F428564

General Info

Members Datasets Scaffolds Average Seq Length
380 214 760 373

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100333373|Ga0070671_1003333731
Length 409
Sequence VVARGLWTHGWRKDGAQLMAEPSALGDSHSVSERKQVPLGELALFFLRLGTTAFGGPAAHIAIMEDELVRRRQWLSSEKFLDLLGASNLIPGPSSSELAIHIGYLCAGWRGLLIAGICFILPAALMVVGLGWLYVRFGRLPATAGILYGIKPVVIGIVLKALWSLGLTAVRTTFFGFLAVLSLLLSVLGLHPLLVLLLAGGVACVTTVKSWRVSAAALPSVAIGGATFATAASFSLLSLFLVFLKLGATVFGSGYVLLAFLRADLVTHRGWLTDGQLLDAVAVGQVTPGPVFTTATFIGFILGGSRGAVLATVGIFLPAFLLVAVSGPLVPRIRKSKTAGAFLDGVNVASLALMAAVTWQLGRASLVDALTVLLAVASLIALVRYRVNSAWLVLVGAIIGLITIALHLR

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 3.16
Rhizosphere 93.16
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100333373 3300005355 Unclassified 1293
2 JGI24751J29686_10009836 3300002459 Unclassified 1971
3 Ga0070658_10002084 3300005327 Bacteria 16753
4 Ga0070658_10095652 3300005327 Bacteria 2452
5 Ga0070658_10155201 3300005327 Unclassified 1919
6 Ga0070683_100011485 3300005329 Bacteria 7660
7 Ga0070683_100047877 3300005329 Bacteria 3952
8 Ga0070683_100216197 3300005329 Bacteria 1821
9 Ga0070670_100008126 3300005331 Bacteria 8931
10 Ga0068869_100010917 3300005334 Bacteria 5944
11 Ga0068869_100098487 3300005334 Unclassified 2209
12 Ga0070680_100077364 3300005336 Bacteria 2740
13 Ga0068868_100039658 3300005338 Unclassified 3660
14 Ga0070689_100006404 3300005340 Bacteria 8144
15 Ga0070661_100005272 3300005344 Bacteria 8906
16 Ga0070661_100022564 3300005344 Archaea 4507
17 Ga0070671_100000195 3300005355 Bacteria 40544
18 Ga0070688_100027911 3300005365 Bacteria 3364
19 Ga0070688_100161026 3300005365 Unclassified 1542
20 Ga0070714_100238097 3300005435 Bacteria 1679
21 Ga0070713_100020130 3300005436 Bacteria 5110
22 Ga0070711_100145877 3300005439 Bacteria 1780
23 Ga0070708_100020716 3300005445 Bacteria 5552
24 Ga0070708_100186128 3300005445 Bacteria 1942
25 Ga0070663_100005282 3300005455 Bacteria 7661
26 Ga0070681_10061437 3300005458 Bacteria 3732
27 Ga0070681_10095334 3300005458 Bacteria 2924
28 Ga0070699_100409817 3300005518 Bacteria 1226
29 Ga0070679_100021814 3300005530 Bacteria 6255
30 Ga0070679_100139360 3300005530 Bacteria 2406
31 Ga0070684_100006237 3300005535 Bacteria 9203
32 Ga0068853_100000459 3300005539 Bacteria 27826
33 Ga0068853_100006778 3300005539 Bacteria 9128
34 Ga0070672_100003255 3300005543 Bacteria 10511
35 Ga0070665_100093053 3300005548 Bacteria 3019
36 Ga0070704_100102236 3300005549 Bacteria 2162
37 Ga0068855_100001498 3300005563 Bacteria 29248
38 Ga0068855_100067033 3300005563 Bacteria 4184
39 Ga0068855_100079688 3300005563 Bacteria 3798
40 Ga0070664_100009665 3300005564 Bacteria 7825
41 Ga0068857_100008640 3300005577 Bacteria 8814
42 Ga0068854_100024899 3300005578 Bacteria 4103
43 Ga0068854_100128529 3300005578 Bacteria 1932
44 Ga0068856_100027678 3300005614 Bacteria 5531
45 Ga0068856_100030992 3300005614 Bacteria 5231
46 Ga0068856_100032895 3300005614 Bacteria 5078
47 Ga0068856_100120992 3300005614 Bacteria 2619
48 Ga0068856_100284930 3300005614 Unclassified 1669
49 Ga0068852_100000028 3300005616 Bacteria 113383
50 Ga0068859_100012953 3300005617 Bacteria 8378
51 Ga0068859_100014308 3300005617 Bacteria 7959
52 Ga0068859_100054942 3300005617 Bacteria 4006
53 Ga0068864_100000009 3300005618 Bacteria 373756
54 Ga0068864_100027210 3300005618 Bacteria 4827
55 Ga0068864_100159593 3300005618 Bacteria 2049
56 Ga0068866_10007118 3300005718 Unclassified 4677
57 Ga0068861_100078300 3300005719 Bacteria 2581
58 Ga0068861_100142130 3300005719 Unclassified 1960
59 Ga0068851_10039714 3300005834 Bacteria 2364
60 Ga0068863_100028501 3300005841 Bacteria 5332
61 Ga0068863_100048452 3300005841 Unclassified 4029
