metagRoot

F428532

General Info

Members	Datasets	Scaffolds	Average Seq Length
380	255	370	406

Family's Representative Sequence

Representative Sequence	3300003203\|JGI25406J46586_10042093\|JGI25406J46586_100420931
Length	441
Sequence	MASPSSSRNREPVIVAGGGIGGLAAALALARKGFRSVVLEQAPQFGEIGAGIQIAPNAWHALDALGVGALVKKEAVFIEHLLMMDGVSGEKVIDIPLDARFAKRFANPYAVTHRADIHGSLVDGCKALPQMIDLRTNXRVTGFDIADRGVRVRLASGEVINGAALVGADGAKSVVRDALVGDQLPASTIHKCYRAVLNAGDVPKDLRWAAATLWAAHDTHIVHYPLRGWKLFNLVATAIGQPISEGHAAVATPEEVLPQFAHFCEKPLKLMGTPKQFTRWMLRFRDPVDNWIKGPVALLGDAAHLMLQYMAQGAAMAMEDAVALGFACDATDGDFEKAFKRYQEMRLVRASRMHISANSLVGQIFHVPDGLLRLVRNDIFIGRSPERYYDALEWVFAAPDYVRQFKAASPARRPAATVAHRAKPLKRAAARKRRPPSRQRS

Samples

	Sample ID	Description	Type	Environment
1	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
2	2574179768	Azoarcus communis DSM 12120	Isolate	Unclassified
3	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
4	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
5	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
6	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
7	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
8	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
9	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
10	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
11	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
12	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
13	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
14	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
15	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
16	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
17	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
18	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
19	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
20	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
21	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
22	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
23	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
24	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
25	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
26	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
27	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
28	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
29	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
30	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
31	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
32	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
33	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
34	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
35	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
36	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
37	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
38	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
39	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
40	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
41	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
42	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
43	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
44	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
45	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
46	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
47	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
48	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
49	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
50	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
51	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
52	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
53	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
54	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
55	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
56	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
57	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
58	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
59	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
60	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
61	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
62	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
63	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
64	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
65	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
66	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
67	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
68	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
69	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
70	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
71	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
73	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
74	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
75	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
76	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
77	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
78	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
79	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
80	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
81	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
82	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
84	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
85	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
87	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
89	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
90	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
91	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
92	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
93	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
94	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
95	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
96	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
97	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
98	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
99	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
100	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
101	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
102	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
103	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
151	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
155	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
156	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
157	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
158	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
159	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
160	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
161	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
162	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
163	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
164	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
165	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
166	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
167	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
168	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
169	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
170	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
171	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
172	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
173	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
175	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
176	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
177	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
178	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
179	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
180	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
181	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
182	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
183	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
184	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
185	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
186	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
187	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
188	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
189	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
190	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
191	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
192	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
193	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
194	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
195	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
196	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
197	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
198	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
199	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
200	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
201	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
202	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
203	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
204	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
205	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
206	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
207	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
208	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
209	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
210	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
211	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
212	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
213	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
214	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
215	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
216	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
217	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
218	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
227	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
228	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
229	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
230	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
233	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
235	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
238	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
240	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
243	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
244	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
245	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
246	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
247	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
248	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
249	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
250	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
251	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
252	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
253	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
254	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
255	639633007	Azoarcus olearius BH72	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	97.37
Metatranscriptomes	0
Isolates	2.63

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.47
Nodule	0
Rhizoplane	0.79
Rhizosphere	90.26
Stem	0
Stem Tuber	0
Unclassified	4.47

