F428538

General Info

Members Datasets Scaffolds Average Seq Length
380 233 341 201

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1022747|Ga0055536_10227472
Length 233
Sequence MNPLYLASGSPRRRELLTQIGVPFSVVSAPIDETPLPDESAPAYVERLARAKAAAGLASLEQPVQAIRGHARSHRYSADPVGAGVPAKAPTGPAVVLGADTAVVLDGRILGKPESREDALAMLADLSGREHQVLTAVALSDGQRVQSLCVTSKVRFRAISADEAQRYWASGEPADKAGGYAIQGLGAVFVTGLSGSYSAVVGLPLSETADLLGQFGIACWQSPAHMPEVTKQR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231024 Pseudomonas sp. GM84 Isolate Nodule
3 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
4 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
5 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
6 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
7 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
8 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
9 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
10 2721755523 Delftia sp. HK171 Isolate Unclassified
11 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
12 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
13 2765235841 Pseudomonas putida AA7 Isolate Unclassified
14 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
15 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
16 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
17 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
18 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
19 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
20 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
21 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
22 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
23 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
24 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
25 2904504865 Serratia marcescens 1822 Isolate Unclassified
26 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
27 2919150387 Rahnella aceris 1817 Isolate Unclassified
28 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
29 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
30 2927143783 Rahnella sp. 2050 Isolate Unclassified
31 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
32 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
100 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
101 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
117 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
118 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
122 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
123 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
124 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
125 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
126 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
127 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
128 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
129 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
135 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
136 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
227 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
228 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
229 8052494512 Pseudomonas putida LD6 Isolate Unclassified
230 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
231 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
232 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
233 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.42
Metatranscriptomes 1.32
Isolates 10.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.05
Nodule 1.58
Rhizoplane 2.11
Rhizosphere 72.37
Stem 0
Stem Tuber 1.32
Unclassified 16.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1427809 2162886007 Bacteria 817
2 SwRhRL2b_contig_535727 2162886007 Bacteria 2274
3 SwRhRL2b_contig_803606 2162886007 Bacteria 3476
4 JGI25162J39368_1000031 3300002737 Bacteria 210480
5 JGI25163J39215_1000033 3300002771 Bacteria 64420
6 JGI25163J39215_1000094 3300002771 Bacteria 37245
7 JGI25164J39214_1000050 3300002772 Bacteria 122934
8 JGI25165J46597_1020576 3300003214 Bacteria 864
9 rootH1_10024335 3300003316 Bacteria 2982
10 Ga0055538_1000004 3300003751 Bacteria 615646
11 Ga0055539_1000004 3300003752 Bacteria 615646
12 Ga0055533_1000007 3300003756 Bacteria 615646
13 Ga0055525_1000007 3300003759 Bacteria 615646
14 Ga0055536_1022747 3300003781 Bacteria 1860
15 Ga0055541_1000004 3300003841 Bacteria 615646
16 Ga0058692_1038434 3300003856 Bacteria 854
17 Ga0065704_10000928 3300005289 Bacteria 35626
18 Ga0065704_10246403 3300005289 Bacteria 1001
19 Ga0065704_10387204 3300005289 Bacteria 765
20 Ga0070658_10031247 3300005327 Bacteria 4275
21 Ga0070680_100098803 3300005336 Bacteria 2422
22 Ga0070660_100294246 3300005339 Bacteria 1330
23 Ga0070703_10183293 3300005406 Bacteria 810
24 Ga0070663_100087698 3300005455 Bacteria 2300
25 Ga0070695_100106878 3300005545 Bacteria 1893
26 Ga0070704_100007380 3300005549 Bacteria 6544
27 Ga0070704_100659173 3300005549 Bacteria 925
28 Ga0068855_100041739 3300005563 Bacteria 5436
29 Ga0075432_10011442 3300006058 Bacteria 3014
30 Ga0075431_100257451 3300006847 Bacteria 1772
31 Ga0099823_1012435 3300006944 Bacteria 8603
32 Ga0099823_1080803 3300006944 Bacteria 1259
33 Ga0079104_1000011 3300006946 Bacteria 359962
34 Ga0105251_10000030 3300009011 Bacteria 124407
35 Ga0105251_10003994 3300009011 Bacteria 10435
36 Ga0105251_10021341 3300009011 Bacteria 3384
37 Ga0105251_10046027 3300009011 Bacteria 2101
38 Ga0105244_10000205 3300009036 Bacteria 60526
39 Ga0105244_10000766 3300009036 Bacteria 27448
