986 Bacteria 864
202 Ga0207703_10000536 3300026035 Bacteria 39195
203 Ga0207703_10350992 3300026035 Bacteria 1358
204 Ga0207639_10057822 3300026041 Bacteria 2980
205 Ga0207639_10093611 3300026041 Bacteria 2410
206 Ga0207678_10002378 3300026067 Bacteria 17075
207 Ga0207678_10015234 3300026067 Bacteria 6765
208 Ga0207678_10358885 3300026067 Bacteria 1257
209 Ga0207702_10673317 3300026078 Bacteria 1018
210 Ga0207641_10251184 3300026088 Bacteria 1652
211 Ga0207648_10049354 3300026089 Bacteria 3682
212 Ga0207648_10053647 3300026089 Bacteria 3523
213 Ga0207648_10153246 3300026089 Bacteria 2034
214 Ga0207676_10301986 3300026095 Bacteria 1462
215 Ga0207675_100020520 3300026118 Bacteria 6159
216 Ga0207683_10004840 3300026121 Bacteria 11594
217 Ga0207683_10018561 3300026121 Bacteria 5936
218 Ga0209969_1001749 3300027360 Bacteria 2995
219 Ga0209995_1020127 3300027471 Bacteria 1103
220 Ga0209982_1007562 3300027552 Bacteria 1588
221 Ga0268266_10000007 3300028379 Bacteria 1372921
222 Ga0268264_10058349 3300028381 Bacteria 3232
223 Ga0268264_10293409 3300028381 Bacteria 1528
224 Ga0268264_10340797 3300028381 Bacteria 1424
225 Ga0268264_10971368 3300028381 Bacteria 855
226 Ga0307515_10048284 3300028794 Bacteria 6440
227 Ga0265338_10431864 3300028800 Bacteria 935
228 Ga0314311_1137376 3300030733 Bacteria 1385
229 Ga0307508_10221720 3300031616 Bacteria 1491
230 Ga0316575_10013864 3300031665 Bacteria 3017
231 Ga0316576_10024953 3300031727 Bacteria 4181
232 Ga0316576_10062282 3300031727 Bacteria 2736
233 Ga0307413_10130284 3300031824 Bacteria 1720
234 Ga0307413_10172562 3300031824 Bacteria 1532
235 Ga0307410_10079523 3300031852 Bacteria 2298
236 Ga0307407_10702053 3300031903 Bacteria 762
237 Ga0307412_10212033 3300031911 Bacteria 1479
238 Ga0307412_10754439 3300031911 Bacteria 840
239 Ga0307416_100078567 3300032002 Bacteria 2777
240 Ga0307416_100942341 3300032002 Bacteria 965
241 Ga0307414_10001626 3300032004 Bacteria 11693
242 Ga0307414_10004708 3300032004 Bacteria 7445
243 Ga0307414_10045003 3300032004 Bacteria 3019
244 Ga0307414_10051007 3300032004 Bacteria 2869
245 Ga0307414_10056897 3300032004 Bacteria 2746
246 Ga0307414_10304278 3300032004 Bacteria 1350
247 Ga0307411_10055234 3300032005 Bacteria 2612
248 Ga0373959_0069515 3300034820 Bacteria 793
249 Ga0373955_0170902 3300035172 Bacteria 1286
250 Ga0316574_0009877 3300035398 Bacteria 5366
251 Ga0373933_0401992 3300035724 Bacteria 893
252 Ga0373937_0026049 3300036401 Bacteria 5283
253 Ga0373937_0198291 3300036401 Bacteria 1887
254 Ga0395900_0645189 3300037418 Bacteria 996
255 Ga0395905_0269843 3300037471 Bacteria 1587
256 Ga0395905_0391263 3300037471 Bacteria 1285
257 Ga0439436_0035284 3300041404 Bacteria 1445
258 Ga0439436_0042165 3300041404 Bacteria 1305
259 Ga0439439_0101428 3300041406 Bacteria 792
260 Ga0439465_0006794 3300041413 Bacteria 3635
261 Ga0439465_0011245 3300041413 Bacteria 2810
262 Ga0451797_1386712 3300041453 Bacteria 1770
263 Ga0451837_0154854 3300041494 Bacteria 4997
264 Ga0451843_0069898 3300041509 Bacteria 934
265 Ga0451843_0281983 3300041509 Bacteria 1147
266 Ga0439431_0138647 3300041997 Bacteria 686
267 Ga0439448_0062161 3300042005 Bacteria 1235
268 Ga0439449_0017697 3300042007 Bacteria 2676
269 Ga0439452_028913 3300042010 Bacteria 1379
270 Ga0439462_0066145 3300042015 Bacteria 980
271 Ga0450898_048276 3300042134 Bacteria 818
272 Ga0450899_005502 3300042135 Bacteria 1363
273 Ga0450905_007896 3300042142 Bacteria 1454
274 Ga0439458_0063550 3300042157 Bacteria 925
275 Ga0451577_0121488 3300042876 Bacteria 2340
276 Ga0451577_0298352 3300042876 Bacteria 1460
277 Ga0453684_0000159 3300044712 Bacteria 300297
278 Ga0451576_0000120 3300045051 Bacteria 199365
279 Ga0466967_0183488 3300045976 Bacteria 1975
280 Ga0495638_0000152 3300046460 Bacteria 109586
281 Ga0495638_0000378 3300046460 Bacteria 55320
282 Ga0495650_0000112 3300046471 Bacteria 197339
283 Ga0495664_0328994 3300046477 Bacteria 921
284 Ga0495606_0001622 3300046507 Bacteria 29369
285 Ga0495618_0273185 3300046514 Bacteria 1056