62 Ga0068863_100057268 3300005841 Bacteria 3688
63 Ga0068858_100002288 3300005842 Bacteria 19394
64 Ga0068858_100003365 3300005842 Bacteria 15924
65 Ga0068860_100003868 3300005843 Bacteria 15385
66 Ga0068860_100007727 3300005843 Bacteria 10747
67 Ga0068860_100061640 3300005843 Bacteria 3563
68 Ga0068862_100002090 3300005844 Bacteria 18007
69 Ga0075428_100000052 3300006844 Bacteria 92602
70 Ga0075428_100003718 3300006844 Bacteria 16720
71 Ga0075428_100023181 3300006844 Bacteria 6867
72 Ga0075428_100065342 3300006844 Bacteria 3984
73 Ga0075430_100002039 3300006846 Bacteria 16657
74 Ga0075430_100057088 3300006846 Bacteria 3284
75 Ga0075430_100091962 3300006846 Bacteria 2537
76 Ga0075431_100009057 3300006847 Bacteria 9981
77 Ga0075431_100014361 3300006847 Bacteria 8009
78 Ga0075431_100019343 3300006847 Bacteria 6941
79 Ga0075431_100119155 3300006847 Bacteria 2723
80 Ga0075431_100468356 3300006847 Bacteria 1254
81 Ga0075433_10026399 3300006852 Bacteria 4917
82 Ga0075429_100000016 3300006880 Bacteria 76591
83 Ga0075429_100050445 3300006880 Bacteria 3620
84 Ga0068865_100184993 3300006881 Bacteria 1607
85 Ga0097620_100012951 3300006931 Bacteria 8378
86 Ga0097620_100014308 3300006931 Bacteria 7959
87 Ga0097620_100054944 3300006931 Bacteria 4006
88 Ga0105240_10009444 3300009093 Bacteria 13809
89 Ga0111539_10012928 3300009094 Bacteria 10446
90 Ga0111539_10269414 3300009094 Bacteria 1982
91 Ga0111539_10377084 3300009094 Bacteria 1651
92 Ga0111539_10382221 3300009094 Bacteria 1639
93 Ga0105245_10024829 3300009098 Archaea 5266
94 Ga0105245_10204246 3300009098 Bacteria 1899
95 Ga0114129_10000756 3300009147 Bacteria 41145
96 Ga0114129_10032526 3300009147 Bacteria 7371
97 Ga0114129_10038124 3300009147 Bacteria 6781
98 Ga0114129_10058397 3300009147 Bacteria 5396
99 Ga0114129_10368026 3300009147 Unclassified 1901
100 Ga0105243_10211778 3300009148 Bacteria 1707
101 Ga0105241_10000162 3300009174 Bacteria 48662
102 Ga0105242_10187853 3300009176 Bacteria 1827
103 Ga0105248_10004381 3300009177 Bacteria 15618
104 Ga0105248_10014165 3300009177 Bacteria 8779
105 Ga0105237_10001833 3300009545 Bacteria 27378
106 Ga0105238_10000373 3300009551 Bacteria 48142
107 Ga0105238_10005053 3300009551 Bacteria 13040
108 Ga0105239_10000774 3300010375 Bacteria 45307
109 Ga0105239_10016564 3300010375 Bacteria 8147
110 Ga0105239_10126685 3300010375 Bacteria 2838
111 Ga0157369_10011205 3300013105 Bacteria 10191
112 Ga0157374_10006104 3300013296 Bacteria 10197
113 Ga0157374_10011855 3300013296 Bacteria 7561
114 Ga0157374_10286320 3300013296 Unclassified 1628
115 Ga0157378_10000088 3300013297 Bacteria 86642
116 Ga0157378_10000759 3300013297 Bacteria 30184
117 Ga0157378_10005992 3300013297 Bacteria 10655
118 Ga0157378_10026037 3300013297 Bacteria 5156
119 Ga0163162_10050264 3300013306 Unclassified 4181
120 Ga0163162_10073424 3300013306 Unclassified 3476
121 Ga0163162_10145085 3300013306 Bacteria 2489
122 Ga0157372_10001123 3300013307 Bacteria 29091
123 Ga0157375_10000152 3300013308 Bacteria 67342
124 Ga0157375_10008078 3300013308 Bacteria 9205
125 Ga0157375_10087388 3300013308 Bacteria 3170
126 Ga0163163_10008912 3300014325 Bacteria 8937
127 Ga0157377_10096018 3300014745 Bacteria 1758
128 Ga0157379_10068953 3300014968 Unclassified 3162
129 Ga0157376_10003703 3300014969 Bacteria 10560
130 Ga0157376_10020160 3300014969 Bacteria 5153
131 Ga0213872_10000182 3300021361 Bacteria 56427
132 Ga0213875_10010920 3300021388 Bacteria 4537
133 Ga0228598_1002961 3300024227 Bacteria 3686
134 Ga0207705_10047218 3300025909 Bacteria 3096
135 Ga0207705_10078087 3300025909 Unclassified 2409
136 Ga0207705_10137759 3300025909 Bacteria 1821