40 Ga0105244_10005346 3300009036 Bacteria 8546
41 Ga0105244_10008768 3300009036 Bacteria 6283
42 Ga0105244_10012301 3300009036 Bacteria 5059
43 Ga0105244_10040827 3300009036 Bacteria 2407
44 Ga0105244_10042609 3300009036 Bacteria 2345
45 Ga0105244_10081762 3300009036 Bacteria 1598
46 Ga0105244_10286378 3300009036 Bacteria 764
47 Ga0105250_10000098 3300009092 Bacteria 78269
48 Ga0105250_10000503 3300009092 Bacteria 27444
49 Ga0105250_10001942 3300009092 Bacteria 10720
50 Ga0105250_10015837 3300009092 Bacteria 3082
51 Ga0105250_10018222 3300009092 Bacteria 2847
52 Ga0105250_10034781 3300009092 Bacteria 2021
53 Ga0105250_10145837 3300009092 Bacteria 983
54 Ga0105240_10219599 3300009093 Bacteria 2215
55 Ga0111539_10040694 3300009094 Bacteria 5593
56 Ga0105243_10003542 3300009148 Bacteria 12617
57 Ga0105243_10100338 3300009148 Bacteria 2401
58 Ga0105237_10037617 3300009545 Bacteria 4889
59 Ga0157371_10000272 3300013102 Bacteria 70187
60 Ga0157371_10014176 3300013102 Bacteria 6026
61 Ga0157370_10001028 3300013104 Bacteria 35085
62 Ga0157370_10001406 3300013104 Bacteria 29865
63 Ga0157370_10291633 3300013104 Bacteria 1507
64 Ga0157370_10298151 3300013104 Bacteria 1488
65 Ga0157370_10394277 3300013104 Bacteria 1275
66 Ga0157369_10000658 3300013105 Bacteria 44725
67 Ga0157369_10001653 3300013105 Bacteria 27194
68 Ga0163162_10010172 3300013306 Bacteria 9137
69 Ga0157372_10004227 3300013307 Bacteria 15354
70 Ga0157372_10069323 3300013307 Bacteria 3966
71 Ga0157372_10070941 3300013307 Bacteria 3921
72 Ga0157372_10869225 3300013307 Bacteria 1047
73 Ga0163163_10093927 3300014325 Bacteria 3016
74 Ga0157380_10443336 3300014326 Bacteria 1245
75 Ga0182006_1012933 3300015261 Bacteria 3640
76 Ga0163161_10148181 3300017792 Bacteria 1782
77 Ga0206356_10177199 3300020070 Bacteria 3169
78 Ga0206354_10837954 3300020081 Bacteria 2705
79 Ga0206354_11698642 3300020081 Bacteria 1999
80 Ga0206353_11156468 3300020082 Bacteria 6281
81 Ga0224712_10000560 3300022467 Bacteria 7535
82 Ga0209760_100006 3300025207 Bacteria 224535
83 Ga0209784_100001 3300025224 Bacteria 3600592
84 Ga0209566_100001 3300025225 Bacteria 3600765
85 Ga0209674_100002 3300025226 Bacteria 3600592
86 Ga0209563_100008 3300025230 Bacteria 1554545
87 Ga0207427_100002 3300025231 Bacteria 1355321
88 Ga0209437_100114 3300025233 Bacteria 210697
89 Ga0209677_100004 3300025253 Bacteria 1554545
90 Ga0209233_1001180 3300025261 Bacteria 10545
91 Ga0209676_1000525 3300025292 Bacteria 59894
92 Ga0207696_1000027 3300025711 Bacteria 412783
93 Ga0207696_1000054 3300025711 Bacteria 266962
94 Ga0207696_1000120 3300025711 Bacteria 146581
95 Ga0207696_1000511 3300025711 Bacteria 32258
96 Ga0207696_1003225 3300025711 Bacteria 7525
97 Ga0207696_1005297 3300025711 Bacteria 5369
98 Ga0207655_1000209 3300025728 Bacteria 102459
99 Ga0207655_1000397 3300025728 Bacteria 60486
100 Ga0207655_1000852 3300025728 Bacteria 32517
101 Ga0207655_1001011 3300025728 Bacteria 28609
102 Ga0207655_1002990 3300025728 Bacteria 12957
103 Ga0207655_1005648 3300025728 Bacteria 8460
104 Ga0207655_1010062 3300025728 Bacteria 5785
105 Ga0207655_1055521 3300025728 Bacteria 1567
106 Ga0207655_1138433 3300025728 Bacteria 784
107 Ga0207713_1000013 3300025735 Bacteria 475751
108 Ga0207713_1005719 3300025735 Bacteria 7711
109 Ga0207713_1006622 3300025735 Bacteria 7022
110 Ga0207713_1010006 3300025735 Bacteria 5289
111 Ga0207713_1049293 3300025735 Bacteria 1690
112 Ga0207705_10000877 3300025909 Bacteria 24646
113 Ga0207695_10185372 3300025913 Bacteria 2000
114 Ga0207671_10034264 3300025914 Bacteria 3773
115 Ga0207660_10304895 3300025917 Bacteria 1269
116 Ga0207657_10265498 3300025919 Bacteria 1365
117 Ga0207709_10000245 3300025935 Bacteria 66704
118 Ga0207709_10065054 3300025935 Bacteria 2292
119 Ga0207667_10020073 3300025949 Bacteria 7441
120 Ga0207678_10046689 3300026067 Bacteria 3745
121 Ga0209281_1000005 3300027111 Bacteria 1242284
122 Ga0209389_1000005 3300027296 Bacteria 232255
123 Ga0209371_1001397 3300027312 Bacteria 16570
124 Ga0207428_10098734 3300027907 Bacteria 2259
125 Ga0268256_1000731 3300030500 Bacteria 24134
126 Ga0316576_10060286 3300031727 Bacteria 2779
127 Ga0316577_10147806 3300031733 Bacteria 1324
128 Ga0307413_10014120 3300031824 Bacteria 4043
129 Ga0307414_10221971 3300032004 Bacteria 1552
130 Ga0373942_0126125 3300035207 Bacteria 804
131 Ga0316574_0292913 3300035398 Bacteria 1036
132 Ga0373931_0400419 3300035691 Bacteria 869
133 Ga0316584_0036410 3300036712 Bacteria 3652
134 Ga0316584_0072871 3300036712 Bacteria 2574
135 Ga0395899_0000038 3300037312 Bacteria 272627
136 Ga0395899_0029437 3300037312 Bacteria 4130
137 Ga0395900_0000030 3300037418 Bacteria 272630
138 Ga0395900_0090338 3300037418 Bacteria 3148
139 Ga0395900_0306126 3300037418 Bacteria 1574
140 Ga0395900_0317053 3300037418 Bacteria 1540
141 Ga0395900_0964938 3300037418 Bacteria 773
142 Ga0395898_0000409 3300037466 Bacteria 92805
143 Ga0395898_0001892 3300037466 Bacteria 26705
144 Ga0395898_0007065 3300037466 Bacteria 11925
145 Ga0395898_0448105 3300037466 Bacteria 1229
146 Ga0395901_0000002 3300038443 Bacteria 761045
147 Ga0395901_0000079 3300038443 Bacteria 134462
148 Ga0395901_0000417 3300038443 Bacteria 50166
149 Ga0395901_0041024 3300038443 Bacteria 4795
150 Ga0439438_006011 3300041405 Bacteria 4368
151 Ga0439447_000509 3300041407 Bacteria 14449
152 Ga0439466_0033294 3300041411 Bacteria 1751
153 Ga0439431_0011602 3300041997 Bacteria 2015
154 Ga0439431_0011693 3300041997 Bacteria 2008
155 Ga0439432_007748 3300042006 Bacteria 3791
156 Ga0439452_007287 3300042010 Bacteria 3396