286 Ga0495630_0285616 3300046517 Bacteria 1261
287 Ga0495587_0191147 3300046536 Bacteria 1159
288 Ga0495598_0107317 3300046537 Bacteria 931
289 Ga0495621_0246166 3300046539 Bacteria 729
290 Ga0495622_0002547 3300046557 Bacteria 8806
291 Ga0495656_0006378 3300046615 Bacteria 4137
292 Ga0495656_0032075 3300046615 Bacteria 2135
293 Ga0495656_0140638 3300046615 Bacteria 1157
294 Ga0495625_0016670 3300046660 Bacteria 5773
295 Ga0495659_0068754 3300046664 Bacteria 1323
296 Ga0495657_0131694 3300046675 Bacteria 1566
297 Ga0495670_0141528 3300046691 Bacteria 1258
298 Ga0495649_0001164 3300046694 Bacteria 20425
299 Ga0495636_0001496 3300047318 Bacteria 8857
300 Ga0495636_0004599 3300047318 Bacteria 5408
301 Ga0495636_0030994 3300047318 Bacteria 2190
302 Ga0495636_0050217 3300047318 Bacteria 1745
303 Ga0495684_0162372 3300047471 Bacteria 1666
304 Ga0496100_0251246 3300048903 Bacteria 1308
305 Ga0496101_0213588 3300048904 Bacteria 1495
306 Ga0496106_0534394 3300048909 Bacteria 941
307 Ga0496109_0035762 3300048912 Bacteria 4483
308 Ga0496110_0211899 3300048913 Bacteria 1761
309 Ga0496112_0597498 3300048915 Bacteria 1035
310 Ga0496113_0002905 3300048916 Bacteria 10101
311 Ga0496113_0021691 3300048916 Bacteria 4533
312 Ga0496114_0005982 3300048917 Bacteria 9577
313 Ga0496114_0380767 3300048917 Bacteria 1249
314 Ga0496115_0000008 3300048918 Bacteria 237485
315 Ga0496115_0005931 3300048918 Bacteria 8914
316 Ga0496115_0013455 3300048918 Bacteria 6190
317 Ga0496115_0322743 3300048918 Bacteria 1263
318 Ga0496125_0133667 3300048928 Bacteria 1740
319 Ga0496126_0006571 3300048929 Bacteria 12952
320 Ga0496126_0023762 3300048929 Bacteria 5935
321 Ga0496126_0029021 3300048929 Bacteria 5260
322 Ga0496126_0083326 3300048929 Bacteria 2822
323 Ga0495678_014368 3300049459 Bacteria 3683
324 Ga0495682_0154028 3300049460 Bacteria 819
325 Ga0501299_003824 3300049522 Bacteria 2208
326 Ga0501032_0015623 3300049569 Bacteria 5353
327 Ga0501033_0032227 3300049570 Bacteria 3935
328 Ga0501034_0000275 3300049571 Bacteria 92805
329 Ga0501034_0010873 3300049571 Bacteria 9453
330 Ga0501034_0523238 3300049571 Bacteria 1098
331 Ga0501036_0074264 3300049572 Bacteria 2875
332 Ga0501037_0045703 3300049573 Bacteria 3213
333 Ga0501040_0076238 3300049576 Bacteria 2318
334 Ga0501043_0000694 3300049579 Bacteria 29789
335 Ga0501043_0106107 3300049579 Bacteria 2206
336 Ga0501046_0039140 3300049580 Bacteria 3799
337 Ga0501047_0384725 3300049581 Bacteria 1237
338 Ga0501047_0495216 3300049581 Bacteria 1049
339 Ga0501048_0177524 3300049582 Bacteria 1509
340 Ga0501067_0011911 3300049583 Bacteria 4818
341 Ga0501068_0222967 3300049584 Bacteria 1198
342 Ga0501069_0038030 3300049585 Bacteria 2655
343 Ga0501070_0103813 3300049586 Bacteria 2350
344 Ga0501071_0007818 3300049587 Bacteria 7051
345 Ga0501073_0121514 3300049589 Bacteria 1810
346 Ga0501074_0007488 3300049590 Bacteria 7897
347 Ga0501249_006351 3300049679 Bacteria 2429
348 Ga0501252_004844 3300049682 Bacteria 1446
349 Ga0501257_085411 3300049686 Bacteria 817
350 Ga0501225_0014773 3300049705 Bacteria 2178
351 Ga0501225_0053339 3300049705 Bacteria 1128
352 Ga0501079_0112148 3300049741 Bacteria 2119
353 Ga0501080_0066411 3300049742 Bacteria 3354
354 Ga0501080_0394761 3300049742 Bacteria 1245
355 Ga0501080_0456848 3300049742 Bacteria 1144
356 Ga0501083_0083684 3300049744 Bacteria 2113
357 Ga0501271_005002 3300049768 Bacteria 1278
358 Ga0501035_0011489 3300049822 Bacteria 8205
359 Ga0501035_0556431 3300049822 Bacteria 939
360 Ga0501045_0085611 3300049824 Bacteria 2326
361 Ga0501226_005248 3300049853 Bacteria 1481
362 nmdc:mga00v17_25_c1 3300050491 Bacteria 101679
363 nmdc:mga09592_382982_c1 3300050508 Bacteria 1216
364 nmdc:mga0qj67_735599_c1 3300050509 Bacteria 783
365 Ga0500651_0055225 3300053093 Bacteria 2488
366 Ga0500568_0006939 3300053139 Bacteria 5617
367 Ga0500620_104601 3300053155 Bacteria 990
368 Ga0501084_0013044 3300054114 Bacteria 6878

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0556431 Ga0501035_0556431_25_534 169
2 3300005331 Ga0070670_100094968 Ga0070670_1000949683 179
