F428560

General Info

Members Datasets Scaffolds Average Seq Length
380 198 377 403

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100004288|Ga0070668_1000042884
Length 414
Sequence VRRRRSGMRIGFLFNHDQVHQVAHSLPIALALAREGVDAEIIAATTNRRLTAEVLRLGGGLIGSDIQLVELGLRRRSRRIAADLLEAVAPASKLMVYGDNLDFFRSLDVLVVAEKTSLMLKTHFGLKNLRIVHTRHGAGDRAIGFDAASAGFDHVLVSGRKVRDRLTAEAGVPGEKISIVGYPKFDLLPSPAQIHPLIDDGRPVALYNPHVSPHLSSWYAMGRQVLDWFVEHDDHHLIFAPHVMLFERPFVVSIDRLRVDRAGRIDDRYLRAPNIHIDLGSRASTTMAYTRRADLYIGDASSQVYEFLLKPRPCVFLNPHGAEWQGDPNFAHWRAGPVIEGAAELGGALAQARAEQPWRYAPIQREMFDYSFDLTQEPSSLRAARAVAKFAGIAAPHLAPVVPAAPPVAMEAHG

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
3 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
170 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
174 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
180 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
181 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
187 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
194 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
195 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
198 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 0
Rhizoplane 1.32
Rhizosphere 83.42
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000055 3300001904 Bacteria 18334
2 JGI24736J21556_1000139 3300001904 Bacteria 12577
3 JGI24741J21665_1000051 3300001915 Bacteria 29256
4 JGI24752J21851_1000276 3300001976 Bacteria 7175
5 JGI24740J21852_10004005 3300001979 Bacteria 6390
6 JGI24740J21852_10007238 3300001979 Bacteria 4524
7 JGI24739J22299_10001314 3300001989 Bacteria 9320
8 JGI24737J22298_10000644 3300001990 Bacteria 12323
9 JGI24735J21928_10000594 3300002067 Bacteria 12729
10 JGI24735J21928_10012432 3300002067 Bacteria 2691
11 JGI24750J21931_1000185 3300002070 Bacteria 10408
12 JGI24748J21848_1000147 3300002074 Bacteria 11148
13 JGI24034J26672_10000011 3300002239 Bacteria 148169
14 JGI24742J22300_10004852 3300002244 Bacteria 2207
15 JGI24751J29686_10000087 3300002459 Bacteria 51968
16 Ga0055530_10000221 3300003791 Bacteria 50922
17 Ga0065165_1001024 3300005262 Bacteria 33944
18 Ga0065165_1001141 3300005262 Bacteria 31121
19 Ga0065165_1007626 3300005262 Bacteria 5266
20 Ga0065704_10077386 3300005289 Bacteria 4755
21 Ga0065707_10088502 3300005295 Bacteria 4641
22 Ga0070658_10040265 3300005327 Bacteria 3770
23 Ga0070690_100000003 3300005330 Bacteria 144748
24 Ga0070670_100000038 3300005331 Bacteria 153333
25 Ga0070670_100000060 3300005331 Bacteria 113477
26 Ga0070670_100000213 3300005331 Bacteria 53498
27 Ga0070670_100000281 3300005331 Bacteria 44802
28 Ga0070670_100027802 3300005331 Bacteria 4865
29 Ga0070670_100231996 3300005331 Bacteria 1606
30 Ga0070666_10000176 3300005335 Bacteria 43811
31 Ga0070666_10029912 3300005335 Bacteria 3584
32 Ga0070689_100001889 3300005340 Bacteria 13528
33 Ga0070661_100035027 3300005344 Bacteria 3643
34 Ga0070668_100000049 3300005347 Bacteria 74953
35 Ga0070668_100001508 3300005347 Bacteria 16824
36 Ga0070668_100004288 3300005347 Bacteria 10584
37 Ga0070668_100010717 3300005347 Bacteria 6816
38 Ga0070668_100047217 3300005347 Bacteria 3310
39 Ga0070668_100054548 3300005347 Bacteria 3083
40 Ga0070668_100063895 3300005347 Bacteria 2853
41 Ga0070668_100072091 3300005347 Bacteria 2691
42 Ga0070669_100000014 3300005353 Bacteria 206875
43 Ga0070669_100000053 3300005353 Bacteria 113601
44 Ga0070669_100000135 3300005353 Bacteria 66559
45 Ga0070671_100000805 3300005355 Bacteria 22666
46 Ga0070671_100002205 3300005355 Bacteria 15048
47 Ga0070671_100007138 3300005355 Bacteria 8926
48 Ga0070673_100000029 3300005364 Bacteria 64228
49 Ga0070688_100000787 3300005365 Bacteria 15717
50 Ga0070659_100132587 3300005366 Bacteria 2024
51 Ga0070667_100000009 3300005367 Bacteria 281488
52 Ga0070667_100000016 3300005367 Bacteria 237028
53 Ga0070667_100006901 3300005367 Bacteria 9433
54 Ga0070667_100007706 3300005367 Bacteria 8928
55 Ga0070667_100019497 3300005367 Bacteria 5627
56 Ga0070667_100019606 3300005367 Bacteria 5611
57 Ga0070667_100216292 3300005367 Bacteria 1704
58 Ga0070663_100003654 3300005455 Bacteria 8911
59 Ga0068867_100000044 3300005459 Bacteria 76426
60 Ga0070685_10000034 3300005466 Bacteria 81799
61 Ga0070685_10016142 3300005466 Bacteria 3974
62 Ga0070686_100000023 3300005544 Bacteria 130174
63 Ga0070665_100000019 3300005548 Bacteria 413972
64 Ga0070665_100000294 3300005548 Bacteria 78909
65 Ga0070665_100001239 3300005548 Bacteria 30984
66 Ga0068855_100042946 3300005563 Bacteria 5357
67 Ga0068855_100099752 3300005563 Bacteria 3344
68 Ga0070664_100011630 3300005564 Bacteria 7142
69 Ga0068854_100034989 3300005578 Bacteria 3514
70 Ga0068856_100008210 3300005614 Bacteria 10178
71 Ga0068852_100115780 3300005616 Bacteria 2444
72 Ga0068859_100001743 3300005617 Bacteria 22161
73 Ga0068859_100005926 3300005617 Bacteria 12401
74 Ga0068859_100009455 3300005617 Bacteria 9842
75 Ga0068859_100126532 3300005617 Bacteria 2624
76 Ga0068859_100145197 3300005617 Bacteria 2447
77 Ga0068864_100000069 3300005618 Bacteria 114134
78 Ga0068864_100000594 3300005618 Bacteria 30718
79 Ga0068864_100007827 3300005618 Bacteria 8806
80 Ga0068861_100043716 3300005719 Bacteria 3365
81 Ga0068861_100095516 3300005719 Bacteria 2354
82 Ga0068851_10008450 3300005834 Bacteria 4759
83 Ga0068851_10111052 3300005834 Bacteria 1463
84 Ga0068863_100000048 3300005841 Bacteria 135912
85 Ga0068863_100000226 3300005841 Bacteria 59763
86 Ga0068863_100000844 3300005841 Bacteria 30718
87 Ga0068863_100002413 3300005841 Bacteria 18559