157 Ga0439456_027105 3300042013 Bacteria 1220
158 Ga0450911_000023 3300042115 Bacteria 90815
159 Ga0450923_038047 3300042125 Bacteria 1002
160 Ga0450892_013825 3300042130 Bacteria 739
161 Ga0450902_000691 3300042137 Bacteria 4305
162 Ga0450903_011175 3300042138 Bacteria 1448
163 Ga0450904_000029 3300042139 Bacteria 33345
164 Ga0450905_000962 3300042142 Bacteria 3609
165 Ga0450905_002178 3300042142 Bacteria 2506
166 Ga0450905_018321 3300042142 Bacteria 1019
167 Ga0439446_0012165 3300042156 Bacteria 2347
168 Ga0450909_020683 3300042185 Bacteria 981
169 Ga0439434_0001788 3300042435 Bacteria 6252
170 Ga0439459_0042447 3300042438 Bacteria 971
171 Ga0439459_0093800 3300042438 Bacteria 725
172 Ga0450916_008836 3300042530 Bacteria 1234
173 Ga0450893_0000296 3300042532 Bacteria 6852
174 Ga0450901_002988 3300042533 Bacteria 1785
175 Ga0466969_0000452 3300044656 Bacteria 22549
176 Ga0466969_0032411 3300044656 Bacteria 2656
177 Ga0466972_0017603 3300044658 Bacteria 3577
178 Ga0466972_0371547 3300044658 Bacteria 669
179 Ga0466973_0023885 3300044659 Bacteria 5856
180 Ga0466965_0000061 3300044683 Bacteria 34238
181 Ga0466965_0106135 3300044683 Bacteria 1440
182 Ga0466966_0000299 3300044684 Bacteria 32487
183 Ga0466966_0000620 3300044684 Bacteria 22564
184 Ga0466966_0005336 3300044684 Bacteria 8455
185 Ga0466961_0000407 3300044693 Bacteria 27641
186 Ga0466961_0017374 3300044693 Bacteria 4620
187 Ga0466961_0039809 3300044693 Bacteria 3013
188 Ga0466963_0000485 3300044694 Bacteria 18512
189 Ga0466963_0001568 3300044694 Bacteria 12385
190 Ga0466963_0001629 3300044694 Bacteria 12224
191 Ga0466963_0104522 3300044694 Bacteria 1941
192 Ga0466971_0009934 3300044719 Bacteria 4158
193 Ga0466971_0025970 3300044719 Bacteria 2616
194 Ga0466971_0279748 3300044719 Bacteria 798
195 Ga0466968_0078819 3300044735 Bacteria 1444
196 Ga0466970_0029594 3300044765 Bacteria 2884
197 Ga0466957_0000780 3300044842 Bacteria 16285
198 Ga0466957_0001222 3300044842 Bacteria 13398
199 Ga0466957_0032698 3300044842 Bacteria 3116
200 Ga0466957_0154033 3300044842 Bacteria 1488
201 Ga0466959_0043786 3300045049 Bacteria 3298
202 Ga0466959_0095291 3300045049 Bacteria 2134
203 Ga0466959_0133186 3300045049 Bacteria 1760
204 Ga0466958_0001247 3300045836 Bacteria 11905
205 Ga0466958_0089057 3300045836 Bacteria 1907
206 Ga0466958_0121951 3300045836 Bacteria 1632
207 Ga0495627_000967 3300046453 Bacteria 19607
208 Ga0495603_0105650 3300046455 Bacteria 1643
209 Ga0495650_0000004 3300046471 Bacteria 779487
210 Ga0495650_0040521 3300046471 Bacteria 1998
211 Ga0495607_0000499 3300046501 Bacteria 39205
212 Ga0495607_0032906 3300046501 Bacteria 3159
213 Ga0495606_0000314 3300046507 Bacteria 83573
214 Ga0495620_0000097 3300046515 Bacteria 69944
215 Ga0495631_0006685 3300046518 Bacteria 5926
216 Ga0495632_0000882 3300046519 Bacteria 26332
217 Ga0495632_0013612 3300046519 Bacteria 4631
218 Ga0495632_0035128 3300046519 Bacteria 2560
219 Ga0495632_0265359 3300046519 Bacteria 767
220 Ga0495637_0029007 3300046520 Bacteria 2466
221 Ga0495637_0033198 3300046520 Bacteria 2269
222 Ga0495643_0000296 3300046522 Bacteria 70161
223 Ga0495643_0001539 3300046522 Bacteria 20656
224 Ga0495643_0001931 3300046522 Bacteria 17458
225 Ga0495643_0005275 3300046522 Bacteria 8781
226 Ga0495648_0001799 3300046524 Bacteria 20624
227 Ga0495652_0203022 3300046529 Bacteria 1503
228 Ga0495654_0001659 3300046530 Bacteria 15077
229 Ga0495597_0057408 3300046542 Bacteria 1703
230 Ga0495633_0112663 3300046558 Bacteria 1261
231 Ga0495668_0113844 3300046616 Bacteria 1479
232 Ga0495625_0258718 3300046660 Bacteria 1127
233 Ga0495671_0004893 3300046692 Bacteria 7924
234 Ga0495671_0078350 3300046692 Bacteria 1620
235 Ga0495649_0003812 3300046694 Bacteria 9981
236 Ga0495649_0053118 3300046694 Bacteria 2194
237 Ga0495660_0000022 3300046810 Bacteria 284337
238 Ga0495660_0002518 3300046810 Bacteria 11684
239 Ga0495636_0154153 3300047318 Bacteria 1032
240 Ga0495672_0020541 3300047320 Bacteria 4323
241 Ga0495672_0037002 3300047320 Bacteria 2991
242 Ga0495672_0354025 3300047320 Bacteria 681
243 Ga0495676_0012574 3300047321 Bacteria 7620
244 Ga0495683_0002233 3300047323 Bacteria 11841
245 Ga0495681_0018007 3300047470 Bacteria 3906
246 Ga0495686_0117818 3300047472 Bacteria 1586
247 Ga0496104_0002690 3300048907 Bacteria 15307
248 Ga0496110_0149463 3300048913 Bacteria 2114
249 Ga0496111_0294887 3300048914 Bacteria 1202
250 Ga0496114_0012048 3300048917 Bacteria 6918
251 Ga0496114_0143678 3300048917 Bacteria 2067
252 Ga0496116_0000188 3300048919 Bacteria 123223
253 Ga0496116_0000856 3300048919 Bacteria 38095
254 Ga0496117_0003327 3300048920 Bacteria 18774
255 Ga0496117_0003843 3300048920 Bacteria 17088
256 Ga0496117_0037286 3300048920 Bacteria 3623
257 Ga0496117_0065891 3300048920 Bacteria 2459
258 Ga0496118_0004697 3300048921 Bacteria 16010
259 Ga0496118_0007206 3300048921 Bacteria 11880
260 Ga0496118_0010843 3300048921 Bacteria 8975
261 Ga0496118_0043542 3300048921 Bacteria 3526
262 Ga0496118_0135524 3300048921 Bacteria 1572
263 Ga0496118_0345821 3300048921 Bacteria 795
264 Ga0496119_0000100 3300048922 Bacteria 125646
265 Ga0496119_0023442 3300048922 Bacteria 4375
266 Ga0496119_0062355 3300048922 Bacteria 2222
267 Ga0496120_0000440 3300048923 Bacteria 65855
268 Ga0496120_0001920 3300048923 Bacteria 22935
269 Ga0496120_0001940 3300048923 Bacteria 22692
270 Ga0496121_0162538 3300048924 Bacteria 1631
271 Ga0496121_0279642 3300048924 Bacteria 1142
272 Ga0496121_0287736 3300048924 Bacteria 1121
273 Ga0496122_0000070 3300048925 Bacteria 223198