137 Ga0207684_10059054 3300025910 Bacteria 3256
138 Ga0207654_10000199 3300025911 Bacteria 37066
139 Ga0207707_10064574 3300025912 Bacteria 3187
140 Ga0207707_10086825 3300025912 Bacteria 2733
141 Ga0207707_10128375 3300025912 Bacteria 2217
142 Ga0207695_10000598 3300025913 Bacteria 72240
143 Ga0207671_10000238 3300025914 Bacteria 82806
144 Ga0207649_10005202 3300025920 Bacteria 7030
145 Ga0207694_10000089 3300025924 Bacteria 103520
146 Ga0207650_10000090 3300025925 Bacteria 118973
147 Ga0207687_10109998 3300025927 Bacteria 2043
148 Ga0207664_10322244 3300025929 Bacteria 1364
149 Ga0207644_10008882 3300025931 Bacteria 6583
150 Ga0207670_10044575 3300025936 Bacteria 2935
151 Ga0207704_10087569 3300025938 Bacteria 2034
152 Ga0207691_10023612 3300025940 Bacteria 5790
153 Ga0207711_10012762 3300025941 Bacteria 6979
154 Ga0207711_10025935 3300025941 Bacteria 4916
155 Ga0207689_10018084 3300025942 Bacteria 5952
156 Ga0207689_10109049 3300025942 Unclassified 2275
157 Ga0207661_10013638 3300025944 Bacteria 5934
158 Ga0207661_10182308 3300025944 Bacteria 1835
159 Ga0207679_10004219 3300025945 Bacteria 8929
160 Ga0207667_10016716 3300025949 Bacteria 8277
161 Ga0207667_10092816 3300025949 Bacteria 3118
162 Ga0207667_10345050 3300025949 Bacteria 1519
163 Ga0207651_10063549 3300025960 Bacteria 2578
164 Ga0207651_10173761 3300025960 Bacteria 1702
165 Ga0207640_10021686 3300025981 Bacteria 3832
166 Ga0207640_10240456 3300025981 Unclassified 1399
167 Ga0207703_10021079 3300026035 Bacteria 5099
168 Ga0207639_10000103 3300026041 Bacteria 70103
169 Ga0207639_10013354 3300026041 Bacteria 5748
170 Ga0207678_10011367 3300026067 Bacteria 7812
171 Ga0207702_10000476 3300026078 Bacteria 45021
172 Ga0207702_10095343 3300026078 Bacteria 2614
173 Ga0207702_10149209 3300026078 Bacteria 2125
174 Ga0207641_10001842 3300026088 Bacteria 20372
175 Ga0207641_10009208 3300026088 Bacteria 8144
176 Ga0207641_10022367 3300026088 Bacteria 5205
177 Ga0207676_10000061 3300026095 Bacteria 117370
178 Ga0207676_10001861 3300026095 Bacteria 15457
179 Ga0207674_10016343 3300026116 Bacteria 8129
180 Ga0207674_10169669 3300026116 Bacteria 2136
181 Ga0207675_100193409 3300026118 Bacteria 1952
182 Ga0207698_10000384 3300026142 Bacteria 25551
183 Ga0207698_10352914 3300026142 Bacteria 1390
184 Ga0265356_1000106 3300028017 Bacteria 14350
185 Ga0268266_10009624 3300028379 Bacteria 8499
186 Ga0268265_10001246 3300028380 Bacteria 22002
187 Ga0268264_10002992 3300028381 Bacteria 14672
188 Ga0268264_10023158 3300028381 Bacteria 5068
189 Ga0268264_10093620 3300028381 Unclassified 2596
190 Ga0265337_1018356 3300028556 Unclassified 2224
191 Ga0265337_1030448 3300028556 Unclassified 1607
192 Ga0265319_1024154 3300028563 Unclassified 2191
193 Ga0265319_1041811 3300028563 Unclassified 1544
194 Ga0265318_10000589 3300028577 Bacteria 25509
195 Ga0265318_10002234 3300028577 Bacteria 10439
196 Ga0265323_10008328 3300028653 Bacteria 4281
197 Ga0265338_10002479 3300028800 Bacteria 27575
198 Ga0265338_10029415 3300028800 Bacteria 5447
199 Ga0265338_10064603 3300028800 Bacteria 3181
200 Ga0265338_10132384 3300028800 Bacteria 1966
201 Ga0265324_10000154 3300029957 Bacteria 52801
202 Ga0265760_10000138 3300031090 Bacteria 18344
203 Ga0265330_10009986 3300031235 Bacteria 4493
204 Ga0265330_10017242 3300031235 Bacteria 3329
205 Ga0265320_10000244 3300031240 Bacteria 44846
206 Ga0265320_10002190 3300031240 Bacteria 13737
207 Ga0265320_10006159 3300031240 Bacteria 7595
208 Ga0265325_10001158 3300031241 Bacteria 18894
209 Ga0265325_10007497 3300031241 Bacteria 6522
210 Ga0265325_10035938 3300031241 Bacteria 2627
211 Ga0265325_10091221 3300031241 Bacteria 1502
212 Ga0265329_10006344 3300031242 Unclassified 4696