88 Ga0068863_100002799 3300005841 Bacteria 17282
89 Ga0068863_100006025 3300005841 Bacteria 11893
90 Ga0068863_100007115 3300005841 Bacteria 10971
91 Ga0068863_100052421 3300005841 Bacteria 3866
92 Ga0068858_100001456 3300005842 Bacteria 24348
93 Ga0068858_100002232 3300005842 Bacteria 19575
94 Ga0068858_100103637 3300005842 Bacteria 2654
95 Ga0068860_100000042 3300005843 Bacteria 227404
96 Ga0068860_100000083 3300005843 Bacteria 168189
97 Ga0068860_100000191 3300005843 Bacteria 97369
98 Ga0068860_100000361 3300005843 Bacteria 60231
99 Ga0068860_100000601 3300005843 Bacteria 42993
100 Ga0068860_100005481 3300005843 Bacteria 12859
101 Ga0068860_100008642 3300005843 Bacteria 10149
102 Ga0068860_100098756 3300005843 Bacteria 2784
103 Ga0068862_100000082 3300005844 Bacteria 113125
104 Ga0068862_100000195 3300005844 Bacteria 66918
105 Ga0068862_100000351 3300005844 Bacteria 49912
106 Ga0068862_100000411 3300005844 Bacteria 46404
107 Ga0068862_100000675 3300005844 Bacteria 34922
108 Ga0068862_100000822 3300005844 Bacteria 30718
109 Ga0068862_100004247 3300005844 Bacteria 12133
110 Ga0068862_100006074 3300005844 Bacteria 10055
111 Ga0068862_100017872 3300005844 Bacteria 5904
112 Ga0075368_10000745 3300006042 Bacteria 9991
113 Ga0075367_10000298 3300006178 Bacteria 17485
114 Ga0075369_10007618 3300006186 Bacteria 4136
115 Ga0068865_100000073 3300006881 Bacteria 52502
116 Ga0097620_100001743 3300006931 Bacteria 22161
117 Ga0097620_100005926 3300006931 Bacteria 12401
118 Ga0097620_100009455 3300006931 Bacteria 9842
119 Ga0097620_100126528 3300006931 Bacteria 2624
120 Ga0097620_100145185 3300006931 Bacteria 2447
121 Ga0105251_10001651 3300009011 Bacteria 18867
122 Ga0105251_10003207 3300009011 Bacteria 12066
123 Ga0105251_10039243 3300009011 Bacteria 2314
124 Ga0105240_10008564 3300009093 Bacteria 14617
125 Ga0105240_10013024 3300009093 Bacteria 11451
126 Ga0105245_10000666 3300009098 Bacteria 31104
127 Ga0105247_10017378 3300009101 Bacteria 4319
128 Ga0105243_10000267 3300009148 Bacteria 58724
129 Ga0105241_10005452 3300009174 Bacteria 9407
130 Ga0105242_10000676 3300009176 Bacteria 26754
131 Ga0105248_10000016 3300009177 Bacteria 308151
132 Ga0105248_10000101 3300009177 Bacteria 95328
133 Ga0105248_10007381 3300009177 Bacteria 12066
134 Ga0105248_10129112 3300009177 Bacteria 2851
135 Ga0105248_10262531 3300009177 Bacteria 1944
136 Ga0105248_10305656 3300009177 Bacteria 1791
137 Ga0105237_10001484 3300009545 Bacteria 30914
138 Ga0105237_10001877 3300009545 Bacteria 26810
139 Ga0105237_10021411 3300009545 Bacteria 6647
140 Ga0105249_10000053 3300009553 Bacteria 168010
141 Ga0105249_10000116 3300009553 Bacteria 108394
142 Ga0105249_10000390 3300009553 Bacteria 42999
143 Ga0105249_10009179 3300009553 Bacteria 8646
144 Ga0105239_10000216 3300010375 Bacteria 85418
145 Ga0105239_10316534 3300010375 Unclassified 1759
146 Ga0105246_10013042 3300011119 Bacteria 5200
147 Ga0157373_10086325 3300013100 Bacteria 2212
148 Ga0157370_10077317 3300013104 Bacteria 3135
149 Ga0157369_10064930 3300013105 Bacteria 3930
150 Ga0157369_10116202 3300013105 Bacteria 2841
151 Ga0157374_10000992 3300013296 Bacteria 24609
152 Ga0157378_10000361 3300013297 Bacteria 44812
153 Ga0157378_10188089 3300013297 Bacteria 1946
154 Ga0163162_10051649 3300013306 Bacteria 4125
155 Ga0163162_10090842 3300013306 Bacteria 3136
156 Ga0157372_10310298 3300013307 Bacteria 1836
157 Ga0157375_10001286 3300013308 Bacteria 21658
158 Ga0163163_10334395 3300014325 Bacteria 1569
159 Ga0157380_10000964 3300014326 Bacteria 18221
160 Ga0157380_10003423 3300014326 Bacteria 10892
161 Ga0157380_10175667 3300014326 Bacteria 1876
162 Ga0157379_10002375 3300014968 Bacteria 15733
163 Ga0157379_10117682 3300014968 Bacteria 2390
164 Ga0157376_10000197 3300014969 Bacteria 42017
165 Ga0163161_10002867 3300017792 Bacteria 12223
166 Ga0163161_10110576 3300017792 Bacteria 2054
167 Ga0213875_10001981 3300021388 Bacteria 12665
168 Ga0207672_1000370 3300025223 Bacteria 5885
169 Ga0209026_1000910 3300025250 Bacteria 15151
170 Ga0209564_1000283 3300025295 Bacteria 102740
171 Ga0207656_10004502 3300025321 Bacteria 4874
172 Ga0207713_1006690 3300025735 Bacteria 6970
173 Ga0207713_1015994 3300025735 Bacteria 3826
174 Ga0207713_1032203 3300025735 Bacteria 2305
175 Ga0207710_10002666 3300025900 Bacteria 8216
176 Ga0207680_10000081 3300025903 Bacteria 43007
177 Ga0207680_10006323 3300025903 Bacteria 5718
178 Ga0207680_10041097 3300025903 Bacteria 2696
179 Ga0207647_10000997 3300025904 Bacteria 21946
180 Ga0207647_10069973 3300025904 Bacteria 2120
181 Ga0207705_10025642 3300025909 Bacteria 4206
182 Ga0207705_10083388 3300025909 Bacteria 2332
183 Ga0207654_10005378 3300025911 Bacteria 6473
184 Ga0207654_10011573 3300025911 Bacteria 4502
185 Ga0207695_10004104 3300025913 Bacteria 20021
186 Ga0207695_10007578 3300025913 Bacteria 13763
187 Ga0207695_10043596 3300025913 Bacteria 4781
188 Ga0207695_10220768 3300025913 Unclassified 1803
189 Ga0207671_10003091 3300025914 Bacteria 16966
190 Ga0207671_10009153 3300025914 Bacteria 8310
191 Ga0207671_10025916 3300025914 Bacteria 4399
192 Ga0207657_10002260 3300025919 Bacteria 20880
193 Ga0207649_10114531 3300025920 Bacteria 1807
194 Ga0207681_10000003 3300025923 Bacteria 713245
195 Ga0207681_10000045 3300025923 Bacteria 128454
196 Ga0207681_10001366 3300025923 Bacteria 15749
197 Ga0207681_10005561 3300025923 Bacteria 7742
198 Ga0207694_10003733 3300025924 Bacteria 12066
199 Ga0207694_10012787 3300025924 Bacteria 6324
200 Ga0207650_10000032 3300025925 Bacteria 229538