274 Ga0496122_0003209 3300048925 Bacteria 21749
275 Ga0496122_0015082 3300048925 Bacteria 7413
276 Ga0496122_0191066 3300048925 Bacteria 1208
277 Ga0496123_0000183 3300048926 Bacteria 126284
278 Ga0496123_0002633 3300048926 Bacteria 21749
279 Ga0496123_0034239 3300048926 Bacteria 3642
280 Ga0496123_0038723 3300048926 Bacteria 3346
281 Ga0496124_0000169 3300048927 Bacteria 131658
282 Ga0496124_0000851 3300048927 Bacteria 49781
283 Ga0496124_0034167 3300048927 Bacteria 4466
284 Ga0496124_0040368 3300048927 Bacteria 4037
285 Ga0496124_0132814 3300048927 Bacteria 1975
286 Ga0496124_0329061 3300048927 Bacteria 1090
287 Ga0496125_0000056 3300048928 Bacteria 271016
288 Ga0496125_0000489 3300048928 Bacteria 69291
289 Ga0496125_0010466 3300048928 Bacteria 9381
290 Ga0496125_0068080 3300048928 Bacteria 2802
291 Ga0496125_0174850 3300048928 Bacteria 1438
292 Ga0496126_0000137 3300048929 Bacteria 167415
293 Ga0496126_0020460 3300048929 Bacteria 6485
294 Ga0496126_0059985 3300048929 Bacteria 3424
295 Ga0496126_0088569 3300048929 Bacteria 2726
296 Ga0496126_0172740 3300048929 Bacteria 1840
297 Ga0495678_031054 3300049459 Bacteria 2231
298 Ga0495682_0004592 3300049460 Bacteria 5876
299 Ga0501034_0000020 3300049571 Bacteria 280294
300 Ga0501036_0117595 3300049572 Bacteria 2245
301 Ga0501036_0825448 3300049572 Bacteria 763
302 Ga0501037_0160735 3300049573 Bacteria 1601
303 Ga0501038_0049170 3300049574 Bacteria 3647
304 Ga0501039_0014549 3300049575 Bacteria 6025
305 Ga0501040_0009031 3300049576 Bacteria 6484
306 Ga0501041_0002581 3300049577 Bacteria 10334
307 Ga0501042_0062995 3300049578 Bacteria 2650
308 Ga0501043_0096133 3300049579 Bacteria 2328
309 Ga0501046_0033923 3300049580 Bacteria 4122
310 Ga0501048_0211221 3300049582 Bacteria 1376
311 Ga0501068_0030919 3300049584 Bacteria 3178
312 Ga0501069_0409316 3300049585 Bacteria 803
313 Ga0501071_0064945 3300049587 Bacteria 2649
314 Ga0501071_0588014 3300049587 Bacteria 856
315 Ga0501072_0138171 3300049588 Bacteria 1943
316 Ga0501075_0008928 3300049591 Bacteria 6994
317 Ga0501076_0031132 3300049592 Bacteria 4159
318 Ga0501076_0396033 3300049592 Bacteria 1135
319 Ga0501079_0005531 3300049741 Bacteria 9422
320 Ga0501079_0114124 3300049741 Bacteria 2100
321 Ga0501080_0024616 3300049742 Bacteria 5582
322 Ga0501080_0975444 3300049742 Bacteria 736
323 Ga0501081_0022274 3300049743 Bacteria 4237
324 Ga0501081_0319456 3300049743 Bacteria 1141
325 Ga0501044_0924295 3300049823 Bacteria 746
326 Ga0501045_0097635 3300049824 Bacteria 2173
327 Ga0501226_000002 3300049853 Bacteria 426935
328 nmdc:mga06r32_247229_c1 3300050510 Bacteria 1771
329 nmdc:mga08y16_608493_c1 3300050511 Bacteria 1101
330 Ga0500618_017273 3300053125 Bacteria 1796
331 Ga0500659_0002940 3300053135 Bacteria 10166
332 Ga0501084_0015578 3300054114 Bacteria 6306
333 Ga0590071_032815 3300059421 Bacteria 1240
334 Ga0590077_031157 3300059426 Bacteria 1165
335 Ga0501082_0016576 3300060353 Bacteria 6344
336 Ga0501082_0530275 3300060353 Bacteria 1029
337 Ga0466962_0001625 3300061719 Bacteria 10527
338 Ga0466962_0044505 3300061719 Bacteria 2124
339 Ga0466962_0137089 3300061719 Bacteria 1184
340 Ga0466962_0359656 3300061719 Bacteria 725
341 Ga0530510_0048200 3300061734 Bacteria 3079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0017603 Ga0466972_0017603_803_1432 159
2 3300037418 Ga0395900_0964938 Ga0395900_0964938_55_684 161
3 3300037466 Ga0395898_0448105 Ga0395898_0448105_427_1056 161
4 3300038443 Ga0395901_0000079 Ga0395901_0000079_109199_109828 161
5 3300044684 Ga0466966_0000620 Ga0466966_0000620_7809_8438 161
6 3300044694 Ga0466963_0001629 Ga0466963_0001629_11026_11655 161
7 3300044719 Ga0466971_0009934 Ga0466971_0009934_1937_2566 161
8 3300044842 Ga0466957_0032698 Ga0466957_0032698_2089_2718 161
9 3300061719 Ga0466962_0001625 Ga0466962_0001625_8555_9184 161
10 3300044693 Ga0466961_0039809 Ga0466961_0039809_2238_2867 163
11 3300037312 Ga0395899_0029437 Ga0395899_0029437_2204_2839 165
12 3300037418 Ga0395900_0306126 Ga0395900_0306126_733_1368 165
13 3300037312 Ga0395899_0000038 Ga0395899_0000038_70347_70982 172
14 3300037418 Ga0395900_0000030 Ga0395900_0000030_201657_202292 172
15 3300037466 Ga0395898_0000409 Ga0395898_0000409_62118_62753 172
16 3300044658 Ga0466972_0371547 Ga0466972_0371547_44_598 172
17 3300044735 Ga0466968_0078819 Ga0466968_0078819_868_1428 174
18 3300048925 Ga0496122_0015082 Ga0496122_0015082_89_709 175
19 3300037418 Ga0395900_0090338 Ga0395900_0090338_1102_1731 179
20 3300037466 Ga0395898_0001892 Ga0395898_0001892_23841_24470 179
21 3300038443 Ga0395901_0041024 Ga0395901_0041024_1535_2164 179
22 3300009092 Ga0105250_10000503 Ga0105250_1000050310 181
23 3300025711 Ga0207696_1000511 Ga0207696_100051115 181
24 3300045836 Ga0466958_0121951 Ga0466958_0121951_124_714 184
25 3300005406 Ga0070703_10183293 Ga0070703_101832931 186
26 iso_pu_bacteria 2721755523 2722883940 186
27 iso_pu_bacteria 2839138175 2839140287 186
28 iso_pu_bacteria 2808606373 2808905218 188
29 iso_pu_bacteria 8011350971 8011354825 188
30 3300003316 rootH1_10024335 rootH1_100243352 189
31 3300005327 Ga0070658_10031247 Ga0070658_100312476 189
32 3300005339 Ga0070660_100294246 Ga0070660_1002942462 189
33 3300005455 Ga0070663_100087698 Ga0070663_1000876983 189
34 3300005563 Ga0068855_100041739 Ga0068855_1000417397 189
35 3300006946 Ga0079104_1000011 Ga0079104_100001153 189
36 3300009092 Ga0105250_10034781 Ga0105250_100347813 189
37 3300009093 Ga0105240_10219599 Ga0105240_102195992 189
38 3300009148 Ga0105243_10003542 Ga0105243_100035428 189