3 3300005335 Ga0070666_10031365 Ga0070666_100313655 179
4 3300005338 Ga0068868_100198851 Ga0068868_1001988513 179
5 3300005344 Ga0070661_100470019 Ga0070661_1004700192 179
6 3300005367 Ga0070667_100087529 Ga0070667_1000875294 179
7 3300005455 Ga0070663_100233814 Ga0070663_1002338142 179
8 3300005457 Ga0070662_100040689 Ga0070662_1000406894 179
9 3300005548 Ga0070665_100000469 Ga0070665_1000004698 179
10 3300005563 Ga0068855_100356046 Ga0068855_1003560462 179
11 3300005614 Ga0068856_100989395 Ga0068856_1009893952 179
12 3300005614 Ga0068856_101556766 Ga0068856_1015567661 179
13 3300005616 Ga0068852_100253984 Ga0068852_1002539842 179
14 3300005834 Ga0068851_10019177 Ga0068851_100191774 179
15 3300005842 Ga0068858_100000797 Ga0068858_10000079726 179
16 3300006881 Ga0068865_100044710 Ga0068865_1000447102 179
17 3300009093 Ga0105240_10018953 Ga0105240_1001895311 179
18 3300009545 Ga0105237_10327528 Ga0105237_103275283 179
19 3300009551 Ga0105238_10038862 Ga0105238_100388623 179
20 3300010375 Ga0105239_10846974 Ga0105239_108469742 179
21 3300013105 Ga0157369_10083411 Ga0157369_100834115 179
22 3300013307 Ga0157372_10216759 Ga0157372_102167592 179
23 3300014969 Ga0157376_10342276 Ga0157376_103422762 179
24 3300025903 Ga0207680_10000780 Ga0207680_1000078011 179
25 3300025913 Ga0207695_10062111 Ga0207695_100621113 179
26 3300025914 Ga0207671_10028449 Ga0207671_100284495 179
27 3300025920 Ga0207649_10144890 Ga0207649_101448902 179
28 3300025924 Ga0207694_10001234 Ga0207694_100012343 179
29 3300025925 Ga0207650_10026663 Ga0207650_100266634 179
30 3300025931 Ga0207644_10283601 Ga0207644_102836013 179
31 3300025933 Ga0207706_10031331 Ga0207706_100313315 179
32 3300025934 Ga0207686_10403661 Ga0207686_104036612 179
33 3300025949 Ga0207667_10059416 Ga0207667_100594162 179
34 3300025961 Ga0207712_10000390 Ga0207712_1000039012 179
35 3300025986 Ga0207658_10012464 Ga0207658_100124646 179
36 3300025986 Ga0207658_10217478 Ga0207658_102174783 179
37 3300026035 Ga0207703_10000536 Ga0207703_1000053615 179
38 3300026041 Ga0207639_10057822 Ga0207639_100578224 179
39 3300026067 Ga0207678_10002378 Ga0207678_1000237811 179
40 3300026089 Ga0207648_10153246 Ga0207648_101532463 179
41 3300028379 Ga0268266_10000007 Ga0268266_10000007844 179
42 3300014968 Ga0157379_10353455 Ga0157379_103534552 180
43 3300036401 Ga0373937_0198291 Ga0373937_0198291_65_670 187
44 3300014968 Ga0157379_11299647 Ga0157379_112996471 190
45 3300025273 Ga0209673_1016419 Ga0209673_10164193 190
46 3300041997 Ga0439431_0138647 Ga0439431_0138647_14_586 190
47 3300050509 nmdc:mga0qj67_735599_c1 nmdc:mga0qj67_735599_c1_145_750 190
48 3300049742 Ga0501080_0394761 Ga0501080_0394761_341_958 193
49 3300031727 Ga0316576_10062282 Ga0316576_100622822 195
50 3300035398 Ga0316574_0009877 Ga0316574_0009877_4436_5047 195
51 3300049522 Ga0501299_003824 Ga0501299_003824_240_833 195
52 iso_pu_bacteria 2739367700 2739732565 200
53 iso_pu_bacteria 2884411467 2884412670 200
54 iso_pu_bacteria 2928963466 2928965297 200
55 3300005328 Ga0070676_10006852 Ga0070676_100068522 201
56 3300005335 Ga0070666_10020164 Ga0070666_100201643 201
57 3300005347 Ga0070668_100118478 Ga0070668_1001184782 201
58 3300005347 Ga0070668_100405678 Ga0070668_1004056782 201
59 3300005367 Ga0070667_100010104 Ga0070667_1000101049 201
60 3300005367 Ga0070667_100270111 Ga0070667_1002701111 201
61 3300005439 Ga0070711_100084602 Ga0070711_1000846022 201
62 3300005459 Ga0068867_100683637 Ga0068867_1006836372 201
63 3300005539 Ga0068853_100324667 Ga0068853_1003246673 201
64 3300005547 Ga0070693_100005200 Ga0070693_1000052007 201
65 3300005548 Ga0070665_100176040 Ga0070665_1001760403 201
66 3300005616 Ga0068852_100023333 Ga0068852_1000233332 201
67 3300005719 Ga0068861_100042796 Ga0068861_1000427962 201
68 3300005834 Ga0068851_10011672 Ga0068851_100116723 201
69 3300005841 Ga0068863_100838011 Ga0068863_1008380111 201
70 3300005843 Ga0068860_101087774 Ga0068860_1010877741 201
71 3300006237 Ga0097621_100155830 Ga0097621_1001558302 201