201 Ga0207650_10000148 3300025925 Bacteria 85425
202 Ga0207650_10000285 3300025925 Bacteria 52016
203 Ga0207650_10000766 3300025925 Bacteria 24658
204 Ga0207650_10006190 3300025925 Bacteria 8154
205 Ga0207650_10090388 3300025925 Bacteria 2338
206 Ga0207650_10205964 3300025925 Bacteria 1578
207 Ga0207687_10000835 3300025927 Bacteria 20801
208 Ga0207644_10000088 3300025931 Bacteria 65977
209 Ga0207644_10000396 3300025931 Bacteria 28366
210 Ga0207644_10001924 3300025931 Bacteria 13463
211 Ga0207690_10046754 3300025932 Bacteria 2868
212 Ga0207686_10000547 3300025934 Bacteria 24269
213 Ga0207709_10000316 3300025935 Bacteria 52719
214 Ga0207704_10000002 3300025938 Bacteria 303025
215 Ga0207691_10068025 3300025940 Bacteria 3218
216 Ga0207711_10000022 3300025941 Bacteria 340441
217 Ga0207711_10001326 3300025941 Bacteria 23411
218 Ga0207711_10023008 3300025941 Bacteria 5216
219 Ga0207711_10038044 3300025941 Bacteria 4090
220 Ga0207689_10001165 3300025942 Bacteria 25310
221 Ga0207667_10003306 3300025949 Bacteria 19886
222 Ga0207651_10000023 3300025960 Bacteria 76488
223 Ga0207712_10000045 3300025961 Bacteria 168093
224 Ga0207712_10000335 3300025961 Bacteria 43007
225 Ga0207712_10000380 3300025961 Bacteria 38956
226 Ga0207712_10084075 3300025961 Bacteria 2324
227 Ga0207668_10000077 3300025972 Bacteria 73595
228 Ga0207668_10000222 3300025972 Bacteria 38527
229 Ga0207668_10005903 3300025972 Bacteria 7214
230 Ga0207668_10006656 3300025972 Bacteria 6835
231 Ga0207668_10036503 3300025972 Bacteria 3280
232 Ga0207668_10071584 3300025972 Bacteria 2477
233 Ga0207658_10000009 3300025986 Bacteria 264118
234 Ga0207658_10000134 3300025986 Bacteria 78342
235 Ga0207658_10000232 3300025986 Bacteria 58908
236 Ga0207658_10000473 3300025986 Bacteria 37262
237 Ga0207658_10002614 3300025986 Bacteria 13083
238 Ga0207658_10005427 3300025986 Bacteria 8742
239 Ga0207658_10129750 3300025986 Bacteria 2023
240 Ga0207703_10000253 3300026035 Bacteria 60255
241 Ga0207703_10000524 3300026035 Bacteria 39370
242 Ga0207639_10004198 3300026041 Bacteria 9704
243 Ga0207678_10001097 3300026067 Bacteria 24850
244 Ga0207678_10053614 3300026067 Bacteria 3475
245 Ga0207702_10001123 3300026078 Bacteria 27335
246 Ga0207702_10001950 3300026078 Bacteria 20121
247 Ga0207641_10000002 3300026088 Bacteria 981004
248 Ga0207641_10000143 3300026088 Bacteria 102398
249 Ga0207641_10001219 3300026088 Bacteria 25743
250 Ga0207641_10001840 3300026088 Bacteria 20379
251 Ga0207641_10002168 3300026088 Bacteria 18495
252 Ga0207641_10002424 3300026088 Bacteria 17227
253 Ga0207641_10015783 3300026088 Bacteria 6187
254 Ga0207641_10028944 3300026088 Bacteria 4580
255 Ga0207641_10250925 3300026088 Bacteria 1652
256 Ga0207648_10000120 3300026089 Bacteria 76384
257 Ga0207676_10000009 3300026095 Bacteria 545256
258 Ga0207676_10000513 3300026095 Bacteria 32623
259 Ga0207676_10000564 3300026095 Bacteria 30717
260 Ga0207676_10006435 3300026095 Bacteria 8295
261 Ga0207674_10111371 3300026116 Bacteria 2711
262 Ga0207675_100007235 3300026118 Bacteria 10488
263 Ga0207675_100010006 3300026118 Bacteria 8885
264 Ga0207698_10025967 3300026142 Bacteria 4137
265 Ga0207698_10077165 3300026142 Bacteria 2670
266 Ga0209813_10000017 3300027866 Bacteria 75687
267 Ga0268266_10000025 3300028379 Bacteria 477143
268 Ga0268266_10001253 3300028379 Bacteria 31025
269 Ga0268266_10001306 3300028379 Bacteria 30304
270 Ga0268265_10000030 3300028380 Bacteria 228157
271 Ga0268265_10000084 3300028380 Bacteria 119522
272 Ga0268265_10000090 3300028380 Bacteria 116514
273 Ga0268265_10000580 3300028380 Bacteria 37079
274 Ga0268265_10001046 3300028380 Bacteria 24878
275 Ga0268265_10001602 3300028380 Bacteria 18690
276 Ga0268265_10006091 3300028380 Bacteria 8189
277 Ga0268265_10006928 3300028380 Bacteria 7667
278 Ga0268264_10000001 3300028381 Bacteria 1221000
279 Ga0268264_10000055 3300028381 Bacteria 314947
280 Ga0268264_10000087 3300028381 Bacteria 236696
281 Ga0268264_10000202 3300028381 Bacteria 121481
282 Ga0268264_10000608 3300028381 Bacteria 43007
283 Ga0268264_10000727 3300028381 Bacteria 37803
284 Ga0268264_10013336 3300028381 Bacteria 6765
285 Ga0268264_10075810 3300028381 Bacteria 2860
286 Ga0307511_10009033 3300030521 Bacteria 9943
287 Ga0307408_100002241 3300031548 Bacteria 13792
288 Ga0307406_10006612 3300031901 Bacteria 6407
289 Ga0307412_10009654 3300031911 Bacteria 5539
290 Ga0307416_100017666 3300032002 Bacteria 4999
291 Ga0307414_10025346 3300032004 Bacteria 3798
292 Ga0373927_0041108 3300035695 Bacteria 2999
293 Ga0395900_0003720 3300037418 Bacteria 16389
294 Ga0436364_0930335 3300037853 Bacteria 30426
295 Ga0395901_0000041 3300038443 Bacteria 202314
296 Ga0453684_0000159 3300044712 Bacteria 300297
297 Ga0451576_0000120 3300045051 Bacteria 199365
298 Ga0495629_0004957 3300046459 Bacteria 9985
299 Ga0495638_0000079 3300046460 Bacteria 157488
300 Ga0495594_0136203 3300046499 Bacteria 1392
301 Ga0495610_0000238 3300046512 Bacteria 57907
302 Ga0495620_0014087 3300046515 Bacteria 4075
303 Ga0495643_0026295 3300046522 Bacteria 3285
304 Ga0495648_0037391 3300046524 Bacteria 3120
305 Ga0495654_0000852 3300046530 Bacteria 23113
306 Ga0495597_0002808 3300046542 Bacteria 10696
307 Ga0495597_0019707 3300046542 Bacteria 3151
308 Ga0495668_0002907 3300046616 Bacteria 13523
309 Ga0495668_0053489 3300046616 Bacteria 2232
310 Ga0495625_0046644 3300046660 Bacteria 3126
311 Ga0495669_0000321 3300046684 Bacteria 26316
312 Ga0495669_0011548 3300046684 Bacteria 3753
313 Ga0495589_0002299 3300046794 Bacteria 10741