213 Ga0265329_10007959 3300031242 Bacteria 4057
214 Ga0265329_10013832 3300031242 Bacteria 2865
215 Ga0265339_10000070 3300031249 Bacteria 88938
216 Ga0265339_10015829 3300031249 Unclassified 4512
217 Ga0265331_10000025 3300031250 Bacteria 229346
218 Ga0265331_10011202 3300031250 Bacteria 4919
219 Ga0265331_10024128 3300031250 Bacteria 3081
220 Ga0265316_10004280 3300031344 Bacteria 14247
221 Ga0265316_10015141 3300031344 Bacteria 6755
222 Ga0265316_10024818 3300031344 Bacteria 5011
223 Ga0265316_10036281 3300031344 Bacteria 3987
224 Ga0265316_10084249 3300031344 Bacteria 2434
225 Ga0307513_10038689 3300031456 Bacteria 5295
226 Ga0307509_10015016 3300031507 Bacteria 9069
227 Ga0307509_10022298 3300031507 Bacteria 7145
228 Ga0265313_10000642 3300031595 Bacteria 36031
229 Ga0265313_10001920 3300031595 Bacteria 18868
230 Ga0265313_10009484 3300031595 Bacteria 6315
231 Ga0307508_10008757 3300031616 Bacteria 9340
232 Ga0265314_10058703 3300031711 Bacteria 2636
233 Ga0265314_10066465 3300031711 Bacteria 2432
234 Ga0265342_10000839 3300031712 Bacteria 30776
235 Ga0265342_10024895 3300031712 Bacteria 3771
236 Ga0307516_10026863 3300031730 Bacteria 5843
237 Ga0307416_100025776 3300032002 Bacteria 4318
238 Ga0307416_100026465 3300032002 Bacteria 4275
239 Ga0307411_10010915 3300032005 Bacteria 4871
240 Ga0307415_100006475 3300032126 Bacteria 6323
241 Ga0373926_0000720 3300035083 Bacteria 9157
242 Ga0373926_0004472 3300035083 Unclassified 4585
243 Ga0373936_0000002 3300035113 Bacteria 452874
244 Ga0373936_0151352 3300035113 Bacteria 1006
245 Ga0373945_0004057 3300035116 Unclassified 4634
246 Ga0373954_0003869 3300035118 Bacteria 6407
247 Ga0373954_0083970 3300035118 Unclassified 1524
248 Ga0373954_0119808 3300035118 Bacteria 1277
249 Ga0373956_0000930 3300035119 Bacteria 12152
250 Ga0373956_0021170 3300035119 Bacteria 2772
251 Ga0373955_0008665 3300035172 Bacteria 4733
252 Ga0373924_0009685 3300035410 Unclassified 3540
253 Ga0373935_0001603 3300035692 Bacteria 12611
254 Ga0373935_0006890 3300035692 Bacteria 6783
255 Ga0373927_0057681 3300035695 Bacteria 2511
256 Ga0373947_0000214 3300035725 Bacteria 32593
257 Ga0373947_0023440 3300035725 Bacteria 3590
258 Ga0373937_0001149 3300036401 Bacteria 22191
259 Ga0373937_0014329 3300036401 Bacteria 6999
260 Ga0373937_0069924 3300036401 Bacteria 3237
261 Ga0373937_0105035 3300036401 Bacteria 2624
262 Ga0373937_0139241 3300036401 Bacteria 2270
263 Ga0373937_0182588 3300036401 Bacteria 1970
264 Ga0373925_0011767 3300037068 Bacteria 6331
265 Ga0436364_0500845 3300037853 Bacteria 4758
266 Ga0436364_0960040 3300037853 Bacteria 3138
267 Ga0395901_0237410 3300038443 Unclassified 1902
268 Ga0436365_0502110 3300039437 Bacteria 8205
269 Ga0436365_0931262 3300039437 Bacteria 10519
270 Ga0436361_0126076 3300039447 Bacteria 97470
271 Ga0436363_1276007 3300039450 Bacteria 1552
272 Ga0439435_0007825 3300042436 Bacteria 2462
273 Ga0451577_0272084 3300042876 Bacteria 1534
274 Ga0466969_0003123 3300044656 Bacteria 8826
275 Ga0466966_0096740 3300044684 Bacteria 1828
276 Ga0453684_0000095 3300044712 Bacteria 378681
277 Ga0453684_0000128 3300044712 Bacteria 335864
278 Ga0453684_0020304 3300044712 Bacteria 10030
279 Ga0453684_0090088 3300044712 Bacteria 3791
280 Ga0466959_0030440 3300045049 Bacteria 3997
281 Ga0451576_0000543 3300045051 Bacteria 81057
282 Ga0451576_0004375 3300045051 Bacteria 18422
283 Ga0495592_0026676 3300046454 Bacteria 4379
284 Ga0495592_0112861 3300046454 Bacteria 1921
285 Ga0495651_0000473 3300046462 Bacteria 30974
286 Ga0495651_0008558 3300046462 Bacteria 7841
287 Ga0495653_0008231 3300046463 Bacteria 8545
288 Ga0495653_0010811 3300046463 Bacteria 7471