39 3300009545 Ga0105237_10037617 Ga0105237_100376176 189
40 3300013102 Ga0157371_10014176 Ga0157371_100141766 189
41 3300013104 Ga0157370_10001406 Ga0157370_1000140629 189
42 3300013104 Ga0157370_10291633 Ga0157370_102916331 189
43 3300013105 Ga0157369_10000658 Ga0157369_100006589 189
44 3300013105 Ga0157369_10001653 Ga0157369_1000165312 189
45 3300013307 Ga0157372_10869225 Ga0157372_108692251 189
46 3300020070 Ga0206356_10177199 Ga0206356_101771992 189
47 3300020081 Ga0206354_10837954 Ga0206354_108379544 189
48 3300020081 Ga0206354_11698642 Ga0206354_116986423 189
49 3300020082 Ga0206353_11156468 Ga0206353_111564682 189
50 3300022467 Ga0224712_10000560 Ga0224712_100005608 189
51 3300025909 Ga0207705_10000877 Ga0207705_1000087716 189
52 3300025913 Ga0207695_10185372 Ga0207695_101853722 189
53 3300025914 Ga0207671_10034264 Ga0207671_100342642 189
54 3300025919 Ga0207657_10265498 Ga0207657_102654981 189
55 3300025935 Ga0207709_10000245 Ga0207709_1000024514 189
56 3300025949 Ga0207667_10020073 Ga0207667_100200732 189
57 3300026067 Ga0207678_10046689 Ga0207678_100466894 189
58 3300027111 Ga0209281_1000005 Ga0209281_1000005885 189
59 3300037418 Ga0395900_0317053 Ga0395900_0317053_884_1519 189
60 3300037466 Ga0395898_0007065 Ga0395898_0007065_9771_10406 189
61 3300038443 Ga0395901_0000002 Ga0395901_0000002_689138_689773 189
62 3300038443 Ga0395901_0000417 Ga0395901_0000417_1520_2155 189
63 3300044656 Ga0466969_0000452 Ga0466969_0000452_20712_21347 189
64 3300044656 Ga0466969_0032411 Ga0466969_0032411_600_1235 189
65 3300044659 Ga0466973_0023885 Ga0466973_0023885_1063_1698 189
66 3300044683 Ga0466965_0000061 Ga0466965_0000061_16930_17565 189
67 3300044683 Ga0466965_0106135 Ga0466965_0106135_523_1158 189
68 3300044684 Ga0466966_0000299 Ga0466966_0000299_22622_23257 189
69 3300044684 Ga0466966_0005336 Ga0466966_0005336_7150_7785 189
70 3300044693 Ga0466961_0000407 Ga0466961_0000407_18771_19406 189
71 3300044693 Ga0466961_0017374 Ga0466961_0017374_906_1541 189
72 3300044694 Ga0466963_0000485 Ga0466963_0000485_4546_5181 189
73 3300044694 Ga0466963_0001568 Ga0466963_0001568_8358_8993 189
74 3300044694 Ga0466963_0104522 Ga0466963_0104522_254_889 189
75 3300044719 Ga0466971_0025970 Ga0466971_0025970_1462_2097 189
76 3300044719 Ga0466971_0279748 Ga0466971_0279748_42_677 189
77 3300044765 Ga0466970_0029594 Ga0466970_0029594_806_1441 189
78 3300044842 Ga0466957_0000780 Ga0466957_0000780_14593_15228 189
79 3300044842 Ga0466957_0001222 Ga0466957_0001222_2101_2736 189
80 3300044842 Ga0466957_0154033 Ga0466957_0154033_444_1079 189
81 3300045049 Ga0466959_0043786 Ga0466959_0043786_1884_2519 189
82 3300045049 Ga0466959_0095291 Ga0466959_0095291_1267_1902 189
83 3300045049 Ga0466959_0133186 Ga0466959_0133186_633_1268 189
84 3300045836 Ga0466958_0001247 Ga0466958_0001247_1756_2391 189
85 3300045836 Ga0466958_0089057 Ga0466958_0089057_833_1468 189
86 3300048929 Ga0496126_0020460 Ga0496126_0020460_2547_3155 189
87 3300048929 Ga0496126_0059985 Ga0496126_0059985_1366_1992 189
88 3300049587 Ga0501071_0588014 Ga0501071_0588014_23_631 189
89 3300059421 Ga0590071_032815 Ga0590071_032815_244_861 189
90 3300059426 Ga0590077_031157 Ga0590077_031157_288_905 189
91 3300061719 Ga0466962_0044505 Ga0466962_0044505_264_899 189
92 3300061719 Ga0466962_0137089 Ga0466962_0137089_46_681 189
93 3300061719 Ga0466962_0359656 Ga0466962_0359656_24_659 189
94 3300005336 Ga0070680_100098803 Ga0070680_1000988031 190
95 3300005545 Ga0070695_100106878 Ga0070695_1001068782 190
96 3300005549 Ga0070704_100007380 Ga0070704_1000073802 190
97 3300005549 Ga0070704_100659173 Ga0070704_1006591732 190
98 3300006847 Ga0075431_100257451 Ga0075431_1002574512 190
99 3300009094 Ga0111539_10040694 Ga0111539_100406946 190
100 3300014326 Ga0157380_10443336 Ga0157380_104433362 190
101 3300025917 Ga0207660_10304895 Ga0207660_103048952 190
102 3300035207 Ga0373942_0126125 Ga0373942_0126125_170_790 190
103 3300035398 Ga0316574_0292913 Ga0316574_0292913_159_785 190
104 3300035691 Ga0373931_0400419 Ga0373931_0400419_39_659 190
105 3300036712 Ga0316584_0072871 Ga0316584_0072871_220_846 190
106 3300047318 Ga0495636_0154153 Ga0495636_0154153_27_647 190
107 3300049572 Ga0501036_0117595 Ga0501036_0117595_1199_1819 190
108 3300049572 Ga0501036_0825448 Ga0501036_0825448_123_740 190
109 3300049573 Ga0501037_0160735 Ga0501037_0160735_358_978 190
110 3300049574 Ga0501038_0049170 Ga0501038_0049170_2698_3318 190
111 3300049575 Ga0501039_0014549 Ga0501039_0014549_4773_5393 190
112 3300049576 Ga0501040_0009031 Ga0501040_0009031_2734_3354 190
113 3300049577 Ga0501041_0002581 Ga0501041_0002581_92_712 190
114 3300049578 Ga0501042_0062995 Ga0501042_0062995_1712_2332 190
115 3300049579 Ga0501043_0096133 Ga0501043_0096133_402_1022 190
116 3300049580 Ga0501046_0033923 Ga0501046_0033923_234_854 190
117 3300049582 Ga0501048_0211221 Ga0501048_0211221_450_1070 190
118 3300049584 Ga0501068_0030919 Ga0501068_0030919_664_1284 190
119 3300049585 Ga0501069_0409316 Ga0501069_0409316_62_751 190
120 3300049587 Ga0501071_0064945 Ga0501071_0064945_1642_2262 190
121 3300049588 Ga0501072_0138171 Ga0501072_0138171_137_757 190
122 3300049591 Ga0501075_0008928 Ga0501075_0008928_4872_5492 190
123 3300049592 Ga0501076_0031132 Ga0501076_0031132_2998_3618 190
124 3300049592 Ga0501076_0396033 Ga0501076_0396033_107_727 190
125 3300049741 Ga0501079_0005531 Ga0501079_0005531_3043_3663 190
126 3300049741 Ga0501079_0114124 Ga0501079_0114124_1036_1656 190
127 3300049742 Ga0501080_0024616 Ga0501080_0024616_1743_2363 190