314 Ga0495672_0026436 3300047320 Bacteria 3703
315 Ga0495687_058391 3300047443 Bacteria 1600
316 Ga0495686_0000060 3300047472 Bacteria 237402
317 Ga0495686_0002133 3300047472 Bacteria 19329
318 Ga0496102_0027608 3300048905 Bacteria 5068
319 Ga0496103_0000312 3300048906 Bacteria 44885
320 Ga0496103_0033573 3300048906 Bacteria 3135
321 Ga0496103_0047205 3300048906 Bacteria 2660
322 Ga0496109_0034549 3300048912 Bacteria 4555
323 Ga0496117_0003195 3300048920 Bacteria 19409
324 Ga0496117_0006560 3300048920 Bacteria 11710
325 Ga0496117_0011830 3300048920 Bacteria 7767
326 Ga0496118_0001809 3300048921 Bacteria 30805
327 Ga0496118_0001966 3300048921 Bacteria 29148
328 Ga0496118_0013265 3300048921 Bacteria 7811
329 Ga0496118_0066470 3300048921 Bacteria 2631
330 Ga0496118_0173418 3300048921 Bacteria 1314
331 Ga0496119_0031588 3300048922 Bacteria 3547
332 Ga0496119_0101677 3300048922 Bacteria 1613
333 Ga0496121_0000175 3300048924 Bacteria 142910
334 Ga0496121_0005482 3300048924 Bacteria 16245
335 Ga0496121_0006008 3300048924 Bacteria 15323
336 Ga0496121_0007298 3300048924 Bacteria 13369
337 Ga0496121_0126747 3300048924 Bacteria 1918
338 Ga0496123_0011705 3300048926 Bacteria 7568
339 Ga0496124_0003947 3300048927 Bacteria 17720
340 Ga0496124_0016162 3300048927 Bacteria 7116
341 Ga0496125_0002102 3300048928 Bacteria 26737
342 Ga0496126_0018010 3300048929 Bacteria 7021
343 Ga0501294_000582 3300049517 Bacteria 4177
344 Ga0501047_0099174 3300049581 Bacteria 2792
345 Ga0501047_0247537 3300049581 Bacteria 1632
346 Ga0501067_0105103 3300049583 Bacteria 1569
347 Ga0501223_000920 3300049663 Bacteria 6949
348 Ga0501224_000147 3300049664 Bacteria 7662
349 Ga0501235_003942 3300049669 Bacteria 3212
350 Ga0501225_0000544 3300049705 Bacteria 11811
351 Ga0501281_00019 3300049777 Bacteria 21366
352 Ga0501282_005685 3300049778 Bacteria 1335
353 Ga0501044_0090259 3300049823 Bacteria 3092
354 nmdc:mga06z11_20_c1 3300050494 Bacteria 75712
355 nmdc:mga04h51_108_c1 3300050495 Bacteria 24818
356 nmdc:mga0sz30_8985_c1 3300050516 Bacteria 3789
357 Ga0500635_0000107 3300053080 Bacteria 49911
358 Ga0500643_000145 3300053087 Bacteria 71915
359 Ga0500647_0066803 3300053091 Bacteria 1729
360 Ga0500647_0073502 3300053091 Bacteria 1641
361 Ga0500651_0001965 3300053093 Bacteria 10652
362 Ga0500641_0012715 3300053096 Bacteria 3080
363 Ga0500555_001551 3300053103 Bacteria 6959
364 Ga0500556_0016218 3300053104 Bacteria 2314
365 Ga0500569_000285 3300053109 Bacteria 8006
366 Ga0500592_004153 3300053116 Bacteria 2309
367 Ga0500595_006994 3300053119 Bacteria 4729
368 Ga0500608_001715 3300053122 Bacteria 7834
369 Ga0500614_001000 3300053123 Bacteria 7014
370 Ga0500618_011588 3300053125 Bacteria 2333
371 Ga0500642_0003918 3300053130 Bacteria 4584
372 Ga0500655_000188 3300053133 Bacteria 15104
373 Ga0500590_006951 3300053148 Bacteria 5549
374 Ga0500627_0000316 3300053158 Bacteria 13291
375 Ga0500636_0000923 3300053177 Bacteria 15824
376 Ga0500637_0007827 3300053178 Bacteria 5365
377 Ga0500570_009350 3300053724 Bacteria 5440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0136203 Ga0495594_0136203_404_1381 316
2 3300047320 Ga0495672_0026436 Ga0495672_0026436_1717_2934 348
3 3300005563 Ga0068855_100042946 Ga0068855_1000429465 362
4 3300025250 Ga0209026_1000910 Ga0209026_100091012 362
5 3300003791 Ga0055530_10000221 Ga0055530_100002212 372
6 3300005262 Ga0065165_1001024 Ga0065165_100102410 372
7 3300049581 Ga0501047_0247537 Ga0501047_0247537_437_1597 372
8 3300049664 Ga0501224_000147 Ga0501224_000147_1020_2150 372
9 3300005262 Ga0065165_1001141 Ga0065165_10011415 373
10 3300009011 Ga0105251_10001651 Ga0105251_100016512 373
11 3300009101 Ga0105247_10017378 Ga0105247_100173786 373
12 3300009177 Ga0105248_10000016 Ga0105248_10000016283 373
13 3300009553 Ga0105249_10000116 Ga0105249_1000011623 373
14 3300013306 Ga0163162_10051649 Ga0163162_100516493 373
15 3300025295 Ga0209564_1000283 Ga0209564_100028366 373
16 3300030521 Ga0307511_10009033 Ga0307511_100090335 373
17 3300048906 Ga0496103_0047205 Ga0496103_0047205_298_1428 373
18 3300048920 Ga0496117_0006560 Ga0496117_0006560_8990_10120 373
19 3300048921 Ga0496118_0001809 Ga0496118_0001809_29254_30384 373
20 3300048921 Ga0496118_0173418 Ga0496118_0173418_40_1203 373
21 3300009545 Ga0105237_10001484 Ga0105237_100014848 375
22 3300025914 Ga0207671_10025916 Ga0207671_100259163 375
23 iso_pu_bacteria 2582581305 2585259977 379
24 3300005262 Ga0065165_1007626 Ga0065165_10076265 382
25 3300046524 Ga0495648_0037391 Ga0495648_0037391_1794_2951 382
26 3300035695 Ga0373927_0041108 Ga0373927_0041108_417_1583 383
27 3300046542 Ga0495597_0019707 Ga0495597_0019707_1570_2736 383
28 3300053091 Ga0500647_0066803 Ga0500647_0066803_529_1695 383
29 3300053093 Ga0500651_0001965 Ga0500651_0001965_7783_8949 383
30 3300053096 Ga0500641_0012715 Ga0500641_0012715_1681_2847 383
31 3300053125 Ga0500618_011588 Ga0500618_011588_104_1270 383
32 3300053130 Ga0500642_0003918 Ga0500642_0003918_1376_2542 383
33 3300053133 Ga0500655_000188 Ga0500655_000188_7523_8689 383
34 3300053148 Ga0500590_006951 Ga0500590_006951_643_1809 383
35 3300053724 Ga0500570_009350 Ga0500570_009350_1745_2911 383
36 3300021388 Ga0213875_10001981 Ga0213875_100019819 384
37 3300037853 Ga0436364_0930335 Ga0436364_0930335_5506_6675 384
38 3300053116 Ga0500592_004153 Ga0500592_004153_662_1825 384
39 3300053080 Ga0500635_0000107 Ga0500635_0000107_15590_16792 385
40 3300053087 Ga0500643_000145 Ga0500643_000145_20923_22125 385
41 3300053091 Ga0500647_0073502 Ga0500647_0073502_379_1581 385