289 Ga0495653_0188702 3300046463 Bacteria 1408
290 Ga0495580_0014107 3300046472 Bacteria 6074
291 Ga0495580_0029754 3300046472 Unclassified 3962
292 Ga0495580_0081307 3300046472 Bacteria 2258
293 Ga0495664_0021614 3300046477 Bacteria 3717
294 Ga0495664_0098852 3300046477 Bacteria 1757
295 Ga0495608_0043320 3300046511 Bacteria 3007
296 Ga0495628_0032309 3300046516 Bacteria 4226
297 Ga0495628_0082848 3300046516 Bacteria 2491
298 Ga0495630_0004793 3300046517 Bacteria 9491
299 Ga0495630_0010782 3300046517 Bacteria 6599
300 Ga0495630_0069467 3300046517 Bacteria 2650
301 Ga0495652_0003963 3300046529 Bacteria 14340
302 Ga0495652_0028483 3300046529 Bacteria 4914
303 Ga0495586_0038541 3300046535 Bacteria 2568
304 Ga0495587_0001252 3300046536 Bacteria 16858
305 Ga0495587_0009741 3300046536 Bacteria 6142
306 Ga0495645_0010050 3300046543 Bacteria 6629
307 Ga0495645_0072387 3300046543 Bacteria 2484
308 Ga0495645_0082596 3300046543 Bacteria 2304
309 Ga0495667_0002882 3300046559 Bacteria 11526
310 Ga0495667_0004585 3300046559 Bacteria 9340
311 Ga0495635_0081486 3300046663 Bacteria 2214
312 Ga0495657_0025809 3300046675 Unclassified 4169
313 Ga0495657_0030180 3300046675 Bacteria 3798
314 Ga0495599_0005554 3300046678 Bacteria 7562
315 Ga0495623_0002333 3300046679 Bacteria 12650
316 Ga0495646_0007326 3300046680 Bacteria 7010
317 Ga0495613_0000649 3300046689 Bacteria 27637
318 Ga0495613_0097941 3300046689 Bacteria 2119
319 Ga0495624_0004079 3300046690 Bacteria 10739
320 Ga0495600_0006891 3300046809 Bacteria 6931
321 Ga0495604_0005156 3300047317 Bacteria 10346
322 Ga0495674_0038848 3300047319 Bacteria 4270
323 Ga0495674_0040752 3300047319 Unclassified 4152
324 Ga0495674_0071003 3300047319 Bacteria 3007
325 Ga0495680_0000075 3300047322 Bacteria 86720
326 Ga0495680_0004523 3300047322 Bacteria 13286
327 Ga0495680_0009716 3300047322 Bacteria 8634
328 Ga0495675_0000186 3300047444 Bacteria 45392
329 Ga0495675_0003910 3300047444 Bacteria 9021
330 Ga0495675_0068740 3300047444 Bacteria 2237
331 Ga0495675_0102993 3300047444 Bacteria 1785
332 Ga0495684_0001734 3300047471 Bacteria 17536
333 Ga0495684_0010223 3300047471 Bacteria 7259
334 Ga0495684_0020054 3300047471 Bacteria 5150
335 Ga0495593_0001315 3300047673 Bacteria 14553
336 Ga0495602_0064876 3300048088 Bacteria 3154
337 Ga0495602_0065774 3300048088 Bacteria 3127
338 Ga0495614_0001954 3300048089 Bacteria 9060
339 Ga0496102_0076356 3300048905 Unclassified 3082
340 Ga0496103_0031859 3300048906 Bacteria 3216
341 Ga0496104_0224606 3300048907 Bacteria 1790
342 Ga0496106_0345133 3300048909 Bacteria 1196
343 Ga0496108_0006867 3300048911 Bacteria 9210
344 Ga0496109_0009013 3300048912 Bacteria 8499
345 Ga0496111_0052906 3300048914 Bacteria 2933
346 Ga0496112_0009072 3300048915 Bacteria 8936
347 Ga0496112_0013164 3300048915 Bacteria 7633
348 Ga0496113_0000006 3300048916 Bacteria 101670
349 Ga0496114_0000022 3300048917 Bacteria 219236
350 Ga0496114_0162089 3300048917 Bacteria 1945
351 Ga0501034_0105260 3300049571 Bacteria 2814
352 Ga0501036_0230692 3300049572 Bacteria 1554
353 Ga0501040_0098794 3300049576 Bacteria 2034
354 Ga0501042_0156499 3300049578 Bacteria 1644
355 Ga0501075_0022709 3300049591 Bacteria 4585
356 Ga0501075_0136122 3300049591 Bacteria 1871
357 Ga0501076_0007393 3300049592 Bacteria 7994
358 Ga0501079_0064967 3300049741 Bacteria 2815
359 Ga0501081_0022426 3300049743 Bacteria 4225
360 Ga0501045_0088380 3300049824 Bacteria 2289
361 Ga0501045_0101619 3300049824 Bacteria 2129
362 Ga0501045_0145452 3300049824 Bacteria 1763
363 nmdc:mga05p37_12998_c1 3300050507 Bacteria 7364
364 nmdc:mga05p37_42341_c1 3300050507 Bacteria 5595
365 nmdc:mga09592_156431_c1 3300050508 Bacteria 1968