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25151J46595_10012322	3300003187	Bacteria	3896
2	JGI25406J46586_10042093	3300003203	Bacteria	1602
3	Ga0055538_1000053	3300003751	Bacteria	127408
4	Ga0055539_1000078	3300003752	Bacteria	127408
5	Ga0055533_1000084	3300003756	Bacteria	127408
6	Ga0055525_1000112	3300003759	Bacteria	127408
7	Ga0055541_1000055	3300003841	Bacteria	127408
8	Ga0065707_10003532	3300005295	Bacteria	4112
9	Ga0070690_100000398	3300005330	Bacteria	21982
10	Ga0070670_100181067	3300005331	Bacteria	1830
11	Ga0068869_100000982	3300005334	Bacteria	16552
12	Ga0070680_100001158	3300005336	Bacteria	18956
13	Ga0070680_100002637	3300005336	Bacteria	13291
14	Ga0070680_100154412	3300005336	Bacteria	1928
15	Ga0070682_100001096	3300005337	Bacteria	15544
16	Ga0068868_100000097	3300005338	Bacteria	54209
17	Ga0068868_100001858	3300005338	Bacteria	14495
18	Ga0070689_100000188	3300005340	Bacteria	37400
19	Ga0070689_100185035	3300005340	Bacteria	1694
20	Ga0070691_10000867	3300005341	Bacteria	12254
21	Ga0070687_100000069	3300005343	Bacteria	33055
22	Ga0070692_10006007	3300005345	Bacteria	5232
23	Ga0070692_10023260	3300005345	Bacteria	3035
24	Ga0070675_100045415	3300005354	Bacteria	3595
25	Ga0070675_100263582	3300005354	Bacteria	1511
26	Ga0070671_100060748	3300005355	Bacteria	3147
27	Ga0070674_100023097	3300005356	Bacteria	4019
28	Ga0070674_100055859	3300005356	Bacteria	2736
29	Ga0070674_100156966	3300005356	Bacteria	1723
30	Ga0070673_100021371	3300005364	Bacteria	4690
31	Ga0070659_100150123	3300005366	Bacteria	1901
32	Ga0070667_100042093	3300005367	Bacteria	3832
33	Ga0070667_100082626	3300005367	Bacteria	2751
34	Ga0070667_100142689	3300005367	Bacteria	2099
35	Ga0070714_100047357	3300005435	Bacteria	3652
36	Ga0070701_10001237	3300005438	Bacteria	9373
37	Ga0070705_100021866	3300005440	Bacteria	3408
38	Ga0070705_100028403	3300005440	Bacteria	3064
39	Ga0070705_100099211	3300005440	Bacteria	1835
40	Ga0070694_100000562	3300005444	Bacteria	20530
41	Ga0070708_100275993	3300005445	Bacteria	1581
42	Ga0070678_100063113	3300005456	Bacteria	2739
43	Ga0070681_10130580	3300005458	Bacteria	2444
44	Ga0068867_100000296	3300005459	Bacteria	32704
45	Ga0068867_100007181	3300005459	Bacteria	7873
46	Ga0068867_100021885	3300005459	Bacteria	4566
47	Ga0070707_100288563	3300005468	Bacteria	1594
48	Ga0070698_100065246	3300005471	Bacteria	3666
49	Ga0070699_100007220	3300005518	Bacteria	9666
50	Ga0070679_100003737	3300005530	Bacteria	13955
51	Ga0070679_100028971	3300005530	Bacteria	5462
52	Ga0070684_100044478	3300005535	Bacteria	3841
53	Ga0070697_100004195	3300005536	Bacteria	11049
54	Ga0070686_100000090	3300005544	Bacteria	63246
55	Ga0070686_100009181	3300005544	Bacteria	5549
56	Ga0070695_100000188	3300005545	Bacteria	29840
57	Ga0070695_100014991	3300005545	Bacteria	4676
58	Ga0070695_100061041	3300005545	Bacteria	2445
59	Ga0070696_100000719	3300005546	Bacteria	21155
60	Ga0070696_100012269	3300005546	Bacteria	5743
61	Ga0070696_100023207	3300005546	Bacteria	4216
62	Ga0070696_100113081	3300005546	Bacteria	1957
63	Ga0070693_100001033	3300005547	Bacteria	12422
64	Ga0070665_100197899	3300005548	Bacteria	2010
65	Ga0070704_100000064	3300005549	Bacteria	34900
66	Ga0070704_100028481	3300005549	Bacteria	3717
67	Ga0068855_100000833	3300005563	Bacteria	38155
68	Ga0068854_100118356	3300005578	Bacteria	2007
69	Ga0068856_100017695	3300005614	Bacteria	6911
70	Ga0068856_100097720	3300005614	Bacteria	2926
71	Ga0070702_100000002	3300005615	Bacteria	83999
72	Ga0068852_100013608	3300005616	Bacteria	6229
73	Ga0068852_100040325	3300005616	Bacteria	3938
74	Ga0068852_100261332	3300005616	Bacteria	1662
75	Ga0068859_100000195	3300005617	Bacteria	59015
76	Ga0068859_100110587	3300005617	Bacteria	2809
77	Ga0068866_10000037	3300005718	Bacteria	50738
78	Ga0068861_100000043	3300005719	Bacteria	57807
79	Ga0068861_100008107	3300005719	Bacteria	7226
80	Ga0068870_10089116	3300005840	Bacteria	1721
81	Ga0068863_100064274	3300005841	Bacteria	3471
82	Ga0068858_100001438	3300005842	Bacteria	24478
83	Ga0068858_100003921	3300005842	Bacteria	14698
84	Ga0068858_100010244	3300005842	Bacteria	8895
85	Ga0068858_100098980	3300005842	Bacteria	2719
86	Ga0068860_100037967	3300005843	Bacteria	4609
87	Ga0068860_100199310	3300005843	Bacteria	1939
88	Ga0068862_100002188	3300005844	Bacteria	17538
89	Ga0068862_100124357	3300005844	Bacteria	2276
90	Ga0081539_10000233	3300005985	Bacteria	130647
91	Ga0070716_100133675	3300006173	Bacteria	1572
92	Ga0075362_10025222	3300006177	Bacteria	2528
93	Ga0075366_10033949	3300006195	Bacteria	3006
94	Ga0075366_10073618	3300006195	Bacteria	2036
95	Ga0097621_100000045	3300006237	Bacteria	65278
96	Ga0097621_100038135	3300006237	Bacteria	3855
97	Ga0075370_10017440	3300006353	Bacteria	3880
98	Ga0068871_100000040	3300006358	Bacteria	69044
99	Ga0068871_100011962	3300006358	Bacteria	6388
100	Ga0075428_100000047	3300006844	Bacteria	96882
101	Ga0075430_100026031	3300006846	Bacteria	4977
102	Ga0075430_100027080	3300006846	Bacteria	4873
103	Ga0075431_100110914	3300006847	Bacteria	2831
104	Ga0075431_100171945	3300006847	Bacteria	2226
105	Ga0075433_10000605	3300006852	Bacteria	23895
106	Ga0075433_10160131	3300006852	Bacteria	2003
107	Ga0075434_100000414	3300006871	Bacteria	31577
108	Ga0075434_100000554	3300006871	Bacteria	28632
109	Ga0075429_100000067	3300006880	Bacteria	51949
110	Ga0068865_100000343	3300006881	Bacteria	25779
111	Ga0075436_100001082	3300006914	Bacteria	18349
112	Ga0075436_100006380	3300006914	Bacteria	8081
113	Ga0075436_100020290	3300006914	Bacteria	4561
114	Ga0075436_100025180	3300006914	Bacteria	4092
115	Ga0097620_100000195	3300006931	Bacteria	59015
116	Ga0097620_100110586	3300006931	Bacteria	2809
117	Ga0075435_100005507	3300007076	Bacteria	8849
118	Ga0075435_100164420	3300007076	Bacteria	1871
119	Ga0099794_10016726	3300007265	Bacteria	3257
120	Ga0111539_10060108	3300009094	Bacteria	4505
121	Ga0111539_10109701	3300009094	Bacteria	3238
122	Ga0111539_10170777	3300009094	Bacteria	2541
123	Ga0111539_10394330	3300009094	Bacteria	1612
124	Ga0105245_10000306	3300009098	Bacteria	47026
125	Ga0105245_10039479	3300009098	Bacteria	4201
126	Ga0114129_10000040	3300009147	Bacteria	107971
127	Ga0105243_10000035	3300009148	Bacteria	177598
128	Ga0105243_10061389	3300009148	Bacteria	3006
129	Ga0105241_10007746	3300009174	Bacteria	7895
130	Ga0105242_10000097	3300009176	Bacteria	61646
131	Ga0105248_10325757	3300009177	Bacteria	1730
132	Ga0105249_10001837	3300009553	Bacteria	18455
133	Ga0105239_10045568	3300010375	Bacteria	4807
134	Ga0105246_10130091	3300011119	Bacteria	1879
135	Ga0157378_10001996	3300013297	Bacteria	18243
136	Ga0157372_10123993	3300013307	Bacteria	2970
137	Ga0157375_10026773	3300013308	Bacteria	5380
138	Ga0157380_10011181	3300014326	Bacteria	6477
139	Ga0157380_10012013	3300014326	Bacteria	6267
140	Ga0157380_10095688	3300014326	Bacteria	2461