72 3300006358 Ga0068871_100008412 Ga0068871_1000084129 201
73 3300006358 Ga0068871_100095942 Ga0068871_1000959422 201
74 3300006881 Ga0068865_100154423 Ga0068865_1001544232 201
75 3300009551 Ga0105238_10043722 Ga0105238_100437227 201
76 3300010375 Ga0105239_10295740 Ga0105239_102957403 201
77 3300011119 Ga0105246_10108046 Ga0105246_101080463 201
78 3300013104 Ga0157370_10314476 Ga0157370_103144761 201
79 3300013105 Ga0157369_10414176 Ga0157369_104141762 201
80 3300013296 Ga0157374_10091172 Ga0157374_100911724 201
81 3300013297 Ga0157378_10569865 Ga0157378_105698653 201
82 3300013307 Ga0157372_10004902 Ga0157372_1000490211 201
83 3300013307 Ga0157372_10284370 Ga0157372_102843703 201
84 3300014969 Ga0157376_10079140 Ga0157376_100791402 201
85 3300014969 Ga0157376_10158092 Ga0157376_101580923 201
86 3300025914 Ga0207671_10157421 Ga0207671_101574212 201
87 3300025914 Ga0207671_10507584 Ga0207671_105075842 201
88 3300025915 Ga0207693_10529351 Ga0207693_105293512 201
89 3300025920 Ga0207649_10020581 Ga0207649_100205814 201
90 3300025931 Ga0207644_10315740 Ga0207644_103157401 201
91 3300025938 Ga0207704_10011862 Ga0207704_100118623 201
92 3300025938 Ga0207704_10537852 Ga0207704_105378521 201
93 3300025941 Ga0207711_10420295 Ga0207711_104202952 201
94 3300025942 Ga0207689_10145203 Ga0207689_101452032 201
95 3300025945 Ga0207679_10148045 Ga0207679_101480452 201
96 3300025949 Ga0207667_10540373 Ga0207667_105403733 201
97 3300025960 Ga0207651_10122047 Ga0207651_101220472 201
98 3300025972 Ga0207668_10164767 Ga0207668_101647673 201
99 3300025972 Ga0207668_10242401 Ga0207668_102424012 201
100 3300025986 Ga0207658_10332695 Ga0207658_103326952 201
101 3300026041 Ga0207639_10093611 Ga0207639_100936113 201
102 3300026078 Ga0207702_10673317 Ga0207702_106733173 201
103 3300026088 Ga0207641_10251184 Ga0207641_102511843 201
104 3300026118 Ga0207675_100020520 Ga0207675_1000205207 201
105 3300028381 Ga0268264_10293409 Ga0268264_102934092 201
106 3300028381 Ga0268264_10971368 Ga0268264_109713682 201
107 3300031616 Ga0307508_10221720 Ga0307508_102217202 201
108 3300031727 Ga0316576_10024953 Ga0316576_100249536 201
109 3300034820 Ga0373959_0069515 Ga0373959_0069515_96_701 201
110 3300042005 Ga0439448_0062161 Ga0439448_0062161_416_1021 201
111 3300042876 Ga0451577_0121488 Ga0451577_0121488_1533_2150 201
112 3300042876 Ga0451577_0298352 Ga0451577_0298352_658_1263 201
113 3300046517 Ga0495630_0285616 Ga0495630_0285616_254_859 201
114 3300046539 Ga0495621_0246166 Ga0495621_0246166_103_708 201
115 3300048916 Ga0496113_0002905 Ga0496113_0002905_9340_9972 201
116 3300048918 Ga0496115_0013455 Ga0496115_0013455_5440_6045 201
117 3300049569 Ga0501032_0015623 Ga0501032_0015623_1423_2028 201
118 3300049570 Ga0501033_0032227 Ga0501033_0032227_2240_2845 201
119 3300049571 Ga0501034_0010873 Ga0501034_0010873_5615_6220 201
120 3300049571 Ga0501034_0523238 Ga0501034_0523238_214_819 201
121 3300049572 Ga0501036_0074264 Ga0501036_0074264_2051_2656 201
122 3300049573 Ga0501037_0045703 Ga0501037_0045703_1081_1686 201
123 3300049576 Ga0501040_0076238 Ga0501040_0076238_1134_1739 201
124 3300049579 Ga0501043_0106107 Ga0501043_0106107_179_784 201
125 3300049580 Ga0501046_0039140 Ga0501046_0039140_453_1058 201
126 3300049581 Ga0501047_0495216 Ga0501047_0495216_29_634 201
127 3300049582 Ga0501048_0177524 Ga0501048_0177524_371_976 201
128 3300049583 Ga0501067_0011911 Ga0501067_0011911_1812_2417 201
129 3300049584 Ga0501068_0222967 Ga0501068_0222967_233_838 201
130 3300049585 Ga0501069_0038030 Ga0501069_0038030_482_1087 201
131 3300049586 Ga0501070_0103813 Ga0501070_0103813_1513_2118 201
132 3300049587 Ga0501071_0007818 Ga0501071_0007818_597_1202 201
133 3300049589 Ga0501073_0121514 Ga0501073_0121514_636_1241 201
134 3300049590 Ga0501074_0007488 Ga0501074_0007488_1228_1833 201
135 3300049741 Ga0501079_0112148 Ga0501079_0112148_1295_1900 201
136 3300049742 Ga0501080_0066411 Ga0501080_0066411_1942_2547 201
137 3300049742 Ga0501080_0456848 Ga0501080_0456848_361_966 201
138 3300049744 Ga0501083_0083684 Ga0501083_0083684_1276_1881 201