42 3300053177 Ga0500636_0000923 Ga0500636_0000923_5346_6548 385
43 3300053178 Ga0500637_0007827 Ga0500637_0007827_3726_4928 385
44 3300046684 Ga0495669_0011548 Ga0495669_0011548_564_1784 386
45 3300046460 Ga0495638_0000079 Ga0495638_0000079_130283_131488 387
46 3300049778 Ga0501282_005685 Ga0501282_005685_128_1306 387
47 3300044712 Ga0453684_0000159 Ga0453684_0000159_180218_181396 388
48 3300045051 Ga0451576_0000120 Ga0451576_0000120_180218_181396 388
49 iso_pu_bacteria 2928531327 2928533714 388
50 iso_pu_bacteria 2643221552 2643781031 390
51 3300005841 Ga0068863_100007115 Ga0068863_1000071154 392
52 3300009011 Ga0105251_10003207 Ga0105251_100032073 392
53 3300009177 Ga0105248_10007381 Ga0105248_100073812 392
54 3300026088 Ga0207641_10250925 Ga0207641_102509252 392
55 3300046512 Ga0495610_0000238 Ga0495610_0000238_12763_13956 392
56 3300046515 Ga0495620_0014087 Ga0495620_0014087_1142_2335 392
57 3300046660 Ga0495625_0046644 Ga0495625_0046644_496_1710 392
58 3300046684 Ga0495669_0000321 Ga0495669_0000321_8231_9445 392
59 3300048906 Ga0496103_0033573 Ga0496103_0033573_1006_2208 392
60 3300048921 Ga0496118_0013265 Ga0496118_0013265_3234_4436 392
61 3300048924 Ga0496121_0005482 Ga0496121_0005482_10082_11284 392
62 3300048926 Ga0496123_0011705 Ga0496123_0011705_5768_6970 392
63 3300048928 Ga0496125_0002102 Ga0496125_0002102_13087_14289 392
64 3300049581 Ga0501047_0099174 Ga0501047_0099174_282_1490 393
65 3300049583 Ga0501067_0105103 Ga0501067_0105103_104_1306 393
66 3300046616 Ga0495668_0053489 Ga0495668_0053489_406_1611 394
67 3300047472 Ga0495686_0000060 Ga0495686_0000060_208934_210160 394
68 3300048922 Ga0496119_0031588 Ga0496119_0031588_522_1748 394
69 3300049823 Ga0501044_0090259 Ga0501044_0090259_1443_2669 394
70 3300001904 JGI24736J21556_1000139 JGI24736J21556_100013910 395
71 3300001915 JGI24741J21665_1000051 JGI24741J21665_100005121 395
72 3300001979 JGI24740J21852_10007238 JGI24740J21852_100072382 395
73 3300001989 JGI24739J22299_10001314 JGI24739J22299_100013147 395
74 3300001990 JGI24737J22298_10000644 JGI24737J22298_100006449 395
75 3300002067 JGI24735J21928_10000594 JGI24735J21928_100005947 395
76 3300005327 Ga0070658_10040265 Ga0070658_100402653 395
77 3300005344 Ga0070661_100035027 Ga0070661_1000350273 395
78 3300005347 Ga0070668_100010717 Ga0070668_1000107174 395
79 3300005366 Ga0070659_100132587 Ga0070659_1001325872 395
80 3300005367 Ga0070667_100000016 Ga0070667_10000001655 395
81 3300005367 Ga0070667_100216292 Ga0070667_1002162922 395
82 3300005455 Ga0070663_100003654 Ga0070663_1000036546 395
83 3300005466 Ga0070685_10016142 Ga0070685_100161424 395
84 3300005563 Ga0068855_100099752 Ga0068855_1000997523 395
85 3300005564 Ga0070664_100011630 Ga0070664_1000116302 395
86 3300005578 Ga0068854_100034989 Ga0068854_1000349892 395
87 3300005614 Ga0068856_100008210 Ga0068856_1000082103 395
88 3300005616 Ga0068852_100115780 Ga0068852_1001157802 395
89 3300005617 Ga0068859_100001743 Ga0068859_10000174314 395
90 3300005834 Ga0068851_10008450 Ga0068851_100084502 395
91 3300005843 Ga0068860_100000361 Ga0068860_10000036155 395
92 3300005843 Ga0068860_100008642 Ga0068860_1000086422 395
93 3300005844 Ga0068862_100006074 Ga0068862_1000060744 395
94 3300006931 Ga0097620_100001743 Ga0097620_10000174314 395
95 3300009011 Ga0105251_10039243 Ga0105251_100392432 395
96 3300009093 Ga0105240_10008564 Ga0105240_100085647 395
97 3300009174 Ga0105241_10005452 Ga0105241_100054525 395
98 3300009177 Ga0105248_10262531 Ga0105248_102625312 395
99 3300009545 Ga0105237_10001877 Ga0105237_100018777 395
100 3300009545 Ga0105237_10021411 Ga0105237_100214116 395
101 3300010375 Ga0105239_10000216 Ga0105239_1000021653 395
102 3300010375 Ga0105239_10316534 Ga0105239_103165342 395
103 3300013104 Ga0157370_10077317 Ga0157370_100773172 395
104 3300013105 Ga0157369_10116202 Ga0157369_101162022 395
105 3300025321 Ga0207656_10004502 Ga0207656_100045023 395
106 3300025735 Ga0207713_1032203 Ga0207713_10322032 395
107 3300025904 Ga0207647_10069973 Ga0207647_100699732 395
108 3300025909 Ga0207705_10083388 Ga0207705_100833882 395
109 3300025911 Ga0207654_10011573 Ga0207654_100115732 395
110 3300025913 Ga0207695_10007578 Ga0207695_100075789 395
111 3300025913 Ga0207695_10220768 Ga0207695_102207682 395
112 3300025914 Ga0207671_10009153 Ga0207671_100091536 395
113 3300025919 Ga0207657_10002260 Ga0207657_100022609 395
114 3300025924 Ga0207694_10012787 Ga0207694_100127874 395
115 3300025925 Ga0207650_10006190 Ga0207650_100061907 395
116 3300025932 Ga0207690_10046754 Ga0207690_100467542 395
117 3300025972 Ga0207668_10006656 Ga0207668_100066564 395
118 3300025986 Ga0207658_10000134 Ga0207658_1000013454 395
119 3300026041 Ga0207639_10004198 Ga0207639_100041984 395
120 3300026067 Ga0207678_10001097 Ga0207678_1000109715 395
121 3300026078 Ga0207702_10001950 Ga0207702_100019509 395
122 3300026088 Ga0207641_10028944 Ga0207641_100289445 395
123 3300026116 Ga0207674_10111371 Ga0207674_101113712 395
124 3300026118 Ga0207675_100010006 Ga0207675_1000100064 395
125 3300026142 Ga0207698_10077165 Ga0207698_100771653 395
126 3300027866 Ga0209813_10000017 Ga0209813_1000001710 395
127 3300028380 Ga0268265_10006091 Ga0268265_100060914 395
128 3300028381 Ga0268264_10000087 Ga0268264_1000008754 395
129 3300028381 Ga0268264_10075810 Ga0268264_100758102 395
130 3300031548 Ga0307408_100002241 Ga0307408_1000022418 395
131 3300031901 Ga0307406_10006612 Ga0307406_100066123 395
132 3300031911 Ga0307412_10009654 Ga0307412_100096543 395
133 3300032002 Ga0307416_100017666 Ga0307416_1000176664 395