141	Ga0157377_10009512	3300014745	Bacteria	4772
142	Ga0157377_10112989	3300014745	Bacteria	1635
143	Ga0157379_10011288	3300014968	Bacteria	7786
144	Ga0157379_10027084	3300014968	Bacteria	5102
145	Ga0157379_10030223	3300014968	Bacteria	4820
146	Ga0157379_10055699	3300014968	Bacteria	3533
147	Ga0157379_10057874	3300014968	Bacteria	3464
148	Ga0157376_10000403	3300014969	Bacteria	28093
149	Ga0213872_10003582	3300021361	Bacteria	8544
150	Ga0213872_10024053	3300021361	Bacteria	2801
151	Ga0209784_100035	3300025224	Bacteria	299760
152	Ga0209566_100040	3300025225	Bacteria	299760
153	Ga0209674_100057	3300025226	Bacteria	299760
154	Ga0209563_100059	3300025230	Bacteria	299760
155	Ga0209677_100036	3300025253	Bacteria	299760
156	Ga0209025_1000115	3300025294	Bacteria	218871
157	Ga0207642_10004703	3300025899	Bacteria	4411
158	Ga0207642_10072520	3300025899	Bacteria	1643
159	Ga0207645_10008084	3300025907	Bacteria	7379
160	Ga0207643_10028125	3300025908	Bacteria	3120
161	Ga0207654_10018546	3300025911	Bacteria	3654
162	Ga0207707_10002138	3300025912	Bacteria	17899
163	Ga0207660_10041212	3300025917	Bacteria	3235
164	Ga0207660_10042158	3300025917	Bacteria	3202
165	Ga0207662_10000006	3300025918	Bacteria	105457
166	Ga0207652_10002034	3300025921	Bacteria	17425
167	Ga0207652_10017870	3300025921	Bacteria	5810
168	Ga0207646_10013083	3300025922	Bacteria	7947
169	Ga0207646_10105624	3300025922	Bacteria	2526
170	Ga0207659_10032236	3300025926	Bacteria	3594
171	Ga0207659_10032882	3300025926	Bacteria	3564
172	Ga0207687_10002839	3300025927	Bacteria	11755
173	Ga0207664_10273393	3300025929	Bacteria	1480
174	Ga0207644_10031597	3300025931	Bacteria	3690
175	Ga0207644_10036732	3300025931	Bacteria	3441
176	Ga0207690_10127157	3300025932	Bacteria	1860
177	Ga0207706_10054169	3300025933	Bacteria	3540
178	Ga0207686_10000690	3300025934	Bacteria	20922
179	Ga0207709_10003054	3300025935	Bacteria	10125
180	Ga0207670_10009171	3300025936	Bacteria	5628
181	Ga0207670_10084516	3300025936	Bacteria	2228
182	Ga0207670_10109004	3300025936	Bacteria	1992
183	Ga0207669_10215360	3300025937	Bacteria	1405
184	Ga0207704_10002301	3300025938	Bacteria	8579
185	Ga0207704_10126358	3300025938	Bacteria	1761
186	Ga0207665_10193958	3300025939	Bacteria	1477
187	Ga0207691_10036555	3300025940	Bacteria	4551
188	Ga0207691_10045783	3300025940	Bacteria	4021
189	Ga0207691_10059002	3300025940	Bacteria	3490
190	Ga0207691_10229808	3300025940	Bacteria	1607
191	Ga0207711_10232973	3300025941	Bacteria	1687
192	Ga0207689_10000082	3300025942	Bacteria	76708
193	Ga0207689_10008405	3300025942	Bacteria	8987
194	Ga0207689_10044722	3300025942	Bacteria	3661
195	Ga0207667_10054691	3300025949	Bacteria	4198
196	Ga0207712_10022320	3300025961	Bacteria	4166
197	Ga0207658_10055869	3300025986	Bacteria	2928
198	Ga0207677_10006101	3300026023	Bacteria	6579
199	Ga0207677_10009599	3300026023	Bacteria	5446
200	Ga0207677_10034627	3300026023	Bacteria	3272
201	Ga0207703_10009391	3300026035	Bacteria	7688
202	Ga0207678_10189150	3300026067	Bacteria	1759
203	Ga0207708_10004812	3300026075	Bacteria	9943
204	Ga0207702_10013289	3300026078	Bacteria	6847
205	Ga0207648_10000300	3300026089	Bacteria	53912
206	Ga0207648_10007584	3300026089	Bacteria	10641
207	Ga0207648_10010566	3300026089	Bacteria	8736
208	Ga0207648_10109129	3300026089	Bacteria	2429
209	Ga0207676_10069132	3300026095	Bacteria	2827
210	Ga0207674_10153898	3300026116	Bacteria	2255
211	Ga0207674_10320120	3300026116	Bacteria	1500
212	Ga0207675_100000064	3300026118	Bacteria	79279
213	Ga0207683_10024014	3300026121	Bacteria	5247
214	Ga0207698_10006461	3300026142	Bacteria	7316
215	Ga0210000_1000809	3300027462	Bacteria	4332
216	Ga0209983_1006467	3300027665	Bacteria	2406
217	Ga0209971_1009358	3300027682	Bacteria	2322
218	Ga0207428_10001387	3300027907	Bacteria	25585
219	Ga0268266_10032241	3300028379	Bacteria	4452
220	Ga0268265_10002988	3300028380	Bacteria	12355
221	Ga0268265_10005451	3300028380	Bacteria	8692
222	Ga0268264_10001394	3300028381	Bacteria	22601
223	Ga0268264_10030457	3300028381	Bacteria	4423
224	Ga0268264_10249497	3300028381	Bacteria	1648
225	Ga0307515_10101926	3300028794	Bacteria	3459
226	Ga0265332_10002264	3300031238	Bacteria	9857
227	Ga0307513_10002887	3300031456	Bacteria	23517
228	Ga0307516_10001281	3300031730	Bacteria	34984
229	Ga0307516_10058155	3300031730	Bacteria	3765
230	Ga0307516_10095035	3300031730	Bacteria	2804
231	Ga0373929_0003304	3300035085	Bacteria	2915
232	Ga0373929_0018473	3300035085	Bacteria	1386
233	Ga0373940_0012769	3300035088	Bacteria	2017
234	Ga0373949_0005374	3300035090	Bacteria	2859
235	Ga0373932_0001372	3300035112	Bacteria	6829
236	Ga0373939_0000881	3300035114	Bacteria	7446
237	Ga0373939_0010231	3300035114	Bacteria	2340
238	Ga0373941_0007096	3300035115	Bacteria	2728
239	Ga0373954_0001100	3300035118	Bacteria	10800
240	Ga0373943_0058133	3300035170	Bacteria	1924
241	Ga0373946_0017723	3300035171	Bacteria	2727
242	Ga0373962_0002004	3300035242	Bacteria	4854
243	Ga0373924_0015927	3300035410	Bacteria	2865
244	Ga0373931_0003466	3300035691	Bacteria	7086
245	Ga0373931_0005626	3300035691	Bacteria	5813
246	Ga0373931_0009180	3300035691	Bacteria	4723
247	Ga0373931_0017464	3300035691	Bacteria	3550
248	Ga0373931_0030292	3300035691	Bacteria	2784
249	Ga0373935_0019649	3300035692	Bacteria	4118
250	Ga0373927_0032263	3300035695	Bacteria	3411
251	Ga0373933_0005942	3300035724	Bacteria	6640
252	Ga0373933_0007638	3300035724	Bacteria	5903
253	Ga0373937_0001045	3300036401	Bacteria	23385
254	Ga0373937_0040741	3300036401	Bacteria	4235
255	Ga0373937_0057809	3300036401	Bacteria	3563
256	Ga0395898_0226832	3300037466	Bacteria	1782
257	Ga0395905_0001148	3300037471	Bacteria	33147
258	Ga0395905_0002159	3300037471	Bacteria	22302
259	Ga0395905_0050153	3300037471	Bacteria	3912
260	Ga0395905_0269536	3300037471	Bacteria	1588
261	Ga0436365_0787708	3300039437	Bacteria	4532
262	Ga0436361_0088190	3300039447	Bacteria	26184
263	Ga0436361_1015675	3300039447	Bacteria	1878
264	Ga0439453_0002490	3300041408	Bacteria	2549
265	Ga0439441_000324	3300042001	Bacteria	4845
266	Ga0439460_0008868	3300042461	Bacteria	2542
267	Ga0439460_0026394	3300042461	Bacteria	1624
268	Ga0451577_0001465	3300042876	Bacteria	31307
269	Ga0451577_0079966	3300042876	Bacteria	2914
270	Ga0451576_0000822	3300045051	Bacteria	60600
271	Ga0495590_0033610	3300046457	Bacteria	1793
272	Ga0495629_0000206	3300046459	Bacteria	52609
273	Ga0495629_0103527	3300046459	Bacteria	1986
274	Ga0495653_0080001	3300046463	Bacteria	2419
275	Ga0495650_0000688	3300046471	Bacteria	43681
276	Ga0495580_0013828	3300046472	Bacteria	6144
277	Ga0495582_0012981	3300046473	Bacteria	4590
278	Ga0495639_0013122	3300046475	Bacteria	3575
279	Ga0495662_0003159	3300046476	Bacteria	8313
280	Ga0495664_0029928	3300046477	Bacteria	3187
281	Ga0495630_0016274	3300046517	Bacteria	5433
282	Ga0495630_0107397	3300046517	Bacteria	2114
283	Ga0495643_0006544	3300046522	Bacteria	7666