139 3300049822 Ga0501035_0011489 Ga0501035_0011489_2074_2679 201
140 3300049824 Ga0501045_0085611 Ga0501045_0085611_1091_1696 201
141 3300053093 Ga0500651_0055225 Ga0500651_0055225_1138_1743 201
142 3300053139 Ga0500568_0006939 Ga0500568_0006939_668_1273 201
143 3300053155 Ga0500620_104601 Ga0500620_104601_41_646 201
144 3300054114 Ga0501084_0013044 Ga0501084_0013044_174_779 201
145 3300005327 Ga0070658_10085761 Ga0070658_100857612 202
146 3300005335 Ga0070666_10116460 Ga0070666_101164603 202
147 3300005338 Ga0068868_100291875 Ga0068868_1002918752 202
148 3300005439 Ga0070711_100080773 Ga0070711_1000807732 202
149 3300005459 Ga0068867_100100529 Ga0068867_1001005295 202
150 3300005548 Ga0070665_100702055 Ga0070665_1007020553 202
151 3300005617 Ga0068859_100313294 Ga0068859_1003132942 202
152 3300005618 Ga0068864_100802452 Ga0068864_1008024521 202
153 3300005842 Ga0068858_100367256 Ga0068858_1003672561 202
154 3300006237 Ga0097621_100150784 Ga0097621_1001507842 202
155 3300006844 Ga0075428_100588341 Ga0075428_1005883413 202
156 3300006846 Ga0075430_100243043 Ga0075430_1002430432 202
157 3300006880 Ga0075429_100235487 Ga0075429_1002354872 202
158 3300006881 Ga0068865_100001018 Ga0068865_10000101812 202
159 3300006931 Ga0097620_100313284 Ga0097620_1003132842 202
160 3300009147 Ga0114129_10702534 Ga0114129_107025343 202
161 3300009176 Ga0105242_10050594 Ga0105242_100505945 202
162 3300025903 Ga0207680_10009306 Ga0207680_100093065 202
163 3300025914 Ga0207671_10247821 Ga0207671_102478212 202
164 3300025916 Ga0207663_10119339 Ga0207663_101193393 202
165 3300025924 Ga0207694_10020682 Ga0207694_100206822 202
166 3300025933 Ga0207706_10751433 Ga0207706_107514331 202
167 3300025934 Ga0207686_10051966 Ga0207686_100519663 202
168 3300025986 Ga0207658_10683837 Ga0207658_106838372 202
169 3300026035 Ga0207703_10350992 Ga0207703_103509922 202
170 3300026089 Ga0207648_10049354 Ga0207648_100493542 202
171 3300026095 Ga0207676_10301986 Ga0207676_103019862 202
172 3300026121 Ga0207683_10004840 Ga0207683_1000484012 202
173 3300031665 Ga0316575_10013864 Ga0316575_100138643 202
174 3300035172 Ga0373955_0170902 Ga0373955_0170902_247_861 202
175 3300035724 Ga0373933_0401992 Ga0373933_0401992_120_734 202
176 3300036401 Ga0373937_0026049 Ga0373937_0026049_977_1591 202
177 3300044712 Ga0453684_0000159 Ga0453684_0000159_64272_64880 202
178 3300045051 Ga0451576_0000120 Ga0451576_0000120_64272_64880 202
179 3300046477 Ga0495664_0328994 Ga0495664_0328994_141_755 202
180 3300046536 Ga0495587_0191147 Ga0495587_0191147_143_757 202
181 3300046675 Ga0495657_0131694 Ga0495657_0131694_681_1295 202
182 3300047471 Ga0495684_0162372 Ga0495684_0162372_903_1517 202
183 3300050508 nmdc:mga09592_382982_c1 nmdc:mga09592_382982_c1_340_948 202
184 iso_pu_bacteria 2643221581 2643914655 202
185 iso_pu_bacteria 2923516293 2923517083 202
186 3300003771 Ga0055526_1012727 Ga0055526_10127272 203
187 3300005354 Ga0070675_100096928 Ga0070675_1000969283 203
188 3300028381 Ga0268264_10340797 Ga0268264_103407973 203
189 3300046514 Ga0495618_0273185 Ga0495618_0273185_106_756 203
190 iso_pu_bacteria 2687453130 2687584446 203
191 iso_pu_bacteria 2895498888 2895499810 203
192 iso_pu_bacteria 2895511927 2895512785 203
193 iso_pu_bacteria 2895522137 2895522800 203
194 iso_pu_bacteria 2895525241 2895525426 203
195 3300001989 JGI24739J22299_10014635 JGI24739J22299_100146353 204
196 3300002067 JGI24735J21928_10000458 JGI24735J21928_1000045812 204
197 3300002737 JGI25162J39368_1000470 JGI25162J39368_100047014 204
198 3300002737 JGI25162J39368_1001981 JGI25162J39368_10019818 204
199 3300002741 JGI25157J39369_1000585 JGI25157J39369_100058510 204
200 3300002771 JGI25163J39215_1000551 JGI25163J39215_10005512 204
201 3300002772 JGI25164J39214_1000075 JGI25164J39214_100007516 204
202 3300003187 JGI25151J46595_10043215 JGI25151J46595_100432152 204
203 3300003214 JGI25165J46597_1000178 JGI25165J46597_100017876 204
204 3300003751 Ga0055538_1003074 Ga0055538_10030744 204
205 3300003756 Ga0055533_1003461 Ga0055533_10034615 204