134 3300032004 Ga0307414_10025346 Ga0307414_100253463 395
135 3300047443 Ga0495687_058391 Ga0495687_058391_355_1560 395
136 3300048912 Ga0496109_0034549 Ga0496109_0034549_931_2127 395
137 3300048921 Ga0496118_0066470 Ga0496118_0066470_1122_2351 395
138 3300048924 Ga0496121_0000175 Ga0496121_0000175_141055_142251 395
139 3300048924 Ga0496121_0006008 Ga0496121_0006008_5035_6264 395
140 3300048924 Ga0496121_0007298 Ga0496121_0007298_2747_3976 395
141 3300048927 Ga0496124_0016162 Ga0496124_0016162_2719_3915 395
142 3300048929 Ga0496126_0018010 Ga0496126_0018010_2626_3855 395
143 3300050494 nmdc:mga06z11_20_c1 nmdc:mga06z11_20_c1_64982_66178 395
144 3300050495 nmdc:mga04h51_108_c1 nmdc:mga04h51_108_c1_9526_10722 395
145 3300053103 Ga0500555_001551 Ga0500555_001551_105_1319 395
146 3300053104 Ga0500556_0016218 Ga0500556_0016218_121_1335 395
147 3300005347 Ga0070668_100001508 Ga0070668_10000150811 396
148 3300005843 Ga0068860_100000083 Ga0068860_100000083112 396
149 3300006186 Ga0075369_10007618 Ga0075369_100076182 396
150 3300028381 Ga0268264_10000055 Ga0268264_10000055246 396
151 3300048927 Ga0496124_0003947 Ga0496124_0003947_16167_17372 396
152 3300049517 Ga0501294_000582 Ga0501294_000582_1344_2546 396
153 3300049663 Ga0501223_000920 Ga0501223_000920_4354_5556 396
154 3300049669 Ga0501235_003942 Ga0501235_003942_1334_2536 396
155 3300049705 Ga0501225_0000544 Ga0501225_0000544_647_1849 396
156 3300049777 Ga0501281_00019 Ga0501281_00019_632_1834 396
157 3300050516 nmdc:mga0sz30_8985_c1 nmdc:mga0sz30_8985_c1_516_1721 396
158 3300005289 Ga0065704_10077386 Ga0065704_100773862 397
159 3300005331 Ga0070670_100000213 Ga0070670_1000002137 397
160 3300005331 Ga0070670_100000281 Ga0070670_10000028131 397
161 3300005347 Ga0070668_100000049 Ga0070668_10000004942 397
162 3300005347 Ga0070668_100063895 Ga0070668_1000638952 397
163 3300005355 Ga0070671_100000805 Ga0070671_10000080518 397
164 3300005367 Ga0070667_100000009 Ga0070667_10000000934 397
165 3300005367 Ga0070667_100019497 Ga0070667_1000194973 397
166 3300005617 Ga0068859_100005926 Ga0068859_1000059264 397
167 3300005617 Ga0068859_100009455 Ga0068859_1000094555 397
168 3300005618 Ga0068864_100000594 Ga0068864_1000005941 397
169 3300005719 Ga0068861_100043716 Ga0068861_1000437162 397
170 3300005841 Ga0068863_100000844 Ga0068863_1000008441 397
171 3300005841 Ga0068863_100002413 Ga0068863_10000241311 397
172 3300005841 Ga0068863_100002799 Ga0068863_1000027997 397
173 3300005841 Ga0068863_100006025 Ga0068863_1000060257 397
174 3300005842 Ga0068858_100001456 Ga0068858_10000145624 397
175 3300005843 Ga0068860_100000042 Ga0068860_100000042224 397
176 3300005843 Ga0068860_100005481 Ga0068860_1000054814 397
177 3300005844 Ga0068862_100000411 Ga0068862_10000041110 397
178 3300005844 Ga0068862_100000675 Ga0068862_10000067511 397
179 3300005844 Ga0068862_100000822 Ga0068862_1000008221 397
180 3300005844 Ga0068862_100004247 Ga0068862_1000042473 397
181 3300006931 Ga0097620_100005926 Ga0097620_1000059264 397
182 3300006931 Ga0097620_100009455 Ga0097620_1000094556 397
183 3300009098 Ga0105245_10000666 Ga0105245_1000066626 397
184 3300009148 Ga0105243_10000267 Ga0105243_1000026736 397
185 3300009176 Ga0105242_10000676 Ga0105242_1000067627 397
186 3300009553 Ga0105249_10000053 Ga0105249_1000005365 397
187 3300011119 Ga0105246_10013042 Ga0105246_100130421 397
188 3300013296 Ga0157374_10000992 Ga0157374_100009923 397
189 3300013297 Ga0157378_10000361 Ga0157378_1000036131 397
190 3300013297 Ga0157378_10188089 Ga0157378_101880891 397
191 3300013308 Ga0157375_10001286 Ga0157375_1000128610 397
192 3300014326 Ga0157380_10175667 Ga0157380_101756672 397
193 3300014969 Ga0157376_10000197 Ga0157376_1000019742 397
194 3300025735 Ga0207713_1015994 Ga0207713_10159943 397
195 3300025900 Ga0207710_10002666 Ga0207710_100026665 397
196 3300025903 Ga0207680_10006323 Ga0207680_100063232 397
197 3300025923 Ga0207681_10005561 Ga0207681_100055616 397
198 3300025925 Ga0207650_10000285 Ga0207650_1000028522 397
199 3300025925 Ga0207650_10000766 Ga0207650_1000076618 397
200 3300025931 Ga0207644_10000088 Ga0207644_1000008826 397
201 3300025941 Ga0207711_10000022 Ga0207711_10000022280 397
202 3300025961 Ga0207712_10000045 Ga0207712_10000045110 397
203 3300025972 Ga0207668_10000077 Ga0207668_1000007741 397
204 3300025972 Ga0207668_10005903 Ga0207668_100059035 397
205 3300025986 Ga0207658_10000009 Ga0207658_10000009233 397
206 3300025986 Ga0207658_10000232 Ga0207658_100002325 397
207 3300026035 Ga0207703_10000253 Ga0207703_100002532 397
208 3300026088 Ga0207641_10000002 Ga0207641_100000021021 397
209 3300026088 Ga0207641_10001219 Ga0207641_1000121916 397
210 3300026088 Ga0207641_10001840 Ga0207641_100018404 397
211 3300026088 Ga0207641_10002424 Ga0207641_100024247 397
212 3300026095 Ga0207676_10000564 Ga0207676_1000056432 397
213 3300028380 Ga0268265_10000084 Ga0268265_1000008418 397
214 3300028380 Ga0268265_10000090 Ga0268265_1000009083 397
215 3300028380 Ga0268265_10000580 Ga0268265_100005805 397
216 3300028380 Ga0268265_10006928 Ga0268265_100069282 397
217 3300028381 Ga0268264_10000001 Ga0268264_10000001310 397
218 3300028381 Ga0268264_10000727 Ga0268264_1000072710 397
219 3300046530 Ga0495654_0000852 Ga0495654_0000852_7408_8610 397
220 3300046616 Ga0495668_0002907 Ga0495668_0002907_3879_5081 397
221 3300046794 Ga0495589_0002299 Ga0495589_0002299_8443_9645 397
222 3300048920 Ga0496117_0003195 Ga0496117_0003195_11291_12496 397
223 3300048921 Ga0496118_0001966 Ga0496118_0001966_11309_12514 397