284	Ga0495640_0023373	3300046533	Bacteria	4504
285	Ga0495586_0043282	3300046535	Bacteria	2425
286	Ga0495586_0049347	3300046535	Bacteria	2275
287	Ga0495587_0108505	3300046536	Bacteria	1596
288	Ga0495597_0020197	3300046542	Bacteria	3106
289	Ga0495645_0000416	3300046543	Bacteria	29363
290	Ga0495645_0004251	3300046543	Bacteria	9782
291	Ga0495668_0033594	3300046616	Bacteria	2881
292	Ga0495659_0047693	3300046664	Bacteria	1550
293	Ga0495661_0030433	3300046665	Bacteria	3437
294	Ga0495657_0072314	3300046675	Bacteria	2249
295	Ga0495669_0010111	3300046684	Bacteria	3985
296	Ga0495613_0057013	3300046689	Bacteria	2868
297	Ga0495624_0056032	3300046690	Bacteria	2481
298	Ga0495589_0007455	3300046794	Bacteria	5733
299	Ga0495581_0010923	3300047315	Bacteria	5250
300	Ga0495604_0108953	3300047317	Bacteria	2022
301	Ga0495604_0116616	3300047317	Bacteria	1938
302	Ga0495636_0046295	3300047318	Bacteria	1814
303	Ga0495674_0116997	3300047319	Bacteria	2255
304	Ga0495680_0063053	3300047322	Bacteria	2847
305	Ga0495687_002139	3300047443	Bacteria	16502
306	Ga0496104_0014478	3300048907	Bacteria	7125
307	Ga0496105_0037385	3300048908	Bacteria	3997
308	Ga0496114_0000931	3300048917	Bacteria	21879
309	Ga0496121_0000511	3300048924	Bacteria	73863
310	Ga0496126_0094680	3300048929	Bacteria	2621
311	Ga0501033_0003135	3300049570	Bacteria	13738
312	Ga0501036_0000778	3300049572	Bacteria	23605
313	Ga0501038_0023557	3300049574	Bacteria	5501
314	Ga0501038_0215323	3300049574	Bacteria	1535
315	Ga0501039_0009480	3300049575	Bacteria	7422
316	Ga0501040_0000808	3300049576	Bacteria	19495
317	Ga0501040_0010031	3300049576	Bacteria	6186
318	Ga0501040_0031728	3300049576	Bacteria	3572
319	Ga0501040_0032649	3300049576	Bacteria	3524
320	Ga0501041_0004667	3300049577	Bacteria	7949
321	Ga0501041_0005636	3300049577	Bacteria	7314
322	Ga0501042_0032257	3300049578	Bacteria	3708
323	Ga0501043_0035904	3300049579	Bacteria	3900
324	Ga0501043_0088611	3300049579	Bacteria	2432
325	Ga0501046_0020754	3300049580	Bacteria	5427
326	Ga0501046_0025673	3300049580	Bacteria	4819
327	Ga0501047_0063450	3300049581	Bacteria	3564
328	Ga0501048_0016370	3300049582	Bacteria	5464
329	Ga0501048_0021903	3300049582	Bacteria	4677
330	Ga0501068_0004020	3300049584	Bacteria	7998
331	Ga0501070_0067027	3300049586	Bacteria	2973
332	Ga0501071_0005010	3300049587	Bacteria	8466
333	Ga0501071_0080750	3300049587	Bacteria	2379
334	Ga0501072_0005483	3300049588	Bacteria	9659
335	Ga0501072_0017479	3300049588	Bacteria	5511
336	Ga0501074_0041642	3300049590	Bacteria	3325
337	Ga0501075_0004928	3300049591	Bacteria	9101
338	Ga0501075_0007259	3300049591	Bacteria	7684
339	Ga0501076_0012570	3300049592	Bacteria	6333
340	Ga0501076_0014667	3300049592	Bacteria	5907
341	Ga0501077_0005485	3300049593	Bacteria	7721
342	Ga0501077_0043433	3300049593	Bacteria	2857
343	Ga0501079_0007800	3300049741	Bacteria	8105
344	Ga0501079_0017859	3300049741	Bacteria	5417
345	Ga0501080_0056773	3300049742	Bacteria	3645
346	Ga0501081_0000810	3300049743	Bacteria	18453
347	Ga0501081_0004980	3300049743	Bacteria	8551
348	Ga0501035_0030604	3300049822	Bacteria	4906
349	Ga0501045_0022182	3300049824	Bacteria	4543
350	nmdc:mga0k408_44979_c1	3300050493	Bacteria	2547
351	nmdc:mga05p37_886_c1	3300050507	Bacteria	33754
352	nmdc:mga09592_335_c1	3300050508	Bacteria	34453
353	nmdc:mga0qj67_6200_c1	3300050509	Bacteria	8774
354	nmdc:mga06r32_276523_c1	3300050510	Bacteria	1666
355	nmdc:mga08y16_127322_c1	3300050511	Bacteria	2649
356	nmdc:mga08y16_1601_c1	3300050511	Bacteria	22883
357	nmdc:mga08y16_187131_c1	3300050511	Bacteria	2148
358	nmdc:mga0n895_16155_c1	3300050512	Bacteria	6842
359	nmdc:mga0n895_2327_c1	3300050512	Bacteria	14807
360	nmdc:mga0n895_75424_c1	3300050512	Bacteria	3352
361	nmdc:mga0rr50_2318_c1	3300050513	Bacteria	10677
362	nmdc:mga08x19_118462_c1	3300050514	Bacteria	1772
363	nmdc:mga08x19_24618_c1	3300050514	Bacteria	3744
364	nmdc:mga08x19_2723_c1	3300050514	Bacteria	10682
365	nmdc:mga0a205_144693_c1	3300050515	Bacteria	2277
366	nmdc:mga0a205_505_c1	3300050515	Bacteria	30610
367	Ga0501084_0001603	3300054114	Bacteria	17927
368	Ga0501084_0171758	3300054114	Bacteria	1830
369	Ga0501082_0015756	3300060353	Bacteria	6502
370	Ga0530510_0010946	3300061734	Bacteria	6364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025931	Ga0207644_10036732	Ga0207644_100367323	373
2	3300005355	Ga0070671_100060748	Ga0070671_1000607482	379
3	3300014968	Ga0157379_10030223	Ga0157379_100302237	379
4	3300025931	Ga0207644_10031597	Ga0207644_100315973	379
5	3300046459	Ga0495629_0103527	Ga0495629_0103527_105_1343	379
6	3300046517	Ga0495630_0107397	Ga0495630_0107397_443_1666	379
7	3300046535	Ga0495586_0043282	Ga0495586_0043282_80_1303	379
8	3300046536	Ga0495587_0108505	Ga0495587_0108505_188_1411	379
9	3300047317	Ga0495604_0116616	Ga0495604_0116616_27_1250	379
10	3300047322	Ga0495680_0063053	Ga0495680_0063053_1071_2294	379
11	3300005340	Ga0070689_100185035	Ga0070689_1001850352	380
12	3300005546	Ga0070696_100113081	Ga0070696_1001130812	380
13	3300005548	Ga0070665_100197899	Ga0070665_1001978991	380
14	3300025936	Ga0207670_10109004	Ga0207670_101090042	380
15	3300050514	nmdc:mga08x19_118462_c1	nmdc:mga08x19_118462_c1_27_1235	380
16	3300026116	Ga0207674_10320120	Ga0207674_103201202	381
17	3300047318	Ga0495636_0046295	Ga0495636_0046295_482_1711	381
18	3300026095	Ga0207676_10069132	Ga0207676_100691323	382
19	3300005616	Ga0068852_100040325	Ga0068852_1000403252	385
20	3300005842	Ga0068858_100003921	Ga0068858_10000392114	385
21	3300014326	Ga0157380_10095688	Ga0157380_100956884	385
22	3300025938	Ga0207704_10126358	Ga0207704_101263581	385
23	3300025940	Ga0207691_10045783	Ga0207691_100457835	385
24	3300046664	Ga0495659_0047693	Ga0495659_0047693_137_1357	385
25	3300007265	Ga0099794_10016726	Ga0099794_100167263	386
26	3300050512	nmdc:mga0n895_16155_c1	nmdc:mga0n895_16155_c1_1010_2284	386
27	3300005345	Ga0070692_10023260	Ga0070692_100232602	387
28	3300005356	Ga0070674_100055859	Ga0070674_1000558591	387
29	3300005459	Ga0068867_100007181	Ga0068867_1000071818	387
30	3300005578	Ga0068854_100118356	Ga0068854_1001183562	387
31	3300005719	Ga0068861_100008107	Ga0068861_1000081078	387
32	3300005840	Ga0068870_10089116	Ga0068870_100891162	387
33	3300005844	Ga0068862_100124357	Ga0068862_1001243572	387
34	3300007076	Ga0075435_100164420	Ga0075435_1001644202	387
35	3300009148	Ga0105243_10061389	Ga0105243_100613892	387
36	3300014326	Ga0157380_10012013	Ga0157380_100120135	387
37	3300026075	Ga0207708_10004812	Ga0207708_100048124	387
38	3300026089	Ga0207648_10010566	Ga0207648_100105668	387
39	3300028380	Ga0268265_10002988	Ga0268265_100029888	387
40	3300050513	nmdc:mga0rr50_2318_c1	nmdc:mga0rr50_2318_c1_8581_9828	387
41	3300005295	Ga0065707_10003532	Ga0065707_100035323	388
42	3300005330	Ga0070690_100000398	Ga0070690_10000039817	388
43	3300005334	Ga0068869_100000982	Ga0068869_10000098212	388
44	3300005336	Ga0070680_100001158	Ga0070680_1000011584	388