206 3300003761 Ga0055535_1000144 Ga0055535_100014453 204
207 3300003762 Ga0055542_1000213 Ga0055542_100021310 204
208 3300003762 Ga0055542_1000594 Ga0055542_100059414 204
209 3300003763 Ga0055529_1000153 Ga0055529_100015376 204
210 3300005293 Ga0065715_10045182 Ga0065715_100451822 204
211 3300005340 Ga0070689_100016568 Ga0070689_1000165686 204
212 3300005356 Ga0070674_100718263 Ga0070674_1007182632 204
213 3300005455 Ga0070663_100015214 Ga0070663_1000152144 204
214 3300005466 Ga0070685_10070461 Ga0070685_100704613 204
215 3300005844 Ga0068862_100151167 Ga0068862_1001511672 204
216 3300009551 Ga0105238_10062658 Ga0105238_100626585 204
217 3300010375 Ga0105239_10430420 Ga0105239_104304203 204
218 3300013105 Ga0157369_10515516 Ga0157369_105155163 204
219 3300013306 Ga0163162_10104785 Ga0163162_101047853 204
220 3300014969 Ga0157376_10062349 Ga0157376_100623492 204
221 3300015687 Ga0183368_1003 Ga0183368_1003172 204
222 3300025207 Ga0209760_100219 Ga0209760_10021912 204
223 3300025224 Ga0209784_100104 Ga0209784_10010415 204
224 3300025226 Ga0209674_100033 Ga0209674_100033185 204
225 3300025228 Ga0209672_100759 Ga0209672_1007599 204
226 3300025228 Ga0209672_109176 Ga0209672_1091763 204
227 3300025231 Ga0207427_100070 Ga0207427_10007072 204
228 3300025233 Ga0209437_100059 Ga0209437_100059130 204
229 3300025233 Ga0209437_100214 Ga0209437_10021490 204
230 3300025242 Ga0209258_100034 Ga0209258_10003417 204
231 3300025242 Ga0209258_100858 Ga0209258_1008587 204
232 3300025242 Ga0209258_102669 Ga0209258_1026694 204
233 3300025246 Ga0209646_1000879 Ga0209646_10008795 204
234 3300025246 Ga0209646_1004944 Ga0209646_10049443 204
235 3300025250 Ga0209026_1000176 Ga0209026_100017672 204
236 3300025254 Ga0209148_1000001 Ga0209148_1000001687 204
237 3300025254 Ga0209148_1000002 Ga0209148_1000002786 204
238 3300025256 Ga0209759_1000581 Ga0209759_100058115 204
239 3300025256 Ga0209759_1006107 Ga0209759_10061073 204
240 3300025261 Ga0209233_1000002 Ga0209233_10000021544 204
241 3300025261 Ga0209233_1009776 Ga0209233_10097763 204
242 3300025272 Ga0209455_1000019 Ga0209455_100001915 204
243 3300025272 Ga0209455_1003352 Ga0209455_10033522 204
244 3300025904 Ga0207647_10003302 Ga0207647_1000330211 204
245 3300025920 Ga0207649_10038031 Ga0207649_100380311 204
246 3300025924 Ga0207694_10182954 Ga0207694_101829543 204
247 3300025936 Ga0207670_10010231 Ga0207670_100102312 204
248 3300025986 Ga0207658_10294134 Ga0207658_102941343 204
249 3300026067 Ga0207678_10015234 Ga0207678_100152347 204
250 3300026067 Ga0207678_10358885 Ga0207678_103588852 204
251 3300027360 Ga0209969_1001749 Ga0209969_10017492 204
252 3300027471 Ga0209995_1020127 Ga0209995_10201272 204
253 3300027552 Ga0209982_1007562 Ga0209982_10075622 204
254 3300028381 Ga0268264_10058349 Ga0268264_100583492 204
255 3300028800 Ga0265338_10431864 Ga0265338_104318642 204
256 3300031824 Ga0307413_10130284 Ga0307413_101302842 204
257 3300032004 Ga0307414_10045003 Ga0307414_100450032 204
258 3300032004 Ga0307414_10056897 Ga0307414_100568975 204
259 3300045976 Ga0466967_0183488 Ga0466967_0183488_493_1137 204
260 3300046460 Ga0495638_0000152 Ga0495638_0000152_19606_20280 204
261 3300046460 Ga0495638_0000378 Ga0495638_0000378_6763_7437 204
262 3300046471 Ga0495650_0000112 Ga0495650_0000112_6767_7441 204
263 3300046507 Ga0495606_0001622 Ga0495606_0001622_13968_14609 204
264 3300046557 Ga0495622_0002547 Ga0495622_0002547_3908_4582 204
265 3300046660 Ga0495625_0016670 Ga0495625_0016670_284_958 204
266 3300046694 Ga0495649_0001164 Ga0495649_0001164_6746_7420 204
267 3300048909 Ga0496106_0534394 Ga0496106_0534394_88_729 204
268 3300048918 Ga0496115_0000008 Ga0496115_0000008_236388_237029 204
269 3300048918 Ga0496115_0005931 Ga0496115_0005931_7265_7939 204
270 3300048918 Ga0496115_0322743 Ga0496115_0322743_575_1216 204
271 3300048929 Ga0496126_0023762 Ga0496126_0023762_985_1626 204
272 3300048929 Ga0496126_0029021 Ga0496126_0029021_159_833 204
273 3300048929 Ga0496126_0083326 Ga0496126_0083326_2113_2754 204