224 3300053158 Ga0500627_0000316 Ga0500627_0000316_11780_12982 397
225 3300002459 JGI24751J29686_10000087 JGI24751J29686_1000008719 398
226 3300005295 Ga0065707_10088502 Ga0065707_100885022 398
227 3300005331 Ga0070670_100000038 Ga0070670_1000000388 398
228 3300005331 Ga0070670_100000060 Ga0070670_10000006036 398
229 3300005335 Ga0070666_10029912 Ga0070666_100299122 398
230 3300005347 Ga0070668_100054548 Ga0070668_1000545484 398
231 3300005353 Ga0070669_100000053 Ga0070669_10000005380 398
232 3300005367 Ga0070667_100007706 Ga0070667_1000077062 398
233 3300005548 Ga0070665_100000294 Ga0070665_10000029418 398
234 3300005617 Ga0068859_100126532 Ga0068859_1001265322 398
235 3300005618 Ga0068864_100000069 Ga0068864_10000006980 398
236 3300005719 Ga0068861_100095516 Ga0068861_1000955161 398
237 3300005844 Ga0068862_100000082 Ga0068862_10000008236 398
238 3300005844 Ga0068862_100000351 Ga0068862_1000003518 398
239 3300006931 Ga0097620_100126528 Ga0097620_1001265282 398
240 3300009093 Ga0105240_10013024 Ga0105240_100130244 398
241 3300009177 Ga0105248_10000101 Ga0105248_1000010161 398
242 3300009177 Ga0105248_10129112 Ga0105248_101291122 398
243 3300009553 Ga0105249_10009179 Ga0105249_100091798 398
244 3300014326 Ga0157380_10000964 Ga0157380_1000096414 398
245 3300014968 Ga0157379_10002375 Ga0157379_100023758 398
246 3300017792 Ga0163161_10110576 Ga0163161_101105761 398
247 3300025903 Ga0207680_10041097 Ga0207680_100410972 398
248 3300025913 Ga0207695_10043596 Ga0207695_100435964 398
249 3300025923 Ga0207681_10000003 Ga0207681_10000003484 398
250 3300025925 Ga0207650_10000148 Ga0207650_1000014851 398
251 3300025941 Ga0207711_10001326 Ga0207711_100013267 398
252 3300025961 Ga0207712_10084075 Ga0207712_100840753 398
253 3300025972 Ga0207668_10000222 Ga0207668_1000022219 398
254 3300025972 Ga0207668_10071584 Ga0207668_100715842 398
255 3300025986 Ga0207658_10000473 Ga0207658_100004738 398
256 3300025986 Ga0207658_10005427 Ga0207658_100054278 398
257 3300026088 Ga0207641_10002168 Ga0207641_100021688 398
258 3300026095 Ga0207676_10000009 Ga0207676_10000009486 398
259 3300026095 Ga0207676_10000513 Ga0207676_100005138 398
260 3300026118 Ga0207675_100007235 Ga0207675_10000723510 398
261 3300028379 Ga0268266_10001306 Ga0268266_100013069 398
262 3300028380 Ga0268265_10000030 Ga0268265_10000030124 398
263 3300048924 Ga0496121_0126747 Ga0496121_0126747_12_1208 398
264 3300001976 JGI24752J21851_1000276 JGI24752J21851_10002764 399
265 3300002070 JGI24750J21931_1000185 JGI24750J21931_10001858 399
266 3300002074 JGI24748J21848_1000147 JGI24748J21848_10001478 399
267 3300002239 JGI24034J26672_10000011 JGI24034J26672_10000011111 399
268 3300002244 JGI24742J22300_10004852 JGI24742J22300_100048522 399
269 3300005330 Ga0070690_100000003 Ga0070690_10000000325 399
270 3300005335 Ga0070666_10000176 Ga0070666_1000017626 399
271 3300005340 Ga0070689_100001889 Ga0070689_1000018893 399
272 3300005347 Ga0070668_100047217 Ga0070668_1000472173 399
273 3300005353 Ga0070669_100000014 Ga0070669_100000014108 399
274 3300005355 Ga0070671_100007138 Ga0070671_1000071389 399
275 3300005365 Ga0070688_100000787 Ga0070688_1000007877 399
276 3300005367 Ga0070667_100006901 Ga0070667_10000690110 399
277 3300005466 Ga0070685_10000034 Ga0070685_1000003427 399
278 3300005544 Ga0070686_100000023 Ga0070686_10000002311 399
279 3300005548 Ga0070665_100000019 Ga0070665_100000019397 399
280 3300005841 Ga0068863_100000048 Ga0068863_100000048132 399
281 3300005842 Ga0068858_100002232 Ga0068858_1000022322 399
282 3300005843 Ga0068860_100000601 Ga0068860_10000060126 399
283 3300005844 Ga0068862_100000195 Ga0068862_10000019548 399
284 3300009177 Ga0105248_10305656 Ga0105248_103056561 399
285 3300009553 Ga0105249_10000390 Ga0105249_1000039012 399
286 3300013306 Ga0163162_10090842 Ga0163162_100908422 399
287 3300014325 Ga0163163_10334395 Ga0163163_103343951 399
288 3300014326 Ga0157380_10003423 Ga0157380_100034239 399
289 3300014968 Ga0157379_10117682 Ga0157379_101176822 399
290 3300017792 Ga0163161_10002867 Ga0163161_1000286710 399
291 3300025223 Ga0207672_1000370 Ga0207672_10003705 399
292 3300025903 Ga0207680_10000081 Ga0207680_1000008112 399
293 3300025923 Ga0207681_10000045 Ga0207681_1000004514 399
294 3300025931 Ga0207644_10001924 Ga0207644_100019244 399
295 3300025941 Ga0207711_10038044 Ga0207711_100380444 399
296 3300025961 Ga0207712_10000335 Ga0207712_1000033512 399
297 3300025972 Ga0207668_10036503 Ga0207668_100365033 399
298 3300025986 Ga0207658_10002614 Ga0207658_1000261412 399
299 3300026088 Ga0207641_10000143 Ga0207641_1000014311 399
300 3300026095 Ga0207676_10006435 Ga0207676_100064353 399
301 3300028379 Ga0268266_10000025 Ga0268266_10000025108 399
302 3300028380 Ga0268265_10001046 Ga0268265_1000104617 399
303 3300028381 Ga0268264_10000608 Ga0268264_1000060812 399
304 3300046459 Ga0495629_0004957 Ga0495629_0004957_7030_8304 400
305 3300046522 Ga0495643_0026295 Ga0495643_0026295_1633_2907 400
306 3300046542 Ga0495597_0002808 Ga0495597_0002808_7337_8611 400
307 3300053109 Ga0500569_000285 Ga0500569_000285_2831_4105 400
308 3300053119 Ga0500595_006994 Ga0500595_006994_3155_4429 400
309 3300053122 Ga0500608_001715 Ga0500608_001715_4616_5890 400
310 3300053123 Ga0500614_001000 Ga0500614_001000_1350_2624 400
311 3300005364 Ga0070673_100000029 Ga0070673_10000002941 402
312 3300005459 Ga0068867_100000044 Ga0068867_10000004436 402
313 3300006042 Ga0075368_10000745 Ga0075368_1000074510 402
314 3300006178 Ga0075367_10000298 Ga0075367_1000029810 402