45	3300005337	Ga0070682_100001096	Ga0070682_10000109617	388
46	3300005338	Ga0068868_100000097	Ga0068868_10000009710	388
47	3300005340	Ga0070689_100000188	Ga0070689_10000018818	388
48	3300005341	Ga0070691_10000867	Ga0070691_1000086712	388
49	3300005343	Ga0070687_100000069	Ga0070687_10000006912	388
50	3300005345	Ga0070692_10006007	Ga0070692_100060076	388
51	3300005354	Ga0070675_100045415	Ga0070675_1000454151	388
52	3300005438	Ga0070701_10001237	Ga0070701_100012378	388
53	3300005440	Ga0070705_100021866	Ga0070705_1000218662	388
54	3300005440	Ga0070705_100028403	Ga0070705_1000284034	388
55	3300005444	Ga0070694_100000562	Ga0070694_10000056217	388
56	3300005459	Ga0068867_100000296	Ga0068867_10000029630	388
57	3300005530	Ga0070679_100003737	Ga0070679_1000037373	388
58	3300005544	Ga0070686_100000090	Ga0070686_10000009055	388
59	3300005545	Ga0070695_100000188	Ga0070695_10000018821	388
60	3300005545	Ga0070695_100061041	Ga0070695_1000610413	388
61	3300005546	Ga0070696_100000719	Ga0070696_10000071925	388
62	3300005546	Ga0070696_100012269	Ga0070696_1000122695	388
63	3300005547	Ga0070693_100001033	Ga0070693_10000103310	388
64	3300005549	Ga0070704_100000064	Ga0070704_1000000646	388
65	3300005549	Ga0070704_100028481	Ga0070704_1000284813	388
66	3300005563	Ga0068855_100000833	Ga0068855_10000083341	388
67	3300005614	Ga0068856_100017695	Ga0068856_1000176953	388
68	3300005614	Ga0068856_100097720	Ga0068856_1000977202	388
69	3300005615	Ga0070702_100000002	Ga0070702_10000000230	388
70	3300005616	Ga0068852_100013608	Ga0068852_1000136084	388
71	3300005617	Ga0068859_100000195	Ga0068859_10000019526	388
72	3300005718	Ga0068866_10000037	Ga0068866_1000003710	388
73	3300005719	Ga0068861_100000043	Ga0068861_10000004366	388
74	3300005841	Ga0068863_100064274	Ga0068863_1000642741	388
75	3300005842	Ga0068858_100001438	Ga0068858_10000143810	388
76	3300005842	Ga0068858_100098980	Ga0068858_1000989801	388
77	3300005843	Ga0068860_100037967	Ga0068860_1000379672	388
78	3300005844	Ga0068862_100002188	Ga0068862_1000021882	388
79	3300006237	Ga0097621_100000045	Ga0097621_10000004550	388
80	3300006358	Ga0068871_100000040	Ga0068871_10000004010	388
81	3300006844	Ga0075428_100000047	Ga0075428_10000004727	388
82	3300006852	Ga0075433_10000605	Ga0075433_1000060517	388
83	3300006852	Ga0075433_10160131	Ga0075433_101601311	388
84	3300006871	Ga0075434_100000554	Ga0075434_10000055411	388
85	3300006880	Ga0075429_100000067	Ga0075429_10000006713	388
86	3300006881	Ga0068865_100000343	Ga0068865_10000034322	388
87	3300006914	Ga0075436_100001082	Ga0075436_1000010824	388
88	3300006931	Ga0097620_100000195	Ga0097620_10000019541	388
89	3300007076	Ga0075435_100005507	Ga0075435_1000055075	388
90	3300009094	Ga0111539_10060108	Ga0111539_100601081	388
91	3300009094	Ga0111539_10170777	Ga0111539_101707772	388
92	3300009094	Ga0111539_10394330	Ga0111539_103943302	388
93	3300009098	Ga0105245_10000306	Ga0105245_1000030635	388
94	3300009147	Ga0114129_10000040	Ga0114129_1000004071	388
95	3300009148	Ga0105243_10000035	Ga0105243_10000035154	388
96	3300009174	Ga0105241_10007746	Ga0105241_100077464	388
97	3300009176	Ga0105242_10000097	Ga0105242_1000009760	388
98	3300009553	Ga0105249_10001837	Ga0105249_1000183714	388
99	3300010375	Ga0105239_10045568	Ga0105239_100455685	388
100	3300011119	Ga0105246_10130091	Ga0105246_101300912	388
101	3300013297	Ga0157378_10001996	Ga0157378_100019962	388
102	3300013307	Ga0157372_10123993	Ga0157372_101239932	388
103	3300014326	Ga0157380_10011181	Ga0157380_100111813	388
104	3300014745	Ga0157377_10009512	Ga0157377_100095122	388
105	3300014745	Ga0157377_10112989	Ga0157377_101129892	388
106	3300014968	Ga0157379_10027084	Ga0157379_100270843	388
107	3300014969	Ga0157376_10000403	Ga0157376_100004033	388
108	3300025899	Ga0207642_10004703	Ga0207642_100047035	388
109	3300025908	Ga0207643_10028125	Ga0207643_100281253	388
110	3300025911	Ga0207654_10018546	Ga0207654_100185462	388
111	3300025917	Ga0207660_10042158	Ga0207660_100421584	388
112	3300025918	Ga0207662_10000006	Ga0207662_1000000680	388
113	3300025921	Ga0207652_10002034	Ga0207652_100020346	388
114	3300025922	Ga0207646_10105624	Ga0207646_101056242	388
115	3300025926	Ga0207659_10032236	Ga0207659_100322363	388
116	3300025926	Ga0207659_10032882	Ga0207659_100328824	388
117	3300025927	Ga0207687_10002839	Ga0207687_100028396	388
118	3300025934	Ga0207686_10000690	Ga0207686_1000069017	388
119	3300025935	Ga0207709_10003054	Ga0207709_100030543	388
120	3300025936	Ga0207670_10009171	Ga0207670_100091713	388
121	3300025936	Ga0207670_10084516	Ga0207670_100845162	388
122	3300025938	Ga0207704_10002301	Ga0207704_100023015	388
123	3300025940	Ga0207691_10229808	Ga0207691_102298081	388
124	3300025942	Ga0207689_10000082	Ga0207689_1000008226	388
125	3300025942	Ga0207689_10044722	Ga0207689_100447222	388
126	3300025949	Ga0207667_10054691	Ga0207667_100546912	388
127	3300025961	Ga0207712_10022320	Ga0207712_100223202	388
128	3300026023	Ga0207677_10009599	Ga0207677_100095993	388
129	3300026035	Ga0207703_10009391	Ga0207703_100093919	388
130	3300026078	Ga0207702_10013289	Ga0207702_100132893	388
131	3300026089	Ga0207648_10000300	Ga0207648_1000030051	388
132	3300026118	Ga0207675_100000064	Ga0207675_10000006459	388
133	3300026142	Ga0207698_10006461	Ga0207698_100064613	388
134	3300027907	Ga0207428_10001387	Ga0207428_100013875	388
135	3300028380	Ga0268265_10005451	Ga0268265_100054514	388
136	3300028381	Ga0268264_10001394	Ga0268264_1000139418	388
137	3300035085	Ga0373929_0003304	Ga0373929_0003304_375_1595	388
138	3300035088	Ga0373940_0012769	Ga0373940_0012769_151_1371	388
139	3300035090	Ga0373949_0005374	Ga0373949_0005374_55_1275	388
140	3300035112	Ga0373932_0001372	Ga0373932_0001372_4218_5438	388
141	3300035114	Ga0373939_0000881	Ga0373939_0000881_1825_3045	388
142	3300035115	Ga0373941_0007096	Ga0373941_0007096_1484_2704	388
143	3300035171	Ga0373946_0017723	Ga0373946_0017723_1219_2427	388
144	3300035242	Ga0373962_0002004	Ga0373962_0002004_2756_3976	388
145	3300035691	Ga0373931_0003466	Ga0373931_0003466_4522_5730	388
146	3300035691	Ga0373931_0005626	Ga0373931_0005626_1884_3104	388
147	3300035692	Ga0373935_0019649	Ga0373935_0019649_1321_2529	388
148	3300042876	Ga0451577_0079966	Ga0451577_0079966_715_1923	388
149	3300045051	Ga0451576_0000822	Ga0451576_0000822_14304_15512	388
150	3300046535	Ga0495586_0049347	Ga0495586_0049347_1016_2224	388
151	3300049574	Ga0501038_0215323	Ga0501038_0215323_76_1320	388
152	3300049576	Ga0501040_0031728	Ga0501040_0031728_1269_2513	388
153	3300049577	Ga0501041_0005636	Ga0501041_0005636_4035_5279	388
154	3300050507	nmdc:mga05p37_886_c1	nmdc:mga05p37_886_c1_10763_11983	388
155	3300050508	nmdc:mga09592_335_c1	nmdc:mga09592_335_c1_9614_10834	388
156	3300050510	nmdc:mga06r32_276523_c1	nmdc:mga06r32_276523_c1_268_1467	388
157	3300050511	nmdc:mga08y16_1601_c1	nmdc:mga08y16_1601_c1_3521_4741	388
158	3300050511	nmdc:mga08y16_187131_c1	nmdc:mga08y16_187131_c1_888_2108	388