274 3300049459 Ga0495678_014368 Ga0495678_014368_2018_2692 204
275 3300049460 Ga0495682_0154028 Ga0495682_0154028_145_786 204
276 iso_pu_bacteria 2571042365 2572253600 204
277 3300005289 Ga0065704_10099761 Ga0065704_100997611 205
278 3300005543 Ga0070672_100256636 Ga0070672_1002566362 205
279 3300006051 Ga0075364_10000769 Ga0075364_100007697 205
280 3300014326 Ga0157380_10342708 Ga0157380_103427083 205
281 3300025918 Ga0207662_10291270 Ga0207662_102912702 205
282 3300028794 Ga0307515_10048284 Ga0307515_100482845 205
283 3300032002 Ga0307416_100078567 Ga0307416_1000785673 205
284 3300032002 Ga0307416_100942341 Ga0307416_1009423412 205
285 3300032004 Ga0307414_10004708 Ga0307414_100047084 205
286 3300032004 Ga0307414_10051007 Ga0307414_100510073 205
287 3300037471 Ga0395905_0391263 Ga0395905_0391263_25_654 205
288 3300041509 Ga0451843_0281983 Ga0451843_0281983_469_1101 205
289 3300042007 Ga0439449_0017697 Ga0439449_0017697_332_952 205
290 3300042142 Ga0450905_007896 Ga0450905_007896_151_783 205
291 3300042157 Ga0439458_0063550 Ga0439458_0063550_186_833 205
292 3300049581 Ga0501047_0384725 Ga0501047_0384725_254_880 205
293 3300049679 Ga0501249_006351 Ga0501249_006351_1337_1960 205
294 3300049686 Ga0501257_085411 Ga0501257_085411_72_695 205
295 3300049705 Ga0501225_0053339 Ga0501225_0053339_308_931 205
296 3300049853 Ga0501226_005248 Ga0501226_005248_452_1075 205
297 3300050491 nmdc:mga00v17_25_c1 nmdc:mga00v17_25_c1_16236_16868 205
298 iso_pu_bacteria 8002869464 8002870164 205
299 2162886007 SwRhRL2b_contig_2377386 SwRhRL2b_0217.00004640 206
300 3300002741 JGI25157J39369_1001417 JGI25157J39369_10014177 206
301 3300003781 Ga0055536_1008655 Ga0055536_10086553 206
302 3300005289 Ga0065704_10071131 Ga0065704_100711311 206
303 3300005344 Ga0070661_100378938 Ga0070661_1003789383 206
304 3300005355 Ga0070671_100160002 Ga0070671_1001600022 206
305 3300005356 Ga0070674_100159014 Ga0070674_1001590143 206
306 3300005435 Ga0070714_100018328 Ga0070714_1000183285 206
307 3300005436 Ga0070713_100000918 Ga0070713_10000091815 206
308 3300005457 Ga0070662_100680817 Ga0070662_1006808171 206
309 3300005459 Ga0068867_100229226 Ga0068867_1002292261 206
310 3300005564 Ga0070664_100106619 Ga0070664_1001066192 206
311 3300005618 Ga0068864_100399561 Ga0068864_1003995612 206
312 3300005719 Ga0068861_100320377 Ga0068861_1003203772 206
313 3300006175 Ga0070712_100150602 Ga0070712_1001506022 206
314 3300009092 Ga0105250_10165904 Ga0105250_101659042 206
315 3300009176 Ga0105242_10429185 Ga0105242_104291852 206
316 3300010375 Ga0105239_10013435 Ga0105239_100134354 206
317 3300013308 Ga0157375_10271814 Ga0157375_102718142 206
318 3300014326 Ga0157380_10371318 Ga0157380_103713182 206
319 3300025226 Ga0209674_101242 Ga0209674_1012424 206
320 3300025250 Ga0209026_1000017 Ga0209026_1000017194 206
321 3300025292 Ga0209676_1000063 Ga0209676_1000063247 206
322 3300025915 Ga0207693_10056699 Ga0207693_100566995 206
323 3300025923 Ga0207681_10458477 Ga0207681_104584773 206
324 3300025928 Ga0207700_10001904 Ga0207700_100019046 206
325 3300025929 Ga0207664_10062212 Ga0207664_100622122 206
326 3300025931 Ga0207644_10058862 Ga0207644_100588623 206
327 3300025937 Ga0207669_10445216 Ga0207669_104452161 206
328 3300025940 Ga0207691_10016420 Ga0207691_100164202 206
329 3300025944 Ga0207661_10170636 Ga0207661_101706363 206
330 3300025986 Ga0207658_10785777 Ga0207658_107857771 206
331 3300026089 Ga0207648_10053647 Ga0207648_100536472 206
332 3300026121 Ga0207683_10018561 Ga0207683_100185617 206
333 3300030733 Ga0314311_1137376 Ga0314311_11373762 206
334 3300031824 Ga0307413_10172562 Ga0307413_101725622 206
335 3300031852 Ga0307410_10079523 Ga0307410_100795235 206
336 3300031903 Ga0307407_10702053 Ga0307407_107020531 206
337 3300031911 Ga0307412_10212033 Ga0307412_102120333 206
338 3300031911 Ga0307412_10754439 Ga0307412_107544392 206
339 3300032004 Ga0307414_10001626 Ga0307414_100016267 206
340 3300032004 Ga0307414_10304278 Ga0307414_103042783 206
341 3300032005 Ga0307411_10055234 Ga0307411_100552344 206