315 3300006881 Ga0068865_100000073 Ga0068865_10000007343 402
316 3300025927 Ga0207687_10000835 Ga0207687_100008352 402
317 3300025934 Ga0207686_10000547 Ga0207686_1000054713 402
318 3300025935 Ga0207709_10000316 Ga0207709_1000031614 402
319 3300025938 Ga0207704_10000002 Ga0207704_10000002254 402
320 3300025940 Ga0207691_10068025 Ga0207691_100680251 402
321 3300025942 Ga0207689_10001165 Ga0207689_1000116513 402
322 3300025960 Ga0207651_10000023 Ga0207651_1000002335 402
323 3300026089 Ga0207648_10000120 Ga0207648_1000012041 402
324 3300005347 Ga0070668_100004288 Ga0070668_1000042884 403
325 3300005618 Ga0068864_100007827 Ga0068864_1000078272 403
326 3300005841 Ga0068863_100000226 Ga0068863_1000002268 403
327 3300005843 Ga0068860_100000191 Ga0068860_1000001918 403
328 3300025925 Ga0207650_10000032 Ga0207650_10000032114 403
329 3300026035 Ga0207703_10000524 Ga0207703_100005245 403
330 3300028380 Ga0268265_10001602 Ga0268265_100016022 403
331 3300028381 Ga0268264_10000202 Ga0268264_100002029 403
332 3300025961 Ga0207712_10000380 Ga0207712_1000038022 407
333 3300037418 Ga0395900_0003720 Ga0395900_0003720_8289_9536 409
334 3300038443 Ga0395901_0000041 Ga0395901_0000041_26525_27772 409
335 3300005331 Ga0070670_100027802 Ga0070670_1000278024 414
336 3300005347 Ga0070668_100072091 Ga0070668_1000720912 414
337 3300005353 Ga0070669_100000135 Ga0070669_10000013560 414
338 3300005355 Ga0070671_100002205 Ga0070671_1000022054 414
339 3300005367 Ga0070667_100019606 Ga0070667_1000196064 414
340 3300005548 Ga0070665_100001239 Ga0070665_10000123914 414
341 3300005841 Ga0068863_100052421 Ga0068863_1000524213 414
342 3300005842 Ga0068858_100103637 Ga0068858_1001036371 414
343 3300005843 Ga0068860_100098756 Ga0068860_1000987562 414
344 3300005844 Ga0068862_100017872 Ga0068862_1000178723 414
345 3300025735 Ga0207713_1006690 Ga0207713_10066906 414
346 3300025923 Ga0207681_10001366 Ga0207681_1000136614 414
347 3300025931 Ga0207644_10000396 Ga0207644_1000039615 414
348 3300025941 Ga0207711_10023008 Ga0207711_100230082 414
349 3300026088 Ga0207641_10015783 Ga0207641_100157836 414
350 3300028379 Ga0268266_10001253 Ga0268266_1000125315 414
351 3300028381 Ga0268264_10013336 Ga0268264_100133364 414
352 3300047472 Ga0495686_0002133 Ga0495686_0002133_7291_8598 415
353 3300005331 Ga0070670_100231996 Ga0070670_1002319961 420
354 3300013100 Ga0157373_10086325 Ga0157373_100863252 420
355 3300025925 Ga0207650_10205964 Ga0207650_102059642 420
356 3300025986 Ga0207658_10129750 Ga0207658_101297502 420
357 3300048905 Ga0496102_0027608 Ga0496102_0027608_2257_3585 420
358 3300048906 Ga0496103_0000312 Ga0496103_0000312_43036_44364 420
359 3300048920 Ga0496117_0011830 Ga0496117_0011830_175_1503 420
360 3300048922 Ga0496119_0101677 Ga0496119_0101677_300_1562 420
361 3300001904 JGI24736J21556_1000055 JGI24736J21556_100005514 421
362 3300001979 JGI24740J21852_10004005 JGI24740J21852_100040055 421
363 3300002067 JGI24735J21928_10012432 JGI24735J21928_100124322 421
364 3300005617 Ga0068859_100145197 Ga0068859_1001451972 421
365 3300005834 Ga0068851_10111052 Ga0068851_101110521 421
366 3300006931 Ga0097620_100145185 Ga0097620_1001451851 421
367 3300013105 Ga0157369_10064930 Ga0157369_100649303 421
368 3300013307 Ga0157372_10310298 Ga0157372_103102981 421
369 3300025904 Ga0207647_10000997 Ga0207647_1000099712 421
370 3300025909 Ga0207705_10025642 Ga0207705_100256422 421
371 3300025911 Ga0207654_10005378 Ga0207654_100053784 421
372 3300025913 Ga0207695_10004104 Ga0207695_1000410410 421
373 3300025914 Ga0207671_10003091 Ga0207671_1000309111 421
374 3300025920 Ga0207649_10114531 Ga0207649_101145312 421
375 3300025924 Ga0207694_10003733 Ga0207694_100037339 421
376 3300025925 Ga0207650_10090388 Ga0207650_100903881 421
377 3300025949 Ga0207667_10003306 Ga0207667_1000330613 421
378 3300026067 Ga0207678_10053614 Ga0207678_100536142 421
379 3300026078 Ga0207702_10001123 Ga0207702_1000112314 421
380 3300026142 Ga0207698_10025967 Ga0207698_100259674 421

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l7k-assembly3.cif.gz_D structure of the wall teichoic acid polymerase tagf, h444n + cdpg (15 minute soak) 0.6782 25 406
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.677 22 128
3l7l-assembly3.cif.gz_D structure of the wall teichoic acid polymerase tagf, h444n + cdpg (30 minute soak) 0.6626 17 406
3l7i-assembly3.cif.gz_D structure of the wall teichoic acid polymerase tagf 0.6591 23 406
3fpf-assembly1.cif.gz_B crystal structure of mtnas in complex with mta and tna 0.658 13 128
ID Description Score Start End Superfamily
3otgA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6833 212 384 3.40.50.2000
af_I1M7C3_1_280_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6647 21 198 3.40.50.2000
1v4vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6644 21 151 3.40.50.2000
3uykB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6616 1 149 3.40.50.2000
2h1fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6559 214 353 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A6M8HUE0-F1-model_v4 Uncharacterized protein 0.9687 22 404
AF-A0A1G5TTA0-F1-model_v4 CDP-Glycerol:Poly(Glycerophosphate) glycerophosphotransferase 0.9676 23 407 GO:0016740
AF-A0A1G5TTA0-F1-model_v4 CDP-Glycerol:Poly(Glycerophosphate) glycerophosphotransferase 0.9651 23 407 GO:0016740
AF-A0A357LFV5-F1-model_v4 Uncharacterized protein 0.9638 236 403
AF-A0A850KQH5-F1-model_v4 Glycosyl transferase 0.9602 21 409

Feature Viewer

pLDDT pTM Quality
81.31 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map