159	3300050512	nmdc:mga0n895_2327_c1	nmdc:mga0n895_2327_c1_9436_10656	388
160	3300050514	nmdc:mga08x19_2723_c1	nmdc:mga08x19_2723_c1_4727_5947	388
161	3300050515	nmdc:mga0a205_144693_c1	nmdc:mga0a205_144693_c1_722_1942	388
162	3300050515	nmdc:mga0a205_505_c1	nmdc:mga0a205_505_c1_12737_13957	388
163	3300005336	Ga0070680_100154412	Ga0070680_1001544122	389
164	3300005367	Ga0070667_100082626	Ga0070667_1000826262	389
165	3300005445	Ga0070708_100275993	Ga0070708_1002759932	389
166	3300005468	Ga0070707_100288563	Ga0070707_1002885631	389
167	3300005471	Ga0070698_100065246	Ga0070698_1000652461	389
168	3300005617	Ga0068859_100110587	Ga0068859_1001105872	389
169	3300006871	Ga0075434_100000414	Ga0075434_10000041432	389
170	3300006931	Ga0097620_100110586	Ga0097620_1001105862	389
171	3300025922	Ga0207646_10013083	Ga0207646_100130837	389
172	3300025986	Ga0207658_10055869	Ga0207658_100558692	389
173	3300028381	Ga0268264_10249497	Ga0268264_102494972	389
174	3300035118	Ga0373954_0001100	Ga0373954_0001100_7311_8549	389
175	3300035410	Ga0373924_0015927	Ga0373924_0015927_1065_2303	389
176	3300035695	Ga0373927_0032263	Ga0373927_0032263_164_1369	389
177	3300035724	Ga0373933_0005942	Ga0373933_0005942_1872_3110	389
178	3300036401	Ga0373937_0001045	Ga0373937_0001045_12519_13757	389
179	3300046476	Ga0495662_0003159	Ga0495662_0003159_5397_6683	389
180	3300046517	Ga0495630_0016274	Ga0495630_0016274_4010_5296	389
181	3300046533	Ga0495640_0023373	Ga0495640_0023373_2475_3761	389
182	3300046675	Ga0495657_0072314	Ga0495657_0072314_651_1889	389
183	3300046690	Ga0495624_0056032	Ga0495624_0056032_588_1874	389
184	3300047317	Ga0495604_0108953	Ga0495604_0108953_289_1575	389
185	3300047319	Ga0495674_0116997	Ga0495674_0116997_458_1744	389
186	3300050512	nmdc:mga0n895_75424_c1	nmdc:mga0n895_75424_c1_679_1884	389
187	3300054114	Ga0501084_0171758	Ga0501084_0171758_103_1452	389
188	3300005440	Ga0070705_100099211	Ga0070705_1000992112	390
189	3300005456	Ga0070678_100063113	Ga0070678_1000631132	390
190	3300005458	Ga0070681_10130580	Ga0070681_101305802	390
191	3300009094	Ga0111539_10109701	Ga0111539_101097012	390
192	3300025912	Ga0207707_10002138	Ga0207707_1000213811	390
193	3300026089	Ga0207648_10109129	Ga0207648_101091292	390
194	3300027462	Ga0210000_1000809	Ga0210000_10008094	390
195	3300031730	Ga0307516_10001281	Ga0307516_1000128126	390
196	3300035085	Ga0373929_0018473	Ga0373929_0018473_118_1374	390
197	3300035114	Ga0373939_0010231	Ga0373939_0010231_25_1284	390
198	3300035691	Ga0373931_0030292	Ga0373931_0030292_54_1304	390
199	3300042461	Ga0439460_0026394	Ga0439460_0026394_88_1440	390
200	3300049576	Ga0501040_0010031	Ga0501040_0010031_2994_4343	390
201	3300049576	Ga0501040_0032649	Ga0501040_0032649_850_2202	390
202	3300049579	Ga0501043_0088611	Ga0501043_0088611_980_2329	390
203	3300049580	Ga0501046_0025673	Ga0501046_0025673_1072_2421	390
204	3300049582	Ga0501048_0016370	Ga0501048_0016370_2846_4195	390
205	3300049587	Ga0501071_0005010	Ga0501071_0005010_4600_5949	390
206	3300049588	Ga0501072_0005483	Ga0501072_0005483_5298_6647	390
207	3300049591	Ga0501075_0004928	Ga0501075_0004928_2638_3987	390
208	3300049592	Ga0501076_0012570	Ga0501076_0012570_3101_4450	390
209	3300049593	Ga0501077_0043433	Ga0501077_0043433_953_2302	390
210	3300049741	Ga0501079_0007800	Ga0501079_0007800_2139_3488	390
211	3300049743	Ga0501081_0004980	Ga0501081_0004980_3022_4371	390
212	3300050511	nmdc:mga08y16_127322_c1	nmdc:mga08y16_127322_c1_353_1651	390
213	3300005535	Ga0070684_100044478	Ga0070684_1000444782	391
214	3300005544	Ga0070686_100009181	Ga0070686_1000091816	391
215	3300006237	Ga0097621_100038135	Ga0097621_1000381352	391
216	3300006358	Ga0068871_100011962	Ga0068871_1000119623	391
217	3300006847	Ga0075431_100110914	Ga0075431_1001109143	391
218	3300035691	Ga0373931_0009180	Ga0373931_0009180_3056_4411	391
219	3300006846	Ga0075430_100027080	Ga0075430_1000270804	392
220	3300027682	Ga0209971_1009358	Ga0209971_10093582	392
221	3300041408	Ga0439453_0002490	Ga0439453_0002490_85_1437	392
222	3300042001	Ga0439441_000324	Ga0439441_000324_2683_4035	392
223	3300042461	Ga0439460_0008868	Ga0439460_0008868_1139_2491	392
224	iso_pu_bacteria	2551306416	2553005827	392
225	iso_pu_bacteria	2923510766	2923514607	392
226	iso_pu_bacteria	639633007	639787577	392
227	3300006846	Ga0075430_100026031	Ga0075430_1000260313	393
228	3300006847	Ga0075431_100171945	Ga0075431_1001719452	393
229	3300025899	Ga0207642_10072520	Ga0207642_100725202	393
230	3300028379	Ga0268266_10032241	Ga0268266_100322415	393
231	3300035724	Ga0373933_0007638	Ga0373933_0007638_4543_5805	393
232	3300036401	Ga0373937_0057809	Ga0373937_0057809_1387_2649	393
233	3300049570	Ga0501033_0003135	Ga0501033_0003135_9536_10879	393
234	3300049572	Ga0501036_0000778	Ga0501036_0000778_18830_20173	393
235	3300049574	Ga0501038_0023557	Ga0501038_0023557_2114_3457	393
236	3300049575	Ga0501039_0009480	Ga0501039_0009480_3252_4595	393
237	3300049576	Ga0501040_0000808	Ga0501040_0000808_2841_4184	393
238	3300049577	Ga0501041_0004667	Ga0501041_0004667_2832_4175	393
239	3300049578	Ga0501042_0032257	Ga0501042_0032257_1304_2647	393
240	3300049579	Ga0501043_0035904	Ga0501043_0035904_491_1834	393
241	3300049580	Ga0501046_0020754	Ga0501046_0020754_1323_2666	393
242	3300049581	Ga0501047_0063450	Ga0501047_0063450_1120_2463	393
243	3300049582	Ga0501048_0021903	Ga0501048_0021903_2012_3355	393
244	3300049584	Ga0501068_0004020	Ga0501068_0004020_3770_5113	393
245	3300049586	Ga0501070_0067027	Ga0501070_0067027_619_1962	393
246	3300049587	Ga0501071_0080750	Ga0501071_0080750_969_2312	393
247	3300049588	Ga0501072_0017479	Ga0501072_0017479_2112_3455	393
248	3300049590	Ga0501074_0041642	Ga0501074_0041642_643_1986	393
249	3300049591	Ga0501075_0007259	Ga0501075_0007259_2760_4103	393
250	3300049592	Ga0501076_0014667	Ga0501076_0014667_1716_3059	393
251	3300049593	Ga0501077_0005485	Ga0501077_0005485_2849_4192	393
252	3300049741	Ga0501079_0017859	Ga0501079_0017859_2752_4095	393
253	3300049742	Ga0501080_0056773	Ga0501080_0056773_399_1742	393
254	3300049743	Ga0501081_0000810	Ga0501081_0000810_2078_3421	393
255	3300049822	Ga0501035_0030604	Ga0501035_0030604_704_2047	393
256	3300049824	Ga0501045_0022182	Ga0501045_0022182_1983_3326	393
257	3300050509	nmdc:mga0qj67_6200_c1	nmdc:mga0qj67_6200_c1_1901_3250	393
258	3300054114	Ga0501084_0001603	Ga0501084_0001603_14808_16151	393
259	3300060353	Ga0501082_0015756	Ga0501082_0015756_1201_2544	393
260	3300061734	Ga0530510_0010946	Ga0530510_0010946_2832_4175	393
261	iso_pu_bacteria	2574179768	2574432969	394
262	3300005354	Ga0070675_100263582	Ga0070675_1002635822	395
263	3300005366	Ga0070659_100150123	Ga0070659_1001501232	395
264	3300005843	Ga0068860_100199310	Ga0068860_1001993102	395
265	3300013308	Ga0157375_10026773	Ga0157375_100267736	395
266	3300014968	Ga0157379_10057874	Ga0157379_100578743	395