366 nmdc:mga09592_2734_c1 3300050508 Bacteria 14257
367 nmdc:mga09592_3630_c1 3300050508 Bacteria 12450
368 nmdc:mga0qj67_113982_c1 3300050509 Bacteria 2183
369 nmdc:mga06r32_151741_c1 3300050510 Bacteria 2296
370 nmdc:mga08y16_206955_c1 3300050511 Bacteria 2032
371 nmdc:mga08y16_60596_c1 3300050511 Bacteria 3952
372 nmdc:mga0a205_14131_c1 3300050515 Bacteria 7450
373 Ga0495601_0099027 3300053077 Bacteria 1882
374 Ga0495612_0004461 3300053078 Bacteria 5807
375 Ga0500635_0020418 3300053080 Bacteria 2029
376 Ga0500566_0014409 3300053094 Bacteria 4649
377 Ga0500603_001471 3300053150 Bacteria 5377
378 Ga0501082_0226851 3300060353 Bacteria 1626
379 Ga0530510_0006928 3300061734 Bacteria 7900
380 Ga0530510_0066926 3300061734 Bacteria 2606
381 Ga0070671_100333373
382 JGI24751J29686_10009836
383 Ga0070658_10002084
384 Ga0070658_10095652
385 Ga0070658_10155201
386 Ga0070683_100011485
387 Ga0070683_100047877
388 Ga0070683_100216197
389 Ga0070670_100008126
390 Ga0068869_100010917
391 Ga0068869_100098487
392 Ga0070680_100077364
393 Ga0068868_100039658
394 Ga0070689_100006404
395 Ga0070661_100005272
396 Ga0070661_100022564
397 Ga0070671_100000195
398 Ga0070688_100027911
399 Ga0070688_100161026
400 Ga0070714_100238097
401 Ga0070713_100020130
402 Ga0070711_100145877
403 Ga0070708_100020716
404 Ga0070708_100186128
405 Ga0070663_100005282
406 Ga0070681_10061437
407 Ga0070681_10095334
408 Ga0070699_100409817
409 Ga0070679_100021814
410 Ga0070679_100139360
411 Ga0070684_100006237
412 Ga0068853_100000459
413 Ga0068853_100006778
414 Ga0070672_100003255
415 Ga0070665_100093053
416 Ga0070704_100102236
417 Ga0068855_100001498
418 Ga0068855_100067033
419 Ga0068855_100079688
420 Ga0070664_100009665
421 Ga0068857_100008640
422 Ga0068854_100024899
423 Ga0068854_100128529
424 Ga0068856_100027678
425 Ga0068856_100030992
426 Ga0068856_100032895
427 Ga0068856_100120992
428 Ga0068856_100284930
429 Ga0068852_100000028
430 Ga0068859_100012953
431 Ga0068859_100014308
432 Ga0068859_100054942
433 Ga0068864_100000009
434 Ga0068864_100027210
435 Ga0068864_100159593
436 Ga0068866_10007118
437 Ga0068861_100078300
438 Ga0068861_100142130
439 Ga0068851_10039714
440 Ga0068863_100028501
441 Ga0068863_100048452
442 Ga0068863_100057268
443 Ga0068858_100002288
444 Ga0068858_100003365
445 Ga0068860_100003868
446 Ga0068860_100007727
447 Ga0068860_100061640
448 Ga0068862_100002090
449 Ga0075428_100000052
450 Ga0075428_100003718
451 Ga0075428_100023181
452 Ga0075428_100065342
453 Ga0075430_100002039
454 Ga0075430_100057088
455 Ga0075430_100091962
456 Ga0075431_100009057
457 Ga0075431_100014361
458 Ga0075431_100019343
459 Ga0075431_100119155
460 Ga0075431_100468356
461 Ga0075433_10026399
462 Ga0075429_100000016
463 Ga0075429_100050445
464 Ga0068865_100184993
465 Ga0097620_100012951
466 Ga0097620_100014308
467 Ga0097620_100054944
468 Ga0105240_10009444
469 Ga0111539_10012928
470 Ga0111539_10269414
471 Ga0111539_10377084
472 Ga0111539_10382221
473 Ga0105245_10024829
474 Ga0105245_10204246
475 Ga0114129_10000756
476 Ga0114129_10032526
477 Ga0114129_10038124
478 Ga0114129_10058397
479 Ga0114129_10368026
480 Ga0105243_10211778
481 Ga0105241_10000162
482 Ga0105242_10187853
483 Ga0105248_10004381
484 Ga0105248_10014165
485 Ga0105237_10001833
486 Ga0105238_10000373
487 Ga0105238_10005053
488 Ga0105239_10000774
489 Ga0105239_10016564
490 Ga0105239_10126685
491 Ga0157369_10011205
492 Ga0157374_10006104
493 Ga0157374_10011855
494 Ga0157374_10286320
495 Ga0157378_10000088
496 Ga0157378_10000759
497 Ga0157378_10005992
498 Ga0157378_10026037
499 Ga0163162_10050264
500 Ga0163162_10073424
501 Ga0163162_10145085
502 Ga0157372_10001123
503 Ga0157375_10000152