128 3300049742 Ga0501080_0975444 Ga0501080_0975444_70_690 190
129 3300049743 Ga0501081_0022274 Ga0501081_0022274_506_1126 190
130 3300049743 Ga0501081_0319456 Ga0501081_0319456_74_694 190
131 3300049823 Ga0501044_0924295 Ga0501044_0924295_85_705 190
132 3300049824 Ga0501045_0097635 Ga0501045_0097635_484_1104 190
133 3300050510 nmdc:mga06r32_247229_c1 nmdc:mga06r32_247229_c1_509_1129 190
134 3300050511 nmdc:mga08y16_608493_c1 nmdc:mga08y16_608493_c1_269_889 190
135 3300054114 Ga0501084_0015578 Ga0501084_0015578_898_1518 190
136 3300060353 Ga0501082_0016576 Ga0501082_0016576_5312_5932 190
137 3300060353 Ga0501082_0530275 Ga0501082_0530275_22_642 190
138 3300061734 Ga0530510_0048200 Ga0530510_0048200_399_1019 190
139 iso_pu_bacteria 2537561728 2538427958 190
140 iso_pu_bacteria 2585427591 2585826411 190
141 iso_pu_bacteria 2585427592 2585830555 190
142 iso_pu_bacteria 2667528173 2671106703 190
143 iso_pu_bacteria 2855195626 2855199770 190
144 iso_pu_bacteria 2858466076 2858466108 190
145 iso_pu_bacteria 2871272651 2871273481 190
146 iso_pu_bacteria 2871282230 2871282836 190
147 iso_pu_bacteria 2900051742 2900056324 190
148 iso_pu_bacteria 2904474040 2904474149 190
149 iso_pu_bacteria 2904504865 2904507234 190
150 iso_pu_bacteria 2908669403 2908672833 190
151 iso_pu_bacteria 2919150387 2919150496 190
152 iso_pu_bacteria 2923519811 2923522664 190
153 iso_pu_bacteria 2927143783 2927145369 190
154 3300031727 Ga0316576_10060286 Ga0316576_100602861 191
155 3300031733 Ga0316577_10147806 Ga0316577_101478062 191
156 3300036712 Ga0316584_0036410 Ga0316584_0036410_231_821 191
157 3300046455 Ga0495603_0105650 Ga0495603_0105650_699_1283 191
158 3300046501 Ga0495607_0032906 Ga0495607_0032906_812_1396 191
159 3300046520 Ga0495637_0029007 Ga0495637_0029007_1564_2148 191
160 3300046520 Ga0495637_0033198 Ga0495637_0033198_1613_2197 191
161 3300046692 Ga0495671_0078350 Ga0495671_0078350_651_1235 191
162 3300046694 Ga0495649_0053118 Ga0495649_0053118_428_1012 191
163 3300047321 Ga0495676_0012574 Ga0495676_0012574_2177_2761 191
164 3300047323 Ga0495683_0002233 Ga0495683_0002233_7642_8226 191
165 3300053125 Ga0500618_017273 Ga0500618_017273_806_1390 191
166 iso_pu_bacteria 2990196909 2990198518 191
167 iso_pu_bacteria 640427133 640486977 191
168 iso_pu_bacteria 651053060 651174852 191
169 3300014325 Ga0163163_10093927 Ga0163163_100939272 192
170 3300041997 Ga0439431_0011693 Ga0439431_0011693_1147_1731 192
171 3300042013 Ga0439456_027105 Ga0439456_027105_523_1107 192
172 3300042115 Ga0450911_000023 Ga0450911_000023_67792_68376 192
173 3300042130 Ga0450892_013825 Ga0450892_013825_61_645 192
174 3300042138 Ga0450903_011175 Ga0450903_011175_368_952 192
175 3300042139 Ga0450904_000029 Ga0450904_000029_2219_2803 192
176 3300042438 Ga0439459_0042447 Ga0439459_0042447_133_717 192
177 3300042438 Ga0439459_0093800 Ga0439459_0093800_16_600 192
178 3300042530 Ga0450916_008836 Ga0450916_008836_430_1014 192
179 3300042532 Ga0450893_0000296 Ga0450893_0000296_4213_4797 192
180 3300048921 Ga0496118_0135524 Ga0496118_0135524_129_713 192
181 3300049853 Ga0501226_000002 Ga0501226_000002_99196_99780 192
182 2162886007 SwRhRL2b_contig_535727 SwRhRL2b_0228.00003270 194
183 2162886007 SwRhRL2b_contig_803606 SwRhRL2b_0252.00000700 194
184 3300002737 JGI25162J39368_1000031 JGI25162J39368_1000031111 194
185 3300002771 JGI25163J39215_1000033 JGI25163J39215_100003357 194
186 3300002771 JGI25163J39215_1000094 JGI25163J39215_10000943 194
187 3300002772 JGI25164J39214_1000050 JGI25164J39214_10000503 194
188 3300003214 JGI25165J46597_1020576 JGI25165J46597_10205762 194
189 3300003751 Ga0055538_1000004 Ga0055538_1000004110 194
190 3300003752 Ga0055539_1000004 Ga0055539_1000004448 194
191 3300003756 Ga0055533_1000007 Ga0055533_1000007110 194
192 3300003759 Ga0055525_1000007 Ga0055525_1000007110 194
193 3300003841 Ga0055541_1000004 Ga0055541_1000004110 194
194 3300005289 Ga0065704_10000928 Ga0065704_1000092811 194
195 3300009011 Ga0105251_10046027 Ga0105251_100460272 194
196 3300009036 Ga0105244_10000205 Ga0105244_1000020515 194
197 3300009036 Ga0105244_10000766 Ga0105244_1000076610 194
198 3300009036 Ga0105244_10008768 Ga0105244_100087683 194
199 3300009036 Ga0105244_10012301 Ga0105244_100123014 194
200 3300009092 Ga0105250_10000098 Ga0105250_1000009860 194
201 3300013102 Ga0157371_10000272 Ga0157371_1000027255 194
202 3300013104 Ga0157370_10001028 Ga0157370_100010283 194
203 3300013306 Ga0163162_10010172 Ga0163162_1001017210 194
204 3300013307 Ga0157372_10069323 Ga0157372_100693232 194
205 3300013307 Ga0157372_10070941 Ga0157372_100709412 194
206 3300025207 Ga0209760_100006 Ga0209760_100006175 194
207 3300025224 Ga0209784_100001 Ga0209784_100001108 194
208 3300025225 Ga0209566_100001 Ga0209566_100001108 194
209 3300025226 Ga0209674_100002 Ga0209674_100002108 194
210 3300025230 Ga0209563_100008 Ga0209563_100008109 194
211 3300025231 Ga0207427_100002 Ga0207427_1000021171 194
212 3300025233 Ga0209437_100114 Ga0209437_10011491 194
213 3300025253 Ga0209677_100004 Ga0209677_100004109 194
214 3300025261 Ga0209233_1001180 Ga0209233_10011804 194
215 3300025711 Ga0207696_1000027 Ga0207696_1000027344 194
216 3300025728 Ga0207655_1000209 Ga0207655_100020923 194
217 3300025728 Ga0207655_1000397 Ga0207655_100039750 194
218 3300025728 Ga0207655_1000852 Ga0207655_100085216 194
219 3300025728 Ga0207655_1002990 Ga0207655_10029902 194
220 3300041405 Ga0439438_006011 Ga0439438_006011_2800_3390 194
221 3300041407 Ga0439447_000509 Ga0439447_000509_12593_13183 194
222 3300041411 Ga0439466_0033294 Ga0439466_0033294_971_1561 194