267	3300025932	Ga0207690_10127157	Ga0207690_101271572	395
268	3300025940	Ga0207691_10059002	Ga0207691_100590022	395
269	3300026121	Ga0207683_10024014	Ga0207683_100240142	395
270	3300028381	Ga0268264_10030457	Ga0268264_100304575	395
271	iso_pu_bacteria	2643221654	2644302587	395
272	3300003751	Ga0055538_1000053	Ga0055538_1000053105	396
273	3300003752	Ga0055539_1000078	Ga0055539_1000078105	396
274	3300003756	Ga0055533_1000084	Ga0055533_1000084105	396
275	3300003759	Ga0055525_1000112	Ga0055525_100011217	396
276	3300003841	Ga0055541_1000055	Ga0055541_100005517	396
277	3300021361	Ga0213872_10024053	Ga0213872_100240532	396
278	3300025224	Ga0209784_100035	Ga0209784_10003518	396
279	3300025225	Ga0209566_100040	Ga0209566_10004018	396
280	3300025226	Ga0209674_100057	Ga0209674_10005718	396
281	3300025230	Ga0209563_100059	Ga0209563_10005918	396
282	3300025253	Ga0209677_100036	Ga0209677_10003618	396
283	3300037471	Ga0395905_0050153	Ga0395905_0050153_525_1718	396
284	3300039447	Ga0436361_1015675	Ga0436361_1015675_631_1824	396
285	3300046522	Ga0495643_0006544	Ga0495643_0006544_5425_6618	396
286	3300046542	Ga0495597_0020197	Ga0495597_0020197_1042_2235	396
287	3300046616	Ga0495668_0033594	Ga0495668_0033594_470_1663	396
288	3300046665	Ga0495661_0030433	Ga0495661_0030433_58_1251	396
289	3300005536	Ga0070697_100004195	Ga0070697_1000041953	397
290	3300005545	Ga0070695_100014991	Ga0070695_1000149913	397
291	3300005546	Ga0070696_100023207	Ga0070696_1000232073	397
292	3300006914	Ga0075436_100025180	Ga0075436_1000251804	397
293	3300026067	Ga0207678_10189150	Ga0207678_101891502	397
294	3300036401	Ga0373937_0040741	Ga0373937_0040741_782_1975	397
295	iso_pu_bacteria	2643221644	2644246760	397
296	3300005336	Ga0070680_100002637	Ga0070680_10000263713	398
297	3300005367	Ga0070667_100042093	Ga0070667_1000420933	398
298	3300005367	Ga0070667_100142689	Ga0070667_1001426892	398
299	3300005435	Ga0070714_100047357	Ga0070714_1000473572	398
300	3300005518	Ga0070699_100007220	Ga0070699_10000722010	398
301	3300005530	Ga0070679_100028971	Ga0070679_1000289713	398
302	3300005616	Ga0068852_100261332	Ga0068852_1002613322	398
303	3300005842	Ga0068858_100010244	Ga0068858_1000102447	398
304	3300006914	Ga0075436_100006380	Ga0075436_1000063803	398
305	3300006914	Ga0075436_100020290	Ga0075436_1000202903	398
306	3300009177	Ga0105248_10325757	Ga0105248_103257572	398
307	3300014968	Ga0157379_10011288	Ga0157379_100112884	398
308	3300021361	Ga0213872_10003582	Ga0213872_100035828	398
309	3300025917	Ga0207660_10041212	Ga0207660_100412124	398
310	3300025921	Ga0207652_10017870	Ga0207652_100178703	398
311	3300025929	Ga0207664_10273393	Ga0207664_102733931	398
312	3300025941	Ga0207711_10232973	Ga0207711_102329731	398
313	3300039437	Ga0436365_0787708	Ga0436365_0787708_2992_4191	398
314	3300039447	Ga0436361_0088190	Ga0436361_0088190_12237_13439	398
315	3300050514	nmdc:mga08x19_24618_c1	nmdc:mga08x19_24618_c1_827_2125	398
316	iso_pu_bacteria	2643221609	2644061292	398
317	iso_pu_bacteria	2643221611	2644076667	398
318	iso_pu_bacteria	2738543012	2739243618	398
319	iso_pu_bacteria	2816332133	2816474167	398
320	3300003187	JGI25151J46595_10012322	JGI25151J46595_100123222	399
321	3300003203	JGI25406J46586_10042093	JGI25406J46586_100420931	399
322	3300005331	Ga0070670_100181067	Ga0070670_1001810672	399
323	3300005338	Ga0068868_100001858	Ga0068868_10000185810	399
324	3300005356	Ga0070674_100023097	Ga0070674_1000230972	399
325	3300005356	Ga0070674_100156966	Ga0070674_1001569661	399
326	3300005364	Ga0070673_100021371	Ga0070673_1000213713	399
327	3300005459	Ga0068867_100021885	Ga0068867_1000218854	399
328	3300005985	Ga0081539_10000233	Ga0081539_1000023377	399
329	3300006173	Ga0070716_100133675	Ga0070716_1001336751	399
330	3300006177	Ga0075362_10025222	Ga0075362_100252222	399
331	3300006195	Ga0075366_10033949	Ga0075366_100339492	399
332	3300006195	Ga0075366_10073618	Ga0075366_100736182	399
333	3300006353	Ga0075370_10017440	Ga0075370_100174404	399
334	3300009098	Ga0105245_10039479	Ga0105245_100394793	399
335	3300014968	Ga0157379_10055699	Ga0157379_100556992	399
336	3300025294	Ga0209025_1000115	Ga0209025_100011586	399
337	3300025907	Ga0207645_10008084	Ga0207645_100080843	399
338	3300025933	Ga0207706_10054169	Ga0207706_100541693	399
339	3300025937	Ga0207669_10215360	Ga0207669_102153601	399
340	3300025939	Ga0207665_10193958	Ga0207665_101939581	399
341	3300025940	Ga0207691_10036555	Ga0207691_100365552	399
342	3300025942	Ga0207689_10008405	Ga0207689_100084056	399
343	3300026023	Ga0207677_10006101	Ga0207677_100061013	399
344	3300026023	Ga0207677_10034627	Ga0207677_100346271	399
345	3300026089	Ga0207648_10007584	Ga0207648_100075844	399
346	3300026116	Ga0207674_10153898	Ga0207674_101538982	399
347	3300027665	Ga0209983_1006467	Ga0209983_10064672	399
348	3300028794	Ga0307515_10101926	Ga0307515_101019263	399
349	3300031238	Ga0265332_10002264	Ga0265332_100022647	399
350	3300031456	Ga0307513_10002887	Ga0307513_1000288713	399
351	3300031730	Ga0307516_10058155	Ga0307516_100581553	399
352	3300031730	Ga0307516_10095035	Ga0307516_100950352	399
353	3300035170	Ga0373943_0058133	Ga0373943_0058133_252_1484	399
354	3300035691	Ga0373931_0017464	Ga0373931_0017464_1896_3098	399
355	3300037466	Ga0395898_0226832	Ga0395898_0226832_154_1356	399
356	3300037471	Ga0395905_0001148	Ga0395905_0001148_21979_23193	399
357	3300037471	Ga0395905_0002159	Ga0395905_0002159_1344_2546	399
358	3300037471	Ga0395905_0269536	Ga0395905_0269536_283_1485	399
359	3300042876	Ga0451577_0001465	Ga0451577_0001465_22698_23900	399
360	3300046457	Ga0495590_0033610	Ga0495590_0033610_392_1594	399
361	3300046459	Ga0495629_0000206	Ga0495629_0000206_21908_23110	399
362	3300046463	Ga0495653_0080001	Ga0495653_0080001_605_1807	399
363	3300046471	Ga0495650_0000688	Ga0495650_0000688_33959_35161	399
364	3300046472	Ga0495580_0013828	Ga0495580_0013828_1112_2314	399
365	3300046473	Ga0495582_0012981	Ga0495582_0012981_455_1657	399
366	3300046475	Ga0495639_0013122	Ga0495639_0013122_1462_2664	399
367	3300046477	Ga0495664_0029928	Ga0495664_0029928_977_2188	399
368	3300046543	Ga0495645_0000416	Ga0495645_0000416_8490_9692	399
369	3300046543	Ga0495645_0004251	Ga0495645_0004251_4269_5480	399
370	3300046684	Ga0495669_0010111	Ga0495669_0010111_409_1611	399
371	3300046689	Ga0495613_0057013	Ga0495613_0057013_1005_2207	399
372	3300046794	Ga0495589_0007455	Ga0495589_0007455_2880_4082	399
373	3300047315	Ga0495581_0010923	Ga0495581_0010923_3832_5034	399
374	3300047443	Ga0495687_002139	Ga0495687_002139_7603_8802	399
375	3300048907	Ga0496104_0014478	Ga0496104_0014478_2036_3238	399
376	3300048908	Ga0496105_0037385	Ga0496105_0037385_1254_2456	399
377	3300048917	Ga0496114_0000931	Ga0496114_0000931_2187_3389	399
378	3300048924	Ga0496121_0000511	Ga0496121_0000511_45530_46732	399
379	3300048929	Ga0496126_0094680	Ga0496126_0094680_365_1567	399
380	3300050493	nmdc:mga0k408_44979_c1	nmdc:mga0k408_44979_c1_857_2056	399