504 Ga0157375_10008078
505 Ga0157375_10087388
506 Ga0163163_10008912
507 Ga0157377_10096018
508 Ga0157379_10068953
509 Ga0157376_10003703
510 Ga0157376_10020160
511 Ga0213872_10000182
512 Ga0213875_10010920
513 Ga0228598_1002961
514 Ga0207705_10047218
515 Ga0207705_10078087
516 Ga0207705_10137759
517 Ga0207684_10059054
518 Ga0207654_10000199
519 Ga0207707_10064574
520 Ga0207707_10086825
521 Ga0207707_10128375
522 Ga0207695_10000598
523 Ga0207671_10000238
524 Ga0207649_10005202
525 Ga0207694_10000089
526 Ga0207650_10000090
527 Ga0207687_10109998
528 Ga0207664_10322244
529 Ga0207644_10008882
530 Ga0207670_10044575
531 Ga0207704_10087569
532 Ga0207691_10023612
533 Ga0207711_10012762
534 Ga0207711_10025935
535 Ga0207689_10018084
536 Ga0207689_10109049
537 Ga0207661_10013638
538 Ga0207661_10182308
539 Ga0207679_10004219
540 Ga0207667_10016716
541 Ga0207667_10092816
542 Ga0207667_10345050
543 Ga0207651_10063549
544 Ga0207651_10173761
545 Ga0207640_10021686
546 Ga0207640_10240456
547 Ga0207703_10021079
548 Ga0207639_10000103
549 Ga0207639_10013354
550 Ga0207678_10011367
551 Ga0207702_10000476
552 Ga0207702_10095343
553 Ga0207702_10149209
554 Ga0207641_10001842
555 Ga0207641_10009208
556 Ga0207641_10022367
557 Ga0207676_10000061
558 Ga0207676_10001861
559 Ga0207674_10016343
560 Ga0207674_10169669
561 Ga0207675_100193409
562 Ga0207698_10000384
563 Ga0207698_10352914
564 Ga0265356_1000106
565 Ga0268266_10009624
566 Ga0268265_10001246
567 Ga0268264_10002992
568 Ga0268264_10023158
569 Ga0268264_10093620
570 Ga0265337_1018356
571 Ga0265337_1030448
572 Ga0265319_1024154
573 Ga0265319_1041811
574 Ga0265318_10000589
575 Ga0265318_10002234
576 Ga0265323_10008328
577 Ga0265338_10002479
578 Ga0265338_10029415
579 Ga0265338_10064603
580 Ga0265338_10132384
581 Ga0265324_10000154
582 Ga0265760_10000138
583 Ga0265330_10009986
584 Ga0265330_10017242
585 Ga0265320_10000244
586 Ga0265320_10002190
587 Ga0265320_10006159
588 Ga0265325_10001158
589 Ga0265325_10007497
590 Ga0265325_10035938
591 Ga0265325_10091221
592 Ga0265329_10006344
593 Ga0265329_10007959
594 Ga0265329_10013832
595 Ga0265339_10000070
596 Ga0265339_10015829
597 Ga0265331_10000025
598 Ga0265331_10011202
599 Ga0265331_10024128
600 Ga0265316_10004280
601 Ga0265316_10015141
602 Ga0265316_10024818
603 Ga0265316_10036281
604 Ga0265316_10084249
605 Ga0307513_10038689
606 Ga0307509_10015016
607 Ga0307509_10022298
608 Ga0265313_10000642
609 Ga0265313_10001920
610 Ga0265313_10009484
611 Ga0307508_10008757
612 Ga0265314_10058703
613 Ga0265314_10066465
614 Ga0265342_10000839
615 Ga0265342_10024895
616 Ga0307516_10026863
617 Ga0307416_100025776
618 Ga0307416_100026465
619 Ga0307411_10010915
620 Ga0307415_100006475
621 Ga0373926_0000720
622 Ga0373926_0004472
623 Ga0373936_0000002
624 Ga0373936_0151352
625 Ga0373945_0004057
626 Ga0373954_0003869
627 Ga0373954_0083970
628 Ga0373954_0119808
629 Ga0373956_0000930
630 Ga0373956_0021170
631 Ga0373955_0008665
632 Ga0373924_0009685
633 Ga0373935_0001603
634 Ga0373935_0006890
635 Ga0373927_0057681
636 Ga0373947_0000214
637 Ga0373947_0023440
638 Ga0373937_0001149
639 Ga0373937_0014329
640 Ga0373937_0069924
641 Ga0373937_0105035
642 Ga0373937_0139241
643 Ga0373937_0182588
644 Ga0373925_0011767
645 Ga0436364_0500845
646 Ga0436364_0960040
647 Ga0395901_0237410
648 Ga0436365_0502110
649 Ga0436365_0931262
650 Ga0436361_0126076
651 Ga0436363_1276007
652 Ga0439435_0007825
653 Ga0451577_0272084
654 Ga0466969_0003123
655 Ga0466966_0096740
656 Ga0453684_0000095
657 Ga0453684_0000128
658 Ga0453684_0020304
659 Ga0453684_0090088
660 Ga0466959_0030440
661 Ga0451576_0000543
662 Ga0451576_0004375
663 Ga0495592_0026676
664 Ga0495592_0112861
665 Ga0495651_0000473