223 3300041997 Ga0439431_0011602 Ga0439431_0011602_210_800 194
224 3300042006 Ga0439432_007748 Ga0439432_007748_1205_1795 194
225 3300042010 Ga0439452_007287 Ga0439452_007287_709_1299 194
226 3300042125 Ga0450923_038047 Ga0450923_038047_118_708 194
227 3300042156 Ga0439446_0012165 Ga0439446_0012165_1123_1713 194
228 3300042185 Ga0450909_020683 Ga0450909_020683_299_889 194
229 3300042435 Ga0439434_0001788 Ga0439434_0001788_731_1321 194
230 3300046471 Ga0495650_0000004 Ga0495650_0000004_116882_117475 194
231 3300046519 Ga0495632_0035128 Ga0495632_0035128_1910_2506 194
232 3300046519 Ga0495632_0265359 Ga0495632_0265359_63_656 194
233 3300046810 Ga0495660_0000022 Ga0495660_0000022_117138_117731 194
234 3300048907 Ga0496104_0002690 Ga0496104_0002690_9199_9792 194
235 3300048919 Ga0496116_0000188 Ga0496116_0000188_117131_117724 194
236 3300048919 Ga0496116_0000856 Ga0496116_0000856_31831_32424 194
237 3300048920 Ga0496117_0065891 Ga0496117_0065891_352_945 194
238 3300048921 Ga0496118_0007206 Ga0496118_0007206_7917_8510 194
239 3300048921 Ga0496118_0043542 Ga0496118_0043542_1763_2356 194
240 3300048922 Ga0496119_0023442 Ga0496119_0023442_1879_2472 194
241 3300048923 Ga0496120_0000440 Ga0496120_0000440_46334_46927 194
242 3300048923 Ga0496120_0001940 Ga0496120_0001940_4766_5359 194
243 3300048924 Ga0496121_0287736 Ga0496121_0287736_33_626 194
244 3300048925 Ga0496122_0000070 Ga0496122_0000070_63500_64093 194
245 3300048926 Ga0496123_0000183 Ga0496123_0000183_120198_120791 194
246 3300048927 Ga0496124_0000169 Ga0496124_0000169_116897_117490 194
247 3300048927 Ga0496124_0000851 Ga0496124_0000851_44029_44622 194
248 3300048928 Ga0496125_0000056 Ga0496125_0000056_153289_153882 194
249 3300048929 Ga0496126_0000137 Ga0496126_0000137_144895_145488 194
250 iso_pu_bacteria 2511231024 2511374338 194
251 iso_pu_bacteria 2554235132 2554817331 194
252 iso_pu_bacteria 2606217733 2608382884 194
253 3300031824 Ga0307413_10014120 Ga0307413_100141202 195
254 3300032004 Ga0307414_10221971 Ga0307414_102219711 195
255 iso_pu_bacteria 2554235231 2555248115 195
256 iso_pu_bacteria 2738543020 2739286920 195
257 iso_pu_bacteria 2738543021 2739292233 195
258 iso_pu_bacteria 2806310737 2807406742 195
259 iso_pu_bacteria 2806310745 2807455074 195
260 iso_pu_bacteria 2842805378 2842809147 195
261 iso_pu_bacteria 3007872151 3007875888 195
262 iso_pu_bacteria 8054929484 8054934406 195
263 iso_pu_bacteria 8056115690 8056120383 195
264 iso_pu_bacteria 8056120720 8056121786 195
265 iso_pu_bacteria 8056137416 8056141996 195
266 3300009011 Ga0105251_10000030 Ga0105251_1000003048 196
267 3300009092 Ga0105250_10001942 Ga0105250_100019426 196
268 3300009092 Ga0105250_10145837 Ga0105250_101458371 196
269 3300025711 Ga0207696_1000054 Ga0207696_1000054147 196
270 3300025735 Ga0207713_1000013 Ga0207713_1000013366 196
271 3300046529 Ga0495652_0203022 Ga0495652_0203022_623_1228 196
272 3300046542 Ga0495597_0057408 Ga0495597_0057408_476_1081 196
273 3300049460 Ga0495682_0004592 Ga0495682_0004592_4030_4635 196
274 3300046453 Ga0495627_000967 Ga0495627_000967_16224_16823 197
275 3300046471 Ga0495650_0040521 Ga0495650_0040521_409_1008 197
276 3300046518 Ga0495631_0006685 Ga0495631_0006685_2775_3374 197
277 3300046519 Ga0495632_0013612 Ga0495632_0013612_3188_3787 197
278 3300046530 Ga0495654_0001659 Ga0495654_0001659_5312_5911 197
279 3300046692 Ga0495671_0004893 Ga0495671_0004893_5508_6107 197
280 3300047320 Ga0495672_0020541 Ga0495672_0020541_2775_3374 197
281 3300003856 Ga0058692_1038434 Ga0058692_10384341 198
282 3300013104 Ga0157370_10394277 Ga0157370_103942772 198
283 3300017792 Ga0163161_10148181 Ga0163161_101481812 198
284 3300027312 Ga0209371_1001397 Ga0209371_100139716 198
285 3300030500 Ga0268256_1000731 Ga0268256_100073121 198
286 3300046501 Ga0495607_0000499 Ga0495607_0000499_10977_11576 198
287 3300046616 Ga0495668_0113844 Ga0495668_0113844_498_1097 198
288 3300046810 Ga0495660_0002518 Ga0495660_0002518_3770_4369 198
289 3300047320 Ga0495672_0037002 Ga0495672_0037002_2013_2612 198
290 3300047320 Ga0495672_0354025 Ga0495672_0354025_66_665 198
291 3300048917 Ga0496114_0012048 Ga0496114_0012048_5546_6142 198
292 3300048926 Ga0496123_0034239 Ga0496123_0034239_651_1253 198
293 3300048928 Ga0496125_0174850 Ga0496125_0174850_684_1280 198
294 3300042137 Ga0450902_000691 Ga0450902_000691_1123_1722 199
295 3300042142 Ga0450905_000962 Ga0450905_000962_2788_3387 199
296 3300042533 Ga0450901_002988 Ga0450901_002988_1111_1710 199
297 3300046522 Ga0495643_0001931 Ga0495643_0001931_14622_15227 199
298 3300046522 Ga0495643_0005275 Ga0495643_0005275_3291_3896 199
299 3300046558 Ga0495633_0112663 Ga0495633_0112663_164_769 199
300 3300046660 Ga0495625_0258718 Ga0495625_0258718_36_641 199
301 3300047470 Ga0495681_0018007 Ga0495681_0018007_1127_1732 199
302 3300047472 Ga0495686_0117818 Ga0495686_0117818_909_1514 199
303 3300048927 Ga0496124_0132814 Ga0496124_0132814_863_1462 199
304 3300049459 Ga0495678_031054 Ga0495678_031054_427_1032 199
305 iso_pu_bacteria 2765235841 2765582116 199
306 iso_pu_bacteria 2919155634 2919157910 199
307 iso_pu_bacteria 8052494512 8052498995 199
308 3300009036 Ga0105244_10005346 Ga0105244_100053463 202
309 3300025728 Ga0207655_1005648 Ga0207655_10056483 202
310 3300048924 Ga0496121_0162538 Ga0496121_0162538_157_765 202
311 2162886007 SwRhRL2b_contig_1427809 SwRhRL2b_0422.00006370 203
312 3300003781 Ga0055536_1022747 Ga0055536_10227472 203
313 3300005289 Ga0065704_10246403 Ga0065704_102464032 203
314 3300005289 Ga0065704_10387204 Ga0065704_103872041 203