342 3300037418 Ga0395900_0645189 Ga0395900_0645189_264_908 206
343 3300037471 Ga0395905_0269843 Ga0395905_0269843_209_853 206
344 3300041404 Ga0439436_0035284 Ga0439436_0035284_249_893 206
345 3300041404 Ga0439436_0042165 Ga0439436_0042165_605_1237 206
346 3300041406 Ga0439439_0101428 Ga0439439_0101428_144_776 206
347 3300041413 Ga0439465_0006794 Ga0439465_0006794_2592_3236 206
348 3300041413 Ga0439465_0011245 Ga0439465_0011245_302_943 206
349 3300041453 Ga0451797_1386712 Ga0451797_1386712_253_924 206
350 3300041494 Ga0451837_0154854 Ga0451837_0154854_352_1023 206
351 3300041509 Ga0451843_0069898 Ga0451843_0069898_149_820 206
352 3300042010 Ga0439452_028913 Ga0439452_028913_164_808 206
353 3300042015 Ga0439462_0066145 Ga0439462_0066145_224_868 206
354 3300042134 Ga0450898_048276 Ga0450898_048276_144_779 206
355 3300042135 Ga0450899_005502 Ga0450899_005502_164_796 206
356 3300046537 Ga0495598_0107317 Ga0495598_0107317_75_707 206
357 3300046615 Ga0495656_0006378 Ga0495656_0006378_2392_3036 206
358 3300046615 Ga0495656_0032075 Ga0495656_0032075_659_1294 206
359 3300046615 Ga0495656_0140638 Ga0495656_0140638_381_1016 206
360 3300046664 Ga0495659_0068754 Ga0495659_0068754_180_815 206
361 3300046691 Ga0495670_0141528 Ga0495670_0141528_329_964 206
362 3300047318 Ga0495636_0001496 Ga0495636_0001496_2836_3471 206
363 3300047318 Ga0495636_0004599 Ga0495636_0004599_155_790 206
364 3300047318 Ga0495636_0030994 Ga0495636_0030994_876_1511 206
365 3300047318 Ga0495636_0050217 Ga0495636_0050217_686_1330 206
366 3300048903 Ga0496100_0251246 Ga0496100_0251246_42_686 206
367 3300048904 Ga0496101_0213588 Ga0496101_0213588_719_1363 206
368 3300048912 Ga0496109_0035762 Ga0496109_0035762_1027_1671 206
369 3300048913 Ga0496110_0211899 Ga0496110_0211899_1005_1649 206
370 3300048915 Ga0496112_0597498 Ga0496112_0597498_112_756 206
371 3300048916 Ga0496113_0021691 Ga0496113_0021691_718_1362 206
372 3300048917 Ga0496114_0005982 Ga0496114_0005982_1508_2128 206
373 3300048917 Ga0496114_0380767 Ga0496114_0380767_58_702 206
374 3300048928 Ga0496125_0133667 Ga0496125_0133667_628_1269 206
375 3300048929 Ga0496126_0006571 Ga0496126_0006571_387_1007 206
376 3300049571 Ga0501034_0000275 Ga0501034_0000275_20143_20763 206
377 3300049579 Ga0501043_0000694 Ga0501043_0000694_28473_29120 206
378 3300049682 Ga0501252_004844 Ga0501252_004844_55_690 206
379 3300049705 Ga0501225_0014773 Ga0501225_0014773_1395_2030 206
380 3300049768 Ga0501271_005002 Ga0501271_005002_493_1128 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02433

FixO

Cytochrome C oxidase, mono-heme subunit/FixO

16

197

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5djq-assembly4.cif.gz_L the structure of cbb3 cytochrome oxidase. 0.6843 10 201
8snh-assembly1.cif.gz_F cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.6725 7 201
5djq-assembly4.cif.gz_L the structure of cbb3 cytochrome oxidase. 0.6649 10 201
6xkw-assembly1.cif.gz_o r. capsulatus ciii2civ bipartite super-complex (sc-2a) with ccoh/cy 0.6605 10 201
8snh-assembly1.cif.gz_F cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.6537 7 201
ID Description Score Start End Superfamily
3mk7E02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7789 44 201 1.10.760.10
3mk7E02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7564 44 201 1.10.760.10
2oz1D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.5364 44 198 1.10.760.10
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.4915 47 203 2.60.40.420
af_A0A1D6KZL1_41_285_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.4904 151 200 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A4Q3P7K5-F1-model_v4 deleted 0.983 118 201
AF-A0A1H7CUC5-F1-model_v4 Cytochrome c oxidase cbb3-type subunit 2 0.9712 116 200 GO:0009055
GO:0020037
AF-A0A7C1TLI8-F1-model_v4 Cytochrome-c oxidase, cbb3-type subunit II 0.9701 127 203 GO:0009055
GO:0020037
AF-A0A356HDG4-F1-model_v4 deleted 0.9627 122 199
AF-A0A090SH65-F1-model_v4 deleted 0.9566 140 200

Feature Viewer

pLDDT pTM Quality
74.37 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map