666 Ga0495651_0008558
667 Ga0495653_0008231
668 Ga0495653_0010811
669 Ga0495653_0188702
670 Ga0495580_0014107
671 Ga0495580_0029754
672 Ga0495580_0081307
673 Ga0495664_0021614
674 Ga0495664_0098852
675 Ga0495608_0043320
676 Ga0495628_0032309
677 Ga0495628_0082848
678 Ga0495630_0004793
679 Ga0495630_0010782
680 Ga0495630_0069467
681 Ga0495652_0003963
682 Ga0495652_0028483
683 Ga0495586_0038541
684 Ga0495587_0001252
685 Ga0495587_0009741
686 Ga0495645_0010050
687 Ga0495645_0072387
688 Ga0495645_0082596
689 Ga0495667_0002882
690 Ga0495667_0004585
691 Ga0495635_0081486
692 Ga0495657_0025809
693 Ga0495657_0030180
694 Ga0495599_0005554
695 Ga0495623_0002333
696 Ga0495646_0007326
697 Ga0495613_0000649
698 Ga0495613_0097941
699 Ga0495624_0004079
700 Ga0495600_0006891
701 Ga0495604_0005156
702 Ga0495674_0038848
703 Ga0495674_0040752
704 Ga0495674_0071003
705 Ga0495680_0000075
706 Ga0495680_0004523
707 Ga0495680_0009716
708 Ga0495675_0000186
709 Ga0495675_0003910
710 Ga0495675_0068740
711 Ga0495675_0102993
712 Ga0495684_0001734
713 Ga0495684_0010223
714 Ga0495684_0020054
715 Ga0495593_0001315
716 Ga0495602_0064876
717 Ga0495602_0065774
718 Ga0495614_0001954
719 Ga0496102_0076356
720 Ga0496103_0031859
721 Ga0496104_0224606
722 Ga0496106_0345133
723 Ga0496108_0006867
724 Ga0496109_0009013
725 Ga0496111_0052906
726 Ga0496112_0009072
727 Ga0496112_0013164
728 Ga0496113_0000006
729 Ga0496114_0000022
730 Ga0496114_0162089
731 Ga0501034_0105260
732 Ga0501036_0230692
733 Ga0501040_0098794
734 Ga0501042_0156499
735 Ga0501075_0022709
736 Ga0501075_0136122
737 Ga0501076_0007393
738 Ga0501079_0064967
739 Ga0501081_0022426
740 Ga0501045_0088380
741 Ga0501045_0101619
742 Ga0501045_0145452
743 nmdc:mga05p37_12998_c1
744 nmdc:mga05p37_42341_c1
745 nmdc:mga09592_156431_c1
746 nmdc:mga09592_2734_c1
747 nmdc:mga09592_3630_c1
748 nmdc:mga0qj67_113982_c1
749 nmdc:mga06r32_151741_c1
750 nmdc:mga08y16_206955_c1
751 nmdc:mga08y16_60596_c1
752 nmdc:mga0a205_14131_c1
753 Ga0495601_0099027
754 Ga0495612_0004461
755 Ga0500635_0020418
756 Ga0500566_0014409
757 Ga0500603_001471
758 Ga0501082_0226851
759 Ga0530510_0006928
760 Ga0530510_0066926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

237

401

0.97

PF02417

Chromate_transp

Chromate transporter

40

205

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.308 65 388
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.3038 65 388
7xlm-assembly1.cif.gz_B human diastrophic dysplasia sulfate transporter slc26a2 0.2947 3 389
7xlm-assembly1.cif.gz_B human diastrophic dysplasia sulfate transporter slc26a2 0.2915 3 389
8e6l-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter d296a mutant in an inward-open, manganese-bound state 0.2913 65 382
ID Description Score Start End Superfamily
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3634 11 387 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3618 11 387 1.20.1740.10
af_A4ICC3_65_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3078 60 384 1.20.1740.10
af_Q5AIA8_39_528_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2902 61 388 1.20.1740.10
af_K7K8J1_75_296_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.2835 62 348 1.20.1510.10
ID Description Score Start End GO Terms
AF-A0A2V6RGZ9-F1-model_v4 Chromate transporter 0.9808 18 111 GO:0005886
GO:0015109
AF-A0A1F8L2I3-F1-model_v4 Chromate transporter 0.9547 21 385 GO:0005886
GO:0015109
AF-A0A2H5ZYF4-F1-model_v4 Putative chromate transport protein 0.9518 46 388 GO:0005886
GO:0015109
AF-A0A3C0R026-F1-model_v4 Chromate transporter 0.9468 15 101 GO:0005886
GO:0015109
AF-A0A7V6SU87-F1-model_v4 Chromate efflux transporter 0.946 17 383 GO:0005886
GO:0015109

Map