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

12

52

0.96 PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

15

62

0.95 PF01494

FAD_binding_3

FAD binding domain

10

355

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3ado-assembly1.cif.gz_A	crystal structure of the rabbit l-gulonate 3-dehydrogenase	0.9344	9	40
4r1n-assembly1.cif.gz_A	crystal structure of (s)-3-hydroxybutylryl-coa dehydrogenase form the n-butanol sysnthesizing bacterium, clostridium butyricum.	0.9209	8	38
4bk3-assembly1.cif.gz_A-2	crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant	0.9205	4	393
4bjz-assembly1.cif.gz_A	crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: native data	0.92	4	393
4bjy-assembly1.cif.gz_A-2	crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: platinum derivative	0.9186	4	393

ID	Description	Score	Start	End	Superfamily
af_P76440_125_245_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9561	9	41	3.50.50.60
2vq3B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9462	9	38	3.40.50.720
af_P9WJL5_17_103_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9275	8	40	3.40.50.720
af_O61709_2_252_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9274	10	38	3.40.50.720
af_Q2FYG1_1_188_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9256	8	38	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A5Z5KU83-F1-model_v4	3-hydroxybenzoate 6-monooxygenase (EC 1.14.13.24)	0.9795	3	288	GO:0018669 GO:0071949
AF-E5XS53-F1-model_v4	Salicylate hydroxylase	0.9724	8	389	GO:0004497 GO:0071949
AF-A0A5Z5KU83-F1-model_v4	3-hydroxybenzoate 6-monooxygenase (EC 1.14.13.24)	0.9694	3	288	GO:0018669 GO:0071949
AF-F3P8B8-F1-model_v4	FAD dependent oxidoreductase	0.9663	9	389	GO:0004497 GO:0071949
AF-A0A3B0S5S6-F1-model_v4	FAD-binding domain-containing protein	0.9653	9	393	GO:0004497 GO:0071949

Feature Viewer

pLDDT	pTM	Quality
89.14	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F428532

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00890

FAD_binding_2

FAD binding domain

12

52

0.96

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

15

62

0.95

PF01494

FAD_binding_3

FAD binding domain

10

355

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map