315 3300006058 Ga0075432_10011442 Ga0075432_100114422 203
316 3300006944 Ga0099823_1012435 Ga0099823_10124353 203
317 3300006944 Ga0099823_1080803 Ga0099823_10808032 203
318 3300009011 Ga0105251_10003994 Ga0105251_100039943 203
319 3300009011 Ga0105251_10021341 Ga0105251_100213414 203
320 3300009036 Ga0105244_10040827 Ga0105244_100408273 203
321 3300009036 Ga0105244_10042609 Ga0105244_100426093 203
322 3300009036 Ga0105244_10081762 Ga0105244_100817622 203
323 3300009036 Ga0105244_10286378 Ga0105244_102863781 203
324 3300009092 Ga0105250_10015837 Ga0105250_100158374 203
325 3300009092 Ga0105250_10018222 Ga0105250_100182222 203
326 3300009148 Ga0105243_10100338 Ga0105243_101003383 203
327 3300013104 Ga0157370_10298151 Ga0157370_102981512 203
328 3300013307 Ga0157372_10004227 Ga0157372_100042276 203
329 3300015261 Ga0182006_1012933 Ga0182006_10129332 203
330 3300025292 Ga0209676_1000525 Ga0209676_100052531 203
331 3300025711 Ga0207696_1000120 Ga0207696_100012045 203
332 3300025711 Ga0207696_1003225 Ga0207696_10032253 203
333 3300025711 Ga0207696_1005297 Ga0207696_10052974 203
334 3300025728 Ga0207655_1001011 Ga0207655_10010114 203
335 3300025728 Ga0207655_1010062 Ga0207655_10100623 203
336 3300025728 Ga0207655_1055521 Ga0207655_10555211 203
337 3300025728 Ga0207655_1138433 Ga0207655_11384332 203
338 3300025735 Ga0207713_1005719 Ga0207713_10057194 203
339 3300025735 Ga0207713_1006622 Ga0207713_10066223 203
340 3300025735 Ga0207713_1010006 Ga0207713_10100064 203
341 3300025735 Ga0207713_1049293 Ga0207713_10492932 203
342 3300025935 Ga0207709_10065054 Ga0207709_100650542 203
343 3300027296 Ga0209389_1000005 Ga0209389_1000005153 203
344 3300027907 Ga0207428_10098734 Ga0207428_100987342 203
345 3300042142 Ga0450905_002178 Ga0450905_002178_762_1373 203
346 3300042142 Ga0450905_018321 Ga0450905_018321_176_787 203
347 3300046507 Ga0495606_0000314 Ga0495606_0000314_55866_56483 203
348 3300046515 Ga0495620_0000097 Ga0495620_0000097_5299_5910 203
349 3300046519 Ga0495632_0000882 Ga0495632_0000882_5302_5913 203
350 3300046522 Ga0495643_0000296 Ga0495643_0000296_5255_5866 203
351 3300046522 Ga0495643_0001539 Ga0495643_0001539_1053_1664 203
352 3300046524 Ga0495648_0001799 Ga0495648_0001799_4251_4862 203
353 3300046694 Ga0495649_0003812 Ga0495649_0003812_2047_2664 203
354 3300048913 Ga0496110_0149463 Ga0496110_0149463_1250_1861 203
355 3300048914 Ga0496111_0294887 Ga0496111_0294887_192_803 203
356 3300048917 Ga0496114_0143678 Ga0496114_0143678_460_1071 203
357 3300048920 Ga0496117_0003327 Ga0496117_0003327_1877_2488 203
358 3300048920 Ga0496117_0003843 Ga0496117_0003843_15124_15735 203
359 3300048920 Ga0496117_0037286 Ga0496117_0037286_141_752 203
360 3300048921 Ga0496118_0004697 Ga0496118_0004697_14443_15054 203
361 3300048921 Ga0496118_0010843 Ga0496118_0010843_1060_1671 203
362 3300048921 Ga0496118_0345821 Ga0496118_0345821_165_776 203
363 3300048922 Ga0496119_0000100 Ga0496119_0000100_49550_50179 203
364 3300048922 Ga0496119_0062355 Ga0496119_0062355_461_1072 203
365 3300048923 Ga0496120_0001920 Ga0496120_0001920_5775_6404 203
366 3300048924 Ga0496121_0279642 Ga0496121_0279642_437_1048 203
367 3300048925 Ga0496122_0003209 Ga0496122_0003209_6890_7501 203
368 3300048925 Ga0496122_0191066 Ga0496122_0191066_128_739 203
369 3300048926 Ga0496123_0002633 Ga0496123_0002633_6890_7501 203
370 3300048926 Ga0496123_0038723 Ga0496123_0038723_1550_2161 203
371 3300048927 Ga0496124_0034167 Ga0496124_0034167_1016_1627 203
372 3300048927 Ga0496124_0040368 Ga0496124_0040368_1864_2475 203
373 3300048927 Ga0496124_0329061 Ga0496124_0329061_390_1001 203
374 3300048928 Ga0496125_0000489 Ga0496125_0000489_28601_29212 203
375 3300048928 Ga0496125_0010466 Ga0496125_0010466_6487_7098 203
376 3300048928 Ga0496125_0068080 Ga0496125_0068080_177_788 203
377 3300048929 Ga0496126_0088569 Ga0496126_0088569_1306_1917 203
378 3300048929 Ga0496126_0172740 Ga0496126_0172740_804_1415 203
379 3300049571 Ga0501034_0000020 Ga0501034_0000020_70703_71314 203
380 3300053135 Ga0500659_0002940 Ga0500659_0002940_1048_1659 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

3

215

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p0e-assembly1.cif.gz_A yhde e33a (p212121 space group) 0.9523 2 186
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9488 2 185
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9448 1 186
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9441 2 185
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9392 2 185
ID Description Score Start End Superfamily
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9488 4 186 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9441 2 185 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9392 2 185 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9291 4 186 3.90.950.10
af_Q86BM0_10_204_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9241 2 187 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A0N8LSI6-F1-model_v4 deleted 0.9746 1 130
AF-A0A258BYI3-F1-model_v4 Septum formation inhibitor Maf 0.9726 1 165 GO:0009117
GO:0047429
AF-A0A1H9HHP0-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9713 2 191 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379
AF-A0A661FGX8-F1-model_v4 Septum formation protein Maf 0.9712 1 146 GO:0009117
GO:0047429
AF-A0A2M8GW32-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.971 2 185 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379

Feature Viewer

pLDDT pTM Quality
90.